The URL can be used to link to this page

Home My WebLink AboutContract 53424-PM1FORT WORTH PROJECT MANUAL FOR CITY SEC ETARY coNrRAcrNo. Soqa4-eM, THE CONSTRUCTION OF Lakes of River Trails East Phase 17 A Water, Sanitary Sewer, Sturm Wuter, Pa ving , and Lighting Improvements IPRC No. -19-0187 City Project No. -102275 FID No. -30114-0200431-102275-E07685 X-No. -X-26183 Betsy Price Mayor F ile No. -W-2657 Christopher P . Harder Director, Water Department William Johnson. David Cooke City Manager Director, Transportatio n and Public Works Departme nt Prepared for CKK Residential Group, II Ltd. 2550 South Precinct Line Road Fort Worth, TX 76181 Icon Consulting Engineers, Inc. 2840 W. Sou thlake Blvd., Ste 110 Southlake, Texas 76092 EFRN F-900 7 CllY SECRETA 00 00 10- 1 TABLE OF CONTENTS FOR DEVELOPER AWARDED PROJECTS Page 1 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised September 1, 2015 SECTION 00 00 10 1 TABLE OF CONTENTS 2 DEVELOPER AWARDED PROJECTS 3 4 Division 00 - General Conditions 5 00 11 13 Invitation to Bidders 6 00 21 13 Instructions to Bidders 7 00 41 00 Bid Form 8 00 42 43 Proposal Form Unit Price 9 00 43 13 Bid Bond 10 00 45 11 Bidders Prequalification’s 11 00 45 12 Prequalification Statement 12 00 45 13 Bidder Prequalification Application 13 00 45 26 Contractor Compliance with Workers' Compensation Law 14 00 45 40 Minority Business Enterprise Goal 15 00 52 43 Agreement 16 00 61 25 Certificate of Insurance 17 00 62 13 Performance Bond 18 00 62 14 Payment Bond 19 00 62 19 Maintenance Bond 20 00 72 00 General Conditions 21 00 73 00 Supplementary Conditions 22 00 73 10 Standard City Conditions of the Construction Contract for Developer Awarded 23 Projects 24 25 Division 01 - General Requirements 26 01 11 00 Summary of Work 27 01 25 00 Substitution Procedures 28 01 31 19 Preconstruction Meeting 29 01 31 20 Project Meetings 30 01 32 16 Construction Progress Schedule 31 01 32 33 Preconstruction Video 32 01 33 00 Submittals 33 01 35 13 Special Project Procedures 34 01 45 23 Testing and Inspection Services 35 01 50 00 Temporary Facilities and Controls 36 01 55 26 Street Use Permit and Modifications to Traffic Control 37 01 57 13 Storm Water Pollution Prevention Plan 38 01 58 13 Temporary Project Signage 39 01 60 00 Product Requirements 40 01 66 00 Product Storage and Handling Requirements 41 01 70 00 Mobilization and Remobilization 42 01 71 23 Construction Staking 43 01 74 23 Cleaning 44 01 77 19 Closeout Requirements 45 01 78 23 Operation and Maintenance Data 46 01 78 39 Project Record Documents 47 Technical Specifications which have been modified by the Engineer specifically for this 48 Project; hard copies are included in the Project’s Contract Documents 49 00 00 10- 2 TABLE OF CONTENTS FOR DEVELOPER AWARDED PROJECTS Page 2 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised September 1, 2015 None 1 2 Technical Specifications listed below are included for this Project by reference and can be 3 viewed/downloaded from the City’s Buzzsaw site at: 4 5 htps://projectpoint.buzzsaw.com/client/fortworthgov/Resources/02%20-6 %20Construction%20Documents/Specifications 7 8 Division 02 - Existing Conditions 9 02 41 13 Selective Site Demolition 10 02 41 14 Utility Removal/Abandonment 11 02 41 15 Paving Removal 12 13 Division 03 - Concrete 14 03 30 00 Cast-In-Place Concrete 15 03 34 13 Controlled Low Strength Material (CLSM) 16 03 34 16 Concrete Base Material for Trench Repair 17 03 80 00 Modifications to Existing Concrete Structures 18 19 Division 26 - Electrical 20 26 05 00 Common Work Results for Electrical 21 26 05 10 Demolition for Electrical Systems 22 26 05 33 Raceway and Boxes for Electrical Systems 23 26 05 43 Underground Ducts and Raceways for Electrical Systems 24 25 Division 31 - Earthwork 26 31 10 00 Site Clearing 27 31 23 16 Unclassified Excavation 28 31 23 23 Borrow 29 31 24 00 Embankments 30 31 25 00 Erosion and Sediment Control 31 31 36 00 Gabions 32 31 37 00 Riprap 33 34 Division 32 - Exterior Improvements 35 32 01 17 Permanent Asphalt Paving Repair 36 32 01 18 Temporary Asphalt Paving Repair 37 32 01 29 Concrete Paving Repair 38 32 11 23 Flexible Base Courses 39 32 11 29 Lime Treated Base Courses 40 32 11 33 Cement Treated Base Courses 41 32 12 16 Asphalt Paving 42 32 12 73 Asphalt Paving Crack Sealants 43 32 13 13 Concrete Paving 44 32 13 20 Concrete Sidewalks, Driveways and Barrier Free Ramps 45 32 13 73 Concrete Paving Joint Sealants 46 32 14 16 Brick Unit Paving 47 32 16 13 Concrete Curb and Gutters and Valley Gutters 48 32 17 23 Pavement Markings 49 32 31 13 Chain Link Fences and Gates 50 00 00 10- 3 TABLE OF CONTENTS FOR DEVELOPER AWARDED PROJECTS Page 3 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised September 1, 2015 32 31 26 Wire Fences and Gates 1 32 31 29 Wood Fences and Gates 2 32 32 13 Cast-in-Place Concrete Retaining Walls 3 32 91 19 Topsoil Placement and Finishing of Parkways 4 32 92 13 Hydro-Mulching, Seeding, and Sodding 5 32 93 43 Trees and Shrubs 6 7 Division 33 - Utilities 8 33 01 30 Sewer and Manhole Testing 9 33 01 31 Closed Circuit Television (CCTV) Inspection 10 33 03 10 Bypass Pumping of Existing Sewer Systems 11 33 04 10 Joint Bonding and Electrical Isolation 12 33 04 11 Corrosion Control Test Stations 13 33 04 12 Magnesium Anode Cathodic Protection System 14 33 04 30 Temporary Water Services 15 33 04 40 Cleaning and Acceptance Testing of Water Mains 16 33 05 10 Utility Trench Excavation, Embedment, and Backfill 17 33 05 12 Water Line Lowering 18 33 05 13 Frame, Cover and Grade Rings 19 33 05 14 Adjusting Manholes, Inlets, Valve Boxes, and Other Structures to Grade 20 33 05 16 Concrete Water Vaults 21 33 05 17 Concrete Collars 22 33 05 20 Auger Boring 23 33 05 21 Tunnel Liner Plate 24 33 05 22 Steel Casing Pipe 25 33 05 23 Hand Tunneling 26 33 05 24 Installation of Carrier Pipe in Casing or Tunnel Liner Plate 27 33 05 26 Utility Markers/Locators 28 33 05 30 Exploratory Excavation for Existing Utilities 29 33 11 10 Ductile Iron Pipe 30 33 11 11 Ductile Iron Fittings 31 33 11 12 Polyvinyl Chloride (PVC) Pressure Pipe 32 33 11 13 Concrete Pressure Pipe, Bar-Wrapped, Steel Cylinder Type 33 33 11 14 Buried Steel Pipe and Fittings 34 33 11 15 Pre-stressed Concrete Cylinder Pipe 35 33 12 10 Water Services 1-inch to 2-inch 36 33 12 11 Large Water Meters 37 33 12 20 Resilient Seated Gate Valve 38 33 12 21 AWWA Rubber-Seated Butterfly Valves 39 33 12 25 Connection to Existing Water Mains 40 33 12 30 Combination Air Valve Assemblies for Potable Water Systems 41 33 12 40 Dry-Barrel Fire Hydrants 42 33 12 50 Water Sample Stations 43 33 12 60 Blow-off Valves 44 33 31 12 Cured in Place Pipe (CIPP) 45 33 31 13 Fiberglass Reinforced Pipe for Gravity Sanitary Sewers 46 33 31 15 HDPE Pipe For Sanitary Sewers (Gravity and Force Mains) 47 33 31 20 Polyvinyl Chloride (PVC) Gravity Sanitary Sewer Pipe 48 33 31 21 Polyvinyl Chloride (PVC) Closed Profile Gravity Sanitary Sewer Pipe 49 33 31 22 Sanitary Sewer Slip Lining 50 00 00 10- 4 TABLE OF CONTENTS FOR DEVELOPER AWARDED PROJECTS Page 4 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised September 1, 2015 33 31 23 Sanitary Sewer Pipe Enlargement 1 33 31 50 Sanitary Sewer Service Connections and Service Line 2 33 31 70 Combination Air Valve for Sanitary Sewer Force Mains 3 33 39 10 Cast-in-Place Concrete Manholes 4 33 39 20 Precast Concrete Manholes 5 33 39 30 Fiberglass Manholes 6 33 39 40 Wastewater Access Chamber (WAC) 7 33 39 60 Epoxy Liners for Sanitary Sewer Structures 8 33 41 10 Reinforced Concrete Storm Sewer Pipe/Culverts 9 33 41 11 HDPE Storm Sewer Pipe 10 33 46 00 Sub drainage 11 33 46 01 Slotted Storm Drains 12 33 46 02 Trench Drains 13 33 49 10 Cast-in-Place Manholes and Junction Boxes 14 33 49 20 Curb and Drop Inlets 15 33 49 40 Storm Drainage Headwalls and Wingwalls 16 17 Division 34 – Transportation 18 34 41 10 Traffic Signals 19 34 41 13 Removing Traffic Signals 20 34 41 20 Roadway Illumination Assemblies 21 34 41 30 Aluminum Signs 22 34 71 13 Traffic Control 23 24 25 26 Appendix 27 GC-4.01 Availability of Lands 28 GC-4.02 Subsurface and Physical Conditions 29 GC-4.04 Underground Facilities 30 GC-4.06 Hazardous Environmental Condition at Site 31 GC-6.06.D Minority and Women Owned Business Enterprise Compliance 32 GC-6.07 Wage Rates 33 GC-6.09 Permits and Utilities 34 GC-6.24 Nondiscrimination 35 GR-01 60 00 Product Requirements 36 City of Fort Worth Water Department Standard Products 37 38 END OF SECTION 39 00 42 43 DAP - BID PROPOSAL Page 1 of 7 1 3311.0261 8" PVC Water Pipe 33 11 12 LF 1777 $28.50 $50,644.50 2 3311.0161 6" PVC Water Pipe 33 11 12 LF 130 $24.25 $3,152.50 3 3311.0161 4" PVC Water Pipe 33 11 12 LF 21 $21.50 $451.50 4 3312.3003 8" Gate Valve 33 12 20 EA 11 $1,200.00 $13,200.00 5 3312.3002 6" Gate Valve 33 12 20 EA 5 $850.00 $4,250.00 6 3311.0001 Ductile Iron Water Fittings w/ Restraint 33 11 11 Ton 2 $4,750.00 $9,500.00 7 3312.2003 1" Water Service 33 12 10 EA 20 $825.00 $16,500.00 8 3312.2203 2" Water Service 33 12 10 EA 3 $1,975.00 $5,925.00 9 3305.0109 Trench Safety 33 05 10 LF 1928 $0.25 $482.00 10 3312.4112 16" x 8" Tapping Sleeve & Valve 33 12 25 EA 1 $6,100.00 $6,100.00 11 3201.0122 5' Wide Asphalt Pvmt Repair, Arterial 32 01 17 LF 63 $130.00 $8,190.00 12 3471.0001 Traffic Control 34 71 13 MO 1 $2,000.00 $2,000.00 13 3305.0116 Concrete Encasement for Utility Pipes 35 05 10 CY 3 $155.00 $465.00 SECTION 00 42 43 Developer Awarded Projects - PROPOSAL FORM Bidder's Proposal Description TOTAL UNIT I: WATER IMPROVEMENTS $120,860.50 Bid Quantity Unit Price Bid Value Project Item Information UNIT PRICE BID Bidder's Application Specification Section No. Unit of Measure Bidlist Item No. UNIT I: WATER IMPROVEMENTS CITY OF FORT WORTH STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS - DEVELOPER AWARDED PROJECTS Form Version April 2, 2014 00 42 43_Bid Proposal_DAP cfa 00 42 43 DAP - BID PROPOSAL Page 2 of 7 SECTION 00 42 43 Developer Awarded Projects - PROPOSAL FORM Bidder's Proposal Description Bid Quantity Unit Price Bid Value Project Item Information UNIT PRICE BID Bidder's Application Specification Section No. Unit of Measure Bidlist Item No. 1 3331.4115 8" Sewer Pipe 33 11 10, 33 31 1 LF 1187 $35.00 $41,545.00 2 3331.4116 8" Sewer Pipe w/CSS Backfill 33 11 10, 33 31 1 LF 60 $55.00 $3,300.00 3 3331.4115 6" Sewer Pipe 33 11 10, 33 31 1 LF 21 $32.50 $682.50 4 3339.1001 4' Manhole 33 39 10, 33 39 2 EA 4 $4,250.00 $17,000.00 5 3339.0001 Epoxy Liner for Manhole 33 39 60 VF 25 $370.00 $9,250.00 6 3331.3101 4" Sewer Service 33 31 50 EA 20 $675.00 $13,500.00 7 3301.0101 Manhole Vacuum Testing 33 01 30 EA 4 $140.00 $560.00 8 3301.0002 Post-CCTV Inspection 33 01 31 LF 1268 $2.70 $3,423.60 9 3305.0109 Trench Safety 33 05 10 LF 1268 $0.75 $951.00 10 3305.0116 Concrete Encasement for Utility Pipes 33 05 10 CY 3 $155.00 $465.00 UNIT II: SANITARY SEWER IMPROVEMENTS TOTAL UNIT II: SANITARY SEWER IMPROVEMENTS $90,677.10 CITY OF FORT WORTH STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS - DEVELOPER AWARDED PROJECTS Form Version April 2, 2014 00 42 43_Bid Proposal_DAP cfa 00 42 43 DAP - BID PROPOSAL Page 3 of 7 SECTION 00 42 43 Developer Awarded Projects - PROPOSAL FORM Bidder's Proposal Description Bid Quantity Unit Price Bid Value Project Item Information UNIT PRICE BID Bidder's Application Specification Section No. Unit of Measure Bidlist Item No. 1 3349.5001 10' Curb Inlet 33 49 20 EA 2 $5,950.00 $11,900.00 2 3349.5002 15' Curb Inlet 33 49 20 EA 2 $8,000.00 $16,000.00 3 3341.0409 48" RCP, Class III 33 41 10 LF 110 $212.00 $23,320.00 4 3341.0309 36" RCP, Class III 33 41 10 LF 455 $150.00 $68,250.00 5 3341.0302 30" RCP, Class III 33 41 10 LF 250 $112.00 $28,000.00 6 3341.0201 21" RCP, Class III 33 41 10 LF 42 $70.00 $2,940.00 7 3349.0002 5' Storm Junction Box 33 49 10 EA 2 $6,200.00 $12,400.00 8 3349.1011 48" Flared Headwall, 1 pipe 33 49 40 EA 1 $6,350.00 $6,350.00 9 3137.0104 Medium Stone Riprap, dry 31 37 00 SY 42 $69.00 $2,898.00 10 3305.0109 Trench Safety 33 05 10 LF 911 $0.75 $683.25 11 3349.2005 30" Parallel Headwall, 1 pipe 33 49 40 EA 1 $3,875.00 $3,875.00 $176,616.25 UNIT III: DRAINAGE IMPROVEMENTS TOTAL UNIT III: DRAINAGE IMPROVEMENTS CITY OF FORT WORTH STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS - DEVELOPER AWARDED PROJECTS Form Version April 2, 2014 00 42 43_Bid Proposal_DAP cfa 00 42 43 DAP - BID PROPOSAL Page 4 of 7 SECTION 00 42 43 Developer Awarded Projects - PROPOSAL FORM Bidder's Proposal Description Bid Quantity Unit Price Bid Value Project Item Information UNIT PRICE BID Bidder's Application Specification Section No. Unit of Measure Bidlist Item No. 1 3213.0101 7" Conc Pvmt 32 13 13 SY 7521 $54.60 $410,646.60 2 3211.0502 8" Lime Treatment 32 11 29 SY 7928 $2.50 $19,820.00 3 3211.0400 Hydrated Lime 32 11 29 TON 142.704 $191.00 $27,256.46 4 3213.0501 Barrier Free Ramp, Type R-1 32 13 20 EA 4 $3,000.00 $12,000.00 5 3213.0501 Barrier Free Ramp, Type M-1 32 13 20 EA 2 $4,000.00 $8,000.00 6 3305.0107 Manhole Adjustment, Minor 33 05 14 EA 4 $450.00 $1,800.00 7 3305.0111 Valve Box Adjustment 33 05 15 EA 17 $200.00 $3,400.00 8 3471.0001 Traffic Control (Dead End Barricade) 34 71 13 EA 1 $2,500.00 $2,500.00 9 3213.0301 4" Conc Sidewalk 32 13 20 SF 10280 $5.00 $51,400.00 10 9999.0001 Traffic Signs / Pavement Markings LS 1 $5,025.00 $5,025.00 11 3471.0001 General Traffic Control 34 71 13 MO 3 $2,000.00 $6,000.00 12 3292.0400 Seeding, Hydromulch 32 92 13 SY 2900 $0.30 $870.00 13 3291.0100 Topsoil 32 91 19 CY 480 $12.00 $5,760.00 14 3137.0104 Medium Stone Riprap, dry 31 37 00 SY 42 $175.00 $7,350.00 15 0241.1300 Remove Conc Curb&Gutter 02 41 15 LF 76 $15.00 $1,140.00 UNIT IV: PAVING IMPROVEMENTS TOTAL UNIT IV: PAVING IMPROVEMENTS $562,968.06 CITY OF FORT WORTH STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS - DEVELOPER AWARDED PROJECTS Form Version April 2, 2014 00 42 43_Bid Proposal_DAP cfa 00 42 43 DAP - BID PROPOSAL Page 5 of 7 SECTION 00 42 43 Developer Awarded Projects - PROPOSAL FORM Bidder's Proposal Description Bid Quantity Unit Price Bid Value Project Item Information UNIT PRICE BID Bidder's Application Specification Section No. Unit of Measure Bidlist Item No. 1 3441.3301 Rdwy Illum Foundation TY 1,2, and 4 34 41 20 EA 10 $650.00 $6,500.00 2 3441.3002 Rdwy Illum Assmbly TY 8,11,D-25, and D-30 34 41 20 EA 10 $1,900.00 $19,000.00 3 3441.3104 150W MH PC Lighting Fixture 34 41 20 EA 10 $405.00 $4,050.00 4 2605.3015 2" CONDT PVC SCH 80 (T) 26 05 33 LF 1331 $8.00 $10,648.00 5 3441.1409 NO 8 Insulated Elec Condr 34 41 10 LF 1331 $6.75 $8,984.25 $49,182.25 UNIT V: STREET LIGHTING IMPROVEMENTS TOTAL UNIT V: STREET LIGHTING IMPROVEMENTS CITY OF FORT WORTH STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS - DEVELOPER AWARDED PROJECTS Form Version April 2, 2014 00 42 43_Bid Proposal_DAP cfa 00 42 43 DAP - BID PROPOSAL Page 6 of 7 SECTION 00 42 43 Developer Awarded Projects - PROPOSAL FORM Bidder's Proposal Description Bid Quantity Unit Price Bid Value Project Item Information UNIT PRICE BID Bidder's Application Specification Section No. Unit of Measure Bidlist Item No. TOTAL UNIT VI: TRAFFIC SIGNAL IMPROVEMENTS UNIT VI: TRAFFIC SIGNAL IMPROVEMENTS CITY OF FORT WORTH STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS - DEVELOPER AWARDED PROJECTS Form Version April 2, 2014 00 42 43_Bid Proposal_DAP cfa 00 42 43 DAP - BID PROPOSAL Page 7 of 7 SECTION 00 42 43 Developer Awarded Projects - PROPOSAL FORM Bidder's Proposal Description Bid Quantity Unit Price Bid Value Project Item Information UNIT PRICE BID Bidder's Application Specification Section No. Unit of Measure Bidlist Item No. 90 END OF SECTION UNIT I: WATER IMPROVEMENTS Bid Summary Contractor agrees to complete WORK for FINAL ACCEPTANCE within calendar days after the date when the CONTRACT commences to run as provided in the General Conditions. $1,000,304.16Total Construction Bid UNIT VI: TRAFFIC SIGNAL IMPROVEMENTS $90,677.10 $176,616.25 $562,968.06 $49,182.25 $120,860.50 UNIT II: SANITARY SEWER IMPROVEMENTS UNIT III: DRAINAGE IMPROVEMENTS UNIT IV: PAVING IMPROVEMENTS UNIT V: STREET LIGHTING IMPROVEMENTS CITY OF FORT WORTH STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS - DEVELOPER AWARDED PROJECTS Form Version April 2, 2014 00 42 43_Bid Proposal_DAP cfa WATER IMPROVEMENTS NEW DEVELOPMENT - OPEN TRENCH ALL SIZES WASTEWATER IMPROVEMENTS NEW DEVELOPMENT - OPEN TRENCH ALL SIZES 00 42 43 DAP - BID PROPOSAL Page 1 of 7 SECTION 00 42 43 Developer Awarded Projects - PROPOSAL FORM UNIT PRICE BID Project Item Information Bidlist Item Description No. UNIT I: WA 1 3311.0261 8" PVC Water Pipe 2 3311.0161 6" PVC Water Pipe 3 3311.0161 4" PVC Water Pipe 4 3312.3003 8" Gate Valve 5 3312.3002 6" Gate Valve 6 3311.0001 Ductile Iron Water Fittings w/ Restraint 7 3312.2003 1" Water Service 8 3312.2203 2" Water Service 9 3305.0109 Trench Safety 10 3312.4112 16" x 8" Tapping Sleeve & Valve 11 13201.0122 5' Wide Asphalt Pvmt Repair, Arterial 12 13471.0001 Traffic Control 13 13305.0116 Concrete Encasement for Utilitv Pines Bidder's Application Bidder's Proposal Specification Section No, Unit of Measure Bid Quantity Unit Price Bid Value IMPROVEMENTS 33 11 12 LF 1777 $28.50 $50,644.50 33 11 12 LF 130 $24.25 $3,152.50 33 11 12 LF 21 $21.50 $451.50 331220 EA 11 $1,200.00 $13,200.00 33 1220 EA 5 $850.00 $4,250.00 33 11 11 Ton 2 $4,750.00 $9,500.00 33 12 10 EA 20 $825.00 $16,500.00 33 12 10 EA 3 $1,975.00 $5,925.00 33 05 10 LF 1928 $0.25 $482.00 33 1225 EA 1 $6,100.001 $6,100.00 3201 17 LF 63 $130.001 $8,190.00 3471 13 MO 1 $2,000.001 $2,000.00 3505 10 Cy 3 $155.00 $465.00 $120,860.50 CITY OF FORT WORTH STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS - DEVELOPER AWARDED PROJECTS Form Version April 2, 2014 Untitled-12 00 42 43 DAP - BID PROPOSAL Page 2 of 7 SECTION 00 42 43 Developer Awarded Projects - PROPOSAL FORM UNIT PRICE BID Bidder's Application Project Item Information Bidder's Proposal Bidlist Item No Description Specification Section No. Unit of Measure Bid Quantity Unit Price Bid Value UNIT II: SANITARY SEWER IMPROVEMENTS 1 3331.4115 8" Sewer Pie 33 11 10,33 31 1 LF 1187 $35.00 $41,545.00 2 3331.4116 8" Sewer Pipe w/CSS Backfill 33 11 10,33 31 1 LF 60 $55.00 $3,300.00 3 3331.4115 6" Sewer Pipe 33 11 10,33 31 1 LF 21 $32.50 $682.50 4 3339.1001 4' Manhole 33 39 10, 33 39 EA 4 $4,250.00 $17,000.00 5 3339.0001 Epoxy Liner for Manhole 33 39 60 VF 25 $370.00 $9,250.00 6 3331.3101 4" Sewer Service 3331 50 EA 20 $675.00 $13,500.00 7 3301.0101 Manhole Vacuum Testing 33 01 30 EA 4 $140.00 $560.00 8 3301.0002 Post -CCTV Inspection 33 0131 LF 1268 $2.70 $3,423.60 9 3305.0109 Trench Safety 33 05 10 LF 1268 $0.75 $951.00 10 3305.0116 Concrete Encasement for Utilitv PiDes 33 05 10 Cy 3 $155.00 $465.00 CITY OF FORT WORTH STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS - DEVELOPER AWARDED PROJECTS Form Version April 2, 2014 Untitled-12 00 42 43 DAP - BID PROPOSAL Page 3 of 7 SECTION 00 42 43 Developer Awarded Projects - PROPOSAL FORM UNIT PRICE BID Bidder's Application Project Item Information Bidders Proposal Bidlist Item No. Description Specification Section No. Unit of Measure Bid Quantity Unit Price Bid Value UNIT III: DRAINAGE IMPROVEMENTS 1 3349.5001 10' Curb Inlet 33 49 20 EA 2 $5,950.00 $11,900.00 2 3349.5002 15' Curb Inlet 33 49 20 EA 2 $8,000.00 $16,000.00 3 3341.0409 48" RCP, Class Ill 3341 10 LF 110 $212.00 $23,320.00 4 3341.0309 36" RCP, Class III 3341 10 LF 455 $150.00 $68,250.00 5 3341.0302 30" RCP, Class III 3341 10 LF 250 $112.00 $28,000.00 6 3341.0201 21" RCP, Class 111 3341 10 LF 42 $70.001 $2,940.00 7 3349.0002 5' Storm Junction Box 3349 10 EA 2 $6,200.00 $12,400.00 8 3349.1011 48" Flared Headwall, 1 pipe 33 49 40 EA 1 $6,350.00 $6,350.00 9 3137.0104 Medium Stone Ri rap, dry 31 37 00 Sy 42 $69.00 $2,898.00 10 3305.0109 Trench Safety 33 05 10 LF 911 $0.75 $683.25 11 3349.2005 30" Parallel Headwall, 1 pipe 33 49 40 EA 1 $3,875.00 $3,875.00 $176,616.25 CITY OF FORT WORTH STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS - DEVELOPER AWARDED PROJECTS Form Version April 2, 2014 Untitled-I2 0045 12 DAP PREQUALIFICATION STATEMENT Page I of 1 SECTION 00 45 12 DAP - PREQUALIFICATION STATEMENT Each Bidder is required to complete the information below by identifying the prequalified contractors and/or subcontractors whom they intend to utilize for the major work type(s) listed. In the "Major Work Type" box provide the complete maior work type and actual description as provided by the Water Department for water and sewer and TPW for paving. Major Work Type Contractor/Subcontractor Company Name Prequalification Ex iration Date Water New Development Open Walker Utilities 1 /31 /2021 Cuts (all sizes); Wastewater New Development Open Cuts (all sizes) The undersigned hereby certifies that the contractors and/or subcontractors described in the table above are currently prequalified for the work types listed. BIDDER: Walker Utilities, Inc. BY: Brandon Walker 124 Brown Trail Hurst, Texas 76053 (Signature) TITLE: Vice President DATE: /-3(- 26 END OF SECTION CITY OF FORT WORTH STANDARD CONSTRUCTION PREQUALIFICATION STATEMENT— DEVELOPER AWARDED PROJECTS Form Version September 1, 2015 004512 Prequalification Statement 201S_DAP Utilities 00 45 26 CONTRACTOR COMPLIANCE WITH WORKER'S COMPENSATION LAW Page I of I SECTION 00 45 26 CONTRACTOR COMPLIANCE WITH WORKER'S COMPENSATION LAW Pursuant to Texas Labor Code Section 406.096(a), as amended, Contractor certifies that it provides worker's compensation insurance coverage for all of its employees employed on City Project No. 102275. Contractor further certifies that, pursuant to Texas Labor Code, Section 406.096(b), as amended, it will provide to City its subcontractor's certificates of compliance with worker's compensation coverage. CONTRACTOR: Walker Utilities Inc. In Company 1 z-4 $fpW �2i / Signature: Address �u1s5-� 1-x r?6D 53 City/State/Zip THE STATE OF TEXAS § COUNTY OF TARRANT § ��AACIor� �4I�1� (Please Print) Dvr�— ._ Title: V ij,Clr— fj-e-51dt4'T- (Please Print) BEFORE ME, the undersigned authority, on this day personally appeared 91'4no4n 14-gl't/ , known to me to be the person whose name is subscribed to the foregoing in trument, and acknowledged to me that he/she executed the same as the act and deed of U j CL%si for the purposes and consideration therein expressed and in the capacity therein stated. GIVEN UNDER MY HAND AND SEAL OF OFFICE this Decc&cr , 20_8. E.M JASON ESCOBEDO Notary Public, State of Texas Comm. Expires 02-26-2021n0`` Notary ID 126811961 30 -9 day of Notary Ic in and for the State of Texas END OF SECTION CITY OF FORT WORTH STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS Revised April 2, 2014 Lakes of River Trails East Phase I T/I 102275 mxa" 1130111119*X1 j 2 00 52 43 - 1 Developer Awarded Project Agreement Page 1 of 4 3 THIS AGREEMENT, authorized on December 30, 2019 is made by and between the Developer, 4 CKK Residential Group, II Ltd., authorized to do business in Texas ("Developer"), and Walker 5 Utilities, authorized to do business in Texas, acting by and through its duly authorized 6 representative, ("Contractor"). 7 Developer and Contractor, in consideration of the mutual covenants hereinafter set forth, agree as 8 follows: 9 Article 1. WORK 10 Contractor shall complete all Work as specified or indicated in the Contract Documents for the 11 Project identified herein. 12 Article 2. PROJECT 13 The project for which the Work under the Contract Documents may be the whole or only a part is 14 generally described as follows: 15 Lakes of River Trails East Phase 17A 16 City Project No.—102275; X No. — X- 26183; FID No. — 30114-0200431-102275-EO7685 17 File No. — W-265 7 18 Article 3. CONTRACT TIME 19 3.1 Time is of the essence. 20 All time limits for Milestones, if any, and Final Acceptance as stated in the Contract 21 Documents are of the essence to this Contract. 22 3.2 Final Acceptance. 23 The Work will be complete for Final Acceptance within 120 calendar days after the date 24 when the Contract Time commences to run as provided in Paragraph 12.04 of the Standard 25 City Conditions of the Construction Contract for Developer Awarded Projects. 26 3.3 Liquidated damages 27 Contractor recognizes that time is of the essence of this Agreement and that Developer 28 will suffer financial loss if the Work is not completed within the times specified in 29 Paragraph 3.2 above, plus any extension thereof allowed in accordance with Article 10 of 30 the Standard City Conditions of the Construction Contract for Developer Awarded 31 Projects. The Contractor also recognizes the delays, expense and difficulties involved in 32 proving in a legal proceeding the actual loss suffered by the Developer if the Work is not 33 completed on time. Accordingly, instead of requiring any such proof , Contractor agrees 34 that as liquidated damages for delay (but not as a penalty), Contractor shall pay 35 Developer One thousand Dollars ($1,000.00) for each day that expires after the time 36 specified in Paragraph 3.2 for Final Acceptance until the City issues the Final Letter of 37 Acceptance. CITY OF FORT WORTH Lakes of River Trails East Phase 17,4 STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS — DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised June 16, 2016 00 52 43 - 2 Developer Awarded Project Agreement Page 2 of 4 38 Article 4. CONTRACT PRICE 39 Developer agrees to pay Contractor for performance of the Work in accordance with the Contract 40 Documents an amount in current funds of Three hundred eighty-eight thousand one hundred fifty 41 three Dollars and eighty-five cents ($388,153.85 ). 42 Article 5. CONTRACT DOCUMENTS 43 5.1 CONTENTS: 44 A. The Contract Documents which comprise the entire agreement between Developer and 45 Contractor concerning the Work consist of the following: 46 1. This Agreement. 47 2. Attachments to this Agreement: 48 a. Bid Form (As provided by Developer) 49 1) Proposal Form (DAP Version) 50 2) Prequalification Statement 51 3) State and Federal documents (project specific) 52 b. Insurance ACORD Form(s) 53 c. Payment Bond (DAP Version) 54 d. Performance Bond (DAP Version) 55 e. Maintenance Bond (DAP Version) 56 f. Power of Attorney for the Bonds 57 g. Worker's Compensation Affidavit 58 h. MBE and/or SBE Commitment Form (If required) 59 3. Standard City General Conditions of the Construction Contract for Developer 60 Awarded Projects. 61 4. Supplementary Conditions. 62 5. Specifications specifically made a part of the Contract Documents by attachment 63 or, if not attached, as incorporated by reference and described in the Table of 64 Contents of the Project's Contract Documents. 65 6. Drawings. 66 7. Addenda. 67 8. Documentation submitted by Contractor prior to Notice of Award. 68 9. The following which may be delivered or issued after the Effective Date of the 69 Agreement and, if issued, become an incorporated part of the Contract Documents: 70 a. Notice to Proceed. 71 b. Field Orders. 72 c. Change Orders. 73 d. Letter of Final Acceptance. 74 75 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS — DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised June 16, 2016 00 52 43 - 3 Developer Awarded Project Agreement Page 3 of 4 76 Article 6. INDEMNIFICATION 77 6.1 Contractor covenants and agrees to indemnify, hold harmless and defend, at its own 78 expense, the city, its officers, servants and employees, from and against any and all 79 claims arising out of, or alleged to arise out of, the work and services to be performed 80 by the contractor, its officers, agents, employees, subcontractors, licenses or invitees 81 under this contract. This indemnification provision is specifically intended to operate 82 and be effective even if it is alleged or proven that all or some of the damages being 83 sought were caused, in whole or in part, by any act, omission or negligence of the city. 84 This indemnity provision is intended to include, without limitation, indemnity for 85 costs, expenses and legal fees incurred by the city in defending against such claims and 86 causes of actions. 87 88 6.2 Contractor covenants and agrees to indemnify and hold harmless, at its own expense, 89 the city, its officers, servants and employees, from and against any and all loss, damage 90 or destruction of property of the city, arising out of, or alleged to arise out of, the work 91 and services to be performed by the contractor, its officers, agents, employees, 92 subcontractors, licensees or invitees under this contract. This indemnification 93 provision is specifically intended to operate and be effective even if it is alleged or 94 proven that all or some of the damages being sought were caused, in whole or in part, 95 by any act, omission or negligence of the city. 96 97 Article 7. MISCELLANEOUS 98 7.1 Terms. 99 Terms used in this Agreement are defined in Article I of the Standard City Conditions of 100 the Construction Contract for Developer Awarded Projects. 101 7.2 Assignment of Contract. 102 This Agreement, including all of the Contract Documents may not be assigned by the 103 Contractor without the advanced express written consent of the Developer. 104 7.3 Successors and Assigns. 105 Developer and Contractor each binds itself, its partners, successors, assigns and legal 106 representatives to the other party hereto, in respect to all covenants, agreements and 107 obligations contained in the Contract Documents. 108 7.4 Severability. 109 Any provision or part of the Contract Documents held to be unconstitutional, void or 110 unenforceable by a court of competent jurisdiction shall be deemed stricken, and all 111 remaining provisions shall continue to be valid and binding upon DEVELOPER and 112 CONTRACTOR. 113 7.5 Governing Law and Venue. 114 This Agreement, including all of the Contract Documents is performable in the State of 115 Texas. Venue shall be Tarrant County, Texas, or the United States District Court for the 116 Northern District of Texas, Fort Worth Division. CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS — DEVELOPER AWARDED PROJECTS Cii)� Projecl No. - 102275 Revised June 16, 2016 00 52 43 - 4 Developer Awarded Project Agreement Page 4 of 4 117 118 7.6 Authority to Sign. 119 Contractor shall attach evidence of authority to sign Agreement, if other than duly 120 authorized signatory of the Contractor. 121 122 IN WITNESS WHEREOF, Developer and Contractor have executed this Agreement in multiple 123 counterparts. 124 125 This Agreement is effective as of the last date signed by the Parties ("Effective Date") 126 127 Contractor: � l U I I��a —J�—e BY: (Signature) (Signature) j5rwJo, i�alker (Printed Name) Title: \A CC- Q('-eSiJC4 Company Name: Address: (Z g1,0 W, City/State/Zip: �V,r IZ�3o/Iq Date De CIO er: /? ;9 By: (Signatur ) Liz /I CIA 1-,. 460'a it (Printed ' Name) Title: An a q ),n P1 PC,(' � 11c- Company name: ,�,f. Address: ii�JU��, rb x SI _ z City/State/Zip: l�t. a b ��/1 � � t o l6/ ►,Z 3ti f c� Date CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS — DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised June 16, 2016 1 2 3 4 5 6 7 SECTION 00 6213 PERFORMANCE BOND 006213-1 PERFORMANCE BOND Page 1 of 2 Bond No. 4426517 THE STATE OF TEXAS § § KNOW ALL BY THESE PRESENTS: COUNTY OF TARRANT § 8 That we, Walker Utilities. Inc. , known as "Principal" 9 herein and SureTec Insurance Company , a corporate surety(sureties, if 10 more than one) duly authorized to do business in the State of Texas, known as "Surety" herein 11 (whether one or more), are held and firmly bound unto the Developer, CKK Residential Group, II 12 LLC., authorized to do business in Texas ("Developer") and the City of Fort Worth, a Texas 13 municipal corporation ("City"), in the penal sum of, 14 Three Hundred Eighty Eight Thousand One Hundred Fifty Three and 85/100--- Dollars ($ 388,153.85---- ) 15 lawful money of the United States, to be paid in Fort Worth, Tarrant County, Texas for the 16 payment of which sum well and truly to be made jointly unto the Developer and the City as dual 17 obligees, we bind ourselves, our heirs, executors, administrators, successors and assigns, jointly 18 and severally, firmly by these presents. 19 WHEREAS, Developer and City have entered into an Agreement for the construction of 20 community facilities in the City of Fort Worth by and through a Community Facilities 21 Agreement, CFA Number CFA19-0137 ;and 22 WHEREAS, the Principal has entered into a certain written contract with the Developer awarded 23 the 30th day of December , 20 19, which Contract is hereby referred to and made a 24 part hereof for all purposes as if fully set forth herein, to furnish all materials, equipment labor 25 and other accessories defined by law, in the prosecution of the Work, including any Change 26 Orders, as provided for in said Contract designated as Lakes of River Trails East Phase 17A. 27 NOW, THEREFORE, the condition of this obligation is such that if the said Principal 28 shall faithfully perform it obligations under the Contract and shall in all respects duly and 29 faithfully perform the Work, including Change Orders, under the Contract, according to the plans, 30 specifications, and contract documents therein referred to, and as well during any period of 31 extension of the Contract that may be granted on the part of the Developer and/or City, then this 32 obligation shall be and become null and void, otherwise to remain in full force and effect. CITY OF FORT WORTH STANDARD CITY CONDITIONS — DEVELOPER AWARDED PROJECTS Revised January 31, 2012 Lakes of River Trails East Phase 17A City Project No. - 1022 75 006213-2 PERFORMANCE BOND Page 2 of 2 1 PROVIDED FURTHER, that if any legal action be filed on this Bond, venue shall lie in 2 Tarrant County, Texas or the United States District Court for the Northern District of Texas, Fort 3 Worth Division. 4 This bond is made and executed in compliance with the provisions of Chapter 2253 of the 5 Texas Government Code, as amended, and all liabilities on this bond shall be determined in 6 accordance with the provisions of said statue. 7 IN WITNESS WHEREOF, the Principal and the Surety have SIGNED and SEALED 8 this instrument by duly authorized agents and officers on this the 31 st day of 9 December 20 19 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 ATTEST: (Principal) Secretary Witn s as to Principal �WA, A Witness as to Surety Elena Sells PRINCIPAL: Walker Utilities, Inc. BY: Signature Brandon Walker Vice President Name and Title Address: 124 Brown Trail Hurst, TX 76053 SURETY: SureTec Insurance Company BY: i tur Jennifer Picchi, Attorney -in -Pact Name and Title Address: 2103 CityWest Blvd., Suite 1300 Houston, TX 77042 Telephone Number: (713) 812-0800 *Note: If signed by an officer of the Surety Company, there must be on file a certified extract from the by-laws showing that this person has authority to sign such obligation. If Surety's physical address is different from its mailing address, both must be provided. The date of the bond shall not be prior to the date the Contract is awarded. CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CITY CONDITIONS — DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised January 31, 2012 006214-1 PAYMENTBOND Page 1 of 2 1 SECTION 00 6214 Bond No. 4426517 2 PAYMENT BOND 3 4 THE STATE OF TEXAS § 5 § KNOW ALL BY THESE PRESENTS: 6 COUNTY OF TARRANT § 7 That we, Walker Utilities. Inc. known as 8 "Principal" herein, and SureTec Insurance Company ,a 9 corporate surety ( or sureties if more than one), duly authorized to do business in the State of 10 Texas, known as "Surety" herein (whether one or more), are held and firmly bound unto the 11 Developer, CKK Residential Group, 11 LLC., authorized to do business in Texas "(Developer"), 12 and the City of Fort Worth, a Texas municipal corporation ("City"), in the penal sum 13 Of Three Hundred Eighty Eight Thousand One Hundred Fifty Three and 85/100--- Dollars ($ 388,153.85---- ) e 14 lawful money of the United States, to be paid in Fort Worth, Tarrant County, Texas, for the 15 payment of which sum well and truly be made jointly unto the Developer and the City as dual 16 obligees, we bind ourselves, our heirs, executors, administrators, successors and assigns, jointly 17 and severally, firmly by these presents: 18 WHEREAS, Developer and City have entered into an Agreement for the construction of 19 community facilities in the City of Fort Worth, by and through a Community Facilities 20 Agreement, CFA Number CFA19-0137;and 21 WHEREAS, Principal has entered into a certain written Contract with Developer, 22 awarded the 30th day of December , 20 19 , which Contract is hereby 23 referred to and made a part hereof for all purposes as if fully set forth herein, to furnish all 24 materials, equipment, labor and other accessories as defined by law, in the prosecution of the 25 Work as provided for in said Contract and designated as Lakes of River Trails East Phase 17A. 26 NOW, THEREFORE, THE CONDITION OF THIS OBLIGATION is such that if 27 Principal shall pay all monies owing to any (and all) payment bond beneficiary (as defined in 28 Chapter 2253 of the Texas Government Code, as amended) in the prosecution of the Work under 29 the Contract, then this obligation shall be and become null and void; otherwise to remain in full 30 force and effect. CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CITY CONDITIONS — DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised January 31, 2012 1 2 3 4 5 6 7 8 9 10 11 12 13 006214-2 PAYMENTBOND Page 2 of 2 This bond is made and executed in compliance with the provisions of Chapter 2253 of the Texas Government Code, as amended, and all liabilities on this bond shall be determined in accordance with the provisions of said statute. IN WITNESS WHEREOF, the Principal and Surety have each SIGNED and SEALED this instrument by duly authorized agents and officers on this the 31st day of December 2019 ATTEST: (Principal) Secretary Wit ss as to Principal ATTEST: N/A (Surety) Secretary ?tM JJL Witness as to Surety Elena Sells PRINCIPAL: Walker Utilities, Inc. BY: Signature Brandon Walker, Vice President Name and Title Address: 124 Brown Trail Hurst, TX 76053 SURETY: SureTec Insurance Company BY: ' na re Jennifer Picchi, Attorney -in -Fact Name and Title Address: 2103 CityWest Blvd., Suite 1300 Houston, TX 77042 Telephone Number: (713) 812-0800 Note: If signed by an officer of the Surety, there must be on file a certified extract from the bylaws showing that this person has authority to sign such obligation. If Surety's physical address is different from its mailing address, both must be provided. The date of the bond shall not be prior to the date the Contract is awarded. 14 END OF SECTION CITY OF FORT WORTH STANDARD CITY CONDITIONS — DEVELOPER AWARDED PROJECTS Revised January 31, 2012 Lakes of River Trails East Phase 17A City Project No.-102275 006219-1 MAINTENANCE BOND Page 1 of 3 1 SECTION 00 6219 Bond No. 4426517 2 MAINTENANCE BOND 3 4 THE STATE OF TEXAS § 5 § KNOW ALL BY THESE PRESENTS: 6 COUNTY OF TARRANT § 7 8 That we, Walker Utilities, Inc. , known as "Principal" 9 herein and SureTec Insurance Company a corporate surety (sureties, if 10 more than one) duly authorized to do business in the State of Texas, known as "Surety" herein 11 (whether one or more), are held and firmly bound unto the Developer, CKK Residential Group, II 12 LLC., authorized to do business in Texas ("Developer") and the City of Fort Worth, a Texas 13 municipal corporation ("City"), in the sum of Three Hundred Eighty Eight Thousand One Hundred Fifty Three and 85/100--- 14 Dollars ($ 388,153.85---- ), lawful money of the United States, to be paid in Fort 15 Worth, Tarrant County, Texas, for payment of which sum well and truly be made jointly unto the 16 Developer and the City as dual obligees and their successors, we bind ourselves, our heirs, 17 executors, administrators, successors and assigns, jointly and severally, firmly by these presents. 18 19 WHEREAS, Developer and City have entered into an Agreement for the construction of 20 community facilities in the City of Fort Worth by and through a Community Facilities 21 Agreement, CFA NumberCFA19-0137; and 22 WHEREAS, the Principal has entered into a certain written contract with the Developer 23 awarded the 30th day of December , 20 19 , which Contract is 24 hereby referred to and a made part hereof for all purposes as if fully set forth herein, to furnish all 25 materials, equipment labor and other accessories as defined by law, in the prosecution of the 26 Work, including any Work resulting from a duly authorized Change Order (collectively herein, 27 the "Work") as provided for in said Contract and designated as Lakes of River Trails East Phase 28 17A; and 29 30 WHEREAS, Principal binds itself to use such materials and to so construct the Work in 31 accordance with the plans, specifications and Contract Documents that the Work is and will 32 remain free from defects in materials or workmanship for and during the period of two (2) years 33 after the date of Final Acceptance of the Work by the City ("Maintenance Period"); and 34 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CITY CONDITIONS — DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised January 31, 2012 006219-2 MAINTENANCE BOND Page 2 of 3 1 WHEREAS, Principal binds itself to repair or reconstruct the Work in whole or in part 2 upon receiving notice from the Developer and/or City of the need thereof at any time within the 3 Maintenance Period. 4 5 NOW THEREFORE, the condition of this obligation is such that if Principal shall 6 remedy any defective Work, for which timely notice was provided by Developer or City, to a 7 completion satisfactory to the City, then this obligation shall become null and void; otherwise to 8 remain in full force and effect. 9 10 PROVIDED, HOWEVER, if Principal shall fail so to repair or reconstruct any timely 11 noticed defective Work, it is agreed that the Developer or City may cause any and all such 12 defective Work to be repaired and/or reconstructed with all associated costs thereof being borne 13 by the Principal and the Surety under this Maintenance Bond; and 14 15 PROVIDED FURTHER, that if any legal action be filed on this Bond, venue shall lie in 16 Tarrant County, Texas or the United States District Court for the Northern District of Texas, Fort 17 Worth Division; and 18 19 PROVIDED FURTHER, that this obligation shall be continuous in nature and 20 successive recoveries may be had hereon for successive breaches. 21 22 23 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CITY CONDITIONS — DEVELOPER AWARDED PROJECTS City Project No.-102275 Revised January 31, 2012 006219-3 MAINTENANCE BOND Page 3 of 3 1 IN WITNESS WHEREOF, the Principal and the Surety have each SIGNED and SEALED this 2 instrument by duly authorized agents and officers on this the 31 st day of 3 December 2019 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 ATTEST: (Principal) Secretary Wi ss as to Principal ATTEST: N/A (Surety) Secretary n�/ l�l �� Witness as to Surety Elena Sells PRINCIPAL: Walker Utilities Inc. BY: Signature Brandon Walker, Vice President Name and Title Address: 124 Brown Trail Hurst, TX 76053 SURETY: S ec Insurance Co an Sig Jennifer Picchi, Attorney -in -Fact Name and Title Address: 2103 CityWest Blvd., Suite 1300 Houston, TX 77042 Telephone Number: (713) 812-0800 37 *Note: If signed by an officer of the Surety Company, there must be on file a certified extract 38 from the by-laws showing that this person has authority to sign such obligation. If 39 Surety's physical address is different from its mailing address, both must be provided. 40 41 The date of the bond shall not be prior to the date the Contract is awarded. M CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CITY CONDITIONS — DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised January 31, 2012 SureTec Insurance Company THIS BOND RIDER CONTAINS IMPORTANT COVERAGE INFORMATION Statutory Complaint Notice/Filing of Claims To obtain information or make a complaint: You may call the Surety's toll free telephone number for information or to make a complaint or file a claim at: 1-866-732-0099. You may also write to the Surety at: SureTec Insurance Company 9737 Great Hills Trail, Suite 320 Austin, Tx 78759 You may contact the Texas Department of Insurance to obtain information on companies, coverage, rights or complaints at 1-800-252- 3439. You may write the Texas Department of Insurance at: PO Box 149104 Austin, TX 78714-9104 Fax#: 512-490-1007 Web: htto://www.tdi.state.tx.us Email: ConsumerProtection@tdi.texas.gov PREMIUM OR CLAIMS DISPUTES: Should you have a dispute concerning your premium or about a claim, you should contact the Surety first. If the dispute is not resolved, you may contact the Texas Department of Insurance. Texas Rider 06042015 POA #: 4221800 SureTec Insurance Company LIMITED POWER OF ATTORNEY Know All Men by These Presents, That SURETEC INSURANCE COMPANY (the "Company"), a corporation duly organized and existing under the laws of the State of Texas, and having its principal office in Houston, Harris County, Texas, does by these presents make, constitute and appoint Kathy Sells, Lanny Land, Steven W. Lewis, Elena Sells, Jennifer Picchi its true and lawful Attorney -in -fact, with full power and authority hereby conferred in its name, place and stead, to execute, acknowledge and deliver any and all bonds, recognizances, undertakings or other instruments or contracts of suretyship to include waivers to the conditions of contracts and consents of surety for, providing the bond penalty does not exceed Five Million and 00/100 Dollars ($5,000,000.00) and to bind the Company thereby as fully and to the same extent as if such bond were signed by the CEO, sealed with the corporate seal of the Company and duly attested by its Secretary, hereby ratifying and confirming all that the said Attorney -in -Fact may do in the premises. Said appointment is made under and by authority of the following resolutions of the Board of Directors of the SureTec Insurance Company: Be it Resolved, that the President, any Vice -President, any Assistant Vice -President, any Secretary or any Assistant Secretary shall be and is hereby vested with full power and authority to appoint any one or more suitable persons as Attomey(s)-in-Fact to represent and act for and on behalf of the Company subject to the following provisions: Attorney -in -Fact may be given full power and authority for and in the name of and of behalf of the Company, to execute, acknowledge and deliver, any and all bonds, recognizances, contracts, agreements or indemnity and other conditional or obligatory undertakings and any and all notices and documents canceling or terminating the Company's liability thereunder, and any such instruments so executed by any such Attorney -in -Fact shall be binding upon the Company as if signed by the President and sealed and effected by the Corporate Secretary. Be it Resolved, that the signature of any authorized officer and seal of the Company heretofore or hereafter affixed to any power of attorney or any certificate relating thereto by facsimile, and any power of attorney or certificate bearing facsimile signature or facsimile seal shall be valid and binding upon the Company with respect to any bond or undertaking to which it is attached. (Adopted at a meeting held on 201* of April, 1999) In Witness Whereof, SURETEC INSURANCE COMPANY has caused these presents to be signed by its CEO, and its corporate seal to be hereto affixed this 14th day of August A.D. 2019 . y�NCF SURETEC INS PANY 0� By: uj John Kno , CE State of Texas ss: 7 • d County of Harris s •^•••••' •MIFF*� On this 14th day of August , A.D. 2019 before me personally came John Knox Jr., to me known, who, being by me duly sworn; did depose and say, that he resides in Houston, Texas, that he is CEO of SURETEC INSURANCE COMPANY, the company described in and which executed the above instrument; that he knows the seal of said Company; that the seal affixed to said instrument is such corporate seal; that it was so affixed by order of the Board of Directors of said Company; and that he signed his name thereto by like order. � ......I,.- JACQUELYN GREENLEAF �hP_tY P(�d tlotary Public, Skate pf Texas Comm. Expires 05-18-2021 ' °;, Notary ID 126903029 ,--A M E�7_ Jacq elyn Greenleaf, Notary Public My commission expires May 18, 2021 I, M. Brent Beaty, Assistant Secretary of SURETEC, INSURANCE COMPANY, do hereby certify that the above and foregoing is a true and correct copy of a Power of Attorney, executed by said Company, which is still in full force and effect; and furthermore, the resolutions of the Board of Directors, set out in the Power of Attorney are in full force and effect. Given under my hand and the seal of said Company at Houston, Texas this 5 S _ day of �6_ 62__ A.D. . Bren Beaty, A istant SeeVetary Any instrument issued in excess of the penalty stated above is totally void and without any validity. For verification of the authority of this power you may call (713) 812-0800 any business day between 8:30 am and 5:00 pm CST. MACHINE LAID CONCRETE PAVING CONSTRUCTION SECTION 00 42 43 Developer Awarded Projects - PROPOSAL FORM UNIT PRICE BID 00 42 43 DAP -BID PROPOSAL Page 4 of 7 Bidder's Application Project Item Information Bidder's Proposal Bidlist Item No. Description Specification Section No. Unit of Measure Bid Quantity Unit Price Bid Value UNIT IV: PAVING IMPROVEMENTS 1 3213.0101 7" Cone Pvmt 3213 13 Sy 7526 $49.53 $372,762.78 2 3211.0502 8" Lime Treatment 321129 Sy 8047 $2.50 $20,117.50 3 3211.0400 Hydrated Lime 321129 TON 144.85 $191.00 $27,666.35 4 3213.0501 Barrier Free Ramp, Type R-1 32 1320 EA 4 $3,000.00 $12,000.00 5 3213.0501 Barrier Free Ramp, Type M-1 32 13 20 EA 2 $4,000.00 $8,000.00 6 3305.0107 Manhole Adjustment, Minor 3305 14 EA 7 $450.00 $3,150.00 7 3305.0111 Valve Box Adjustment 3305 15 EA 15 $200.00 $3,000.00 8 3471.0001 Traffic Control (Dead End Barricade) 3471 13 EA 1 $2,500.00 $2,500.00 9 3213.0301 4" Cone Sidewalk 32 13 20 SF 10280 $5.00 $51,400.00 10 9999.0001 Traffic Signs / Pavement Markings LS 1 $5,025.00 $5,025.00 11 3471.0001 General Traffic Control 3471 13 MO 4 $2,000.00 $8,000.00 12 3292.0400 Seeding, H dromulch 32 92 13 Sy 2900 $0.50 $1,450.00 13 3291.0100 Topsoil 3291 19 Cy 480 $10.00 $4,800.00 14 3137.0104 Medium Stone Ri ra , dry 31 37 00 Sy 41.00 $180.00 $7,380.00 15 0241.1300 Remove Conc Curb&Gutter 0241 15 LF 76 $15.00 $1,140.00 16 3212.0401 HMAC Transition 321216 Sy 118 $95.00 $11,210.00 TOTAL UNIT IV: PAVING IMPROVEMENTS $539,601.63 CITY OF FORT WORTH STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS - DEVELOPER AWARDED PROJECTS Form Version April 2, 2014 00 42 43_Bid Proposal —DAP cfa.xls BID QUALIFICATION: 01 This proposal is submitted with the understanding that the owner's credit and financial arrangements for making payment under the Contract are satisfactory to Stabile & Winn, Inc. 02 Partial Payments on the Fifteenth of the next month, Final Payment immediately upon acceptance from Owner. 03 Two Year Maintenance Bond is included. 04 All Testing, Soil Series, and Coring for Compliance to be furnished & paid for by others. 05 Construction Staking is not included. 06 Inspection Fees, if any, to be paid for by others. 07 Backfill all work is included. 08 Utility Relocations, if any, to be furnished & paid for by others. 09 Temporary Barricades with Lites & Signage are included. 10 Imported Material (Topsoil, Select Fill, etc.) & Seeding Parkways are not included. 11 After the Utility Contractor has completed their work, the Street Subgrade and Parkways must be restored to +/- 0.10 Ft. by others or it will be done on a Force -Account -Basis. 12 Sales Tax is not included. 13 The Erosion Control Plan (SWPPP), and the implementation of the plan are not included. However, the maintaining of the existing implementation is included. 14 Unit Prices are contingent upon all the incorporated materials being installed prior to July 1, 2020. If all the incorporated materials cannot be installed within this time frame, then our unit prices maybe subjected to increases due to delays that are not within our cause or scope of work, and shall be treated as a Change Order to the Contract. This Bid Qualification is a part of this Contract. Contractor: TABILE & WINN, INC. Si John tabile President 0045 12 DAP PREQUALIFICATION STATEMENT Page 1 of 1 SECTION 00 45 12 DAP — PREQUALIFICATION STATEMENT Each Bidder is required to complete the information below by identifying the prequalified contractors and/or subcontractors whom they intend to utilize for the major work type(s) listed. In the "Major Work Type" box provide the complete major work type and actual description as provided by the Water Department for water and sewer and TPW for pavin& Major Work Type Contractor/Subcontractor Company Name Prequalification Expiration Date Machine Laid Concrete Paving Construction Stabile and Winn., Inc. 09/01/20 The undersigned hereby certifies that the contractors and/or subcontractors described in the table above are currently prequalified for the work types listed. BIDDER: Stabile and Winn, .Inc BY: John Stabile PO Box 79380 Saginaw, Texas 76179 (Signature) TITLE: DATE: END OF SECTION CITY OF FORT WORTH STANDARD CONSTRUCTION PREQUALIFICATION STATEMENT— DEVELOPER AWARDED PROJECTS 00 45 12_Prequalification Statement 2015_DAP Paving.docx Form Version September 1, 2015 00 45 26 - 1 CONTRACTOR COMPLIANCE WITH WORKER'S COMPENSATION LAW Page 1 of 1 1 SECTION 00 45 26 2 CONTRACTOR COMPLIANCE WITH WORKER'S COMPENSATION LAW 3 Pursuant to Texas Labor Code Section 406.096(a), as amended, Contractor certifies that it 4 provides worker's compensation insurance coverage for all of its employees employed on City 5 Project No. 102275. Contractor further certifies that, pursuant to Texas Labor Code, Section 6 406.096(b), as amended, it will provide to City its subcontractor's certificates of compliance with 7 worker's compensation coverage. 8 9 CONTRACTOR: 10 I I y AKA `T'tG� By: �.4�.� Lt1, d'7'�6✓Ti_ 12 Company (P ase Print 13 14 1:;b>?nw 7 93A0 Signatu 15 Address 16 17 , �-Va-v Title: 18 City State/Zip (Please Print) 19 20 21 THE STATE OF TEXAS 22 23 COUNTY OF TARRANT 24 25 BEFORE ME, the undersigned authority, on this day personally appeared 26 —I.W.. A/. J41.',L , known to me to be the person whose name is 27 subscribed to the foregoing instrument, and acknowledged to me that he/she executed the same as 28 the act and deed of �f".C6:4�'�t/.^N.., .ems.- for the purposes and 29 consideration therein expressed and in the capacity therein stated. 30 31 32 33 34 35 36 37 38 39 GIVEN UNDER MY HAND AND SEAL OF OFFICE this I3'Out day of -J«Nwd4rr.1 , 20Z-o DEBRA RODRIGUEZ Notary Public, State of Texas Comm. Expires 09-07-2022 Notary ID13171267-2 otary Public i d fbr the State of Texas END OF SECTION CITY OF FORT WORTH Lakes of river Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS City Project No.-102275 Revised April 2, 2014 005243-1 Developer Awarded Project Agreement Page 1 of SECTION 00 52 43 2 AGREEMENT 3 THIS AGREEMENT, authorized on / d' 131' 1 q is made by and between the Developer, 4 CKK Residential Group, II LLC., authorized to do business in Texas ("Developer"), and Stabile 5 and Winn, Inc., authorized to do business in Texas, acting by and through its duly authorized 6 representative, ("Contractor"). 7 Developer and Contractor, in consideration of the mutual covenants hereinafter set forth, agree as 8 follows: 9 Article 1. WORK 10 Contractor shall complete all Work as specified or indicated in the Contract Documents for the 11 Project identified herein. 12 Article 2. PROJECT 13 The project for which the Work under the Contract Documents may be the whole or only a part is 14 generally described as follows: 15 Lakes of River Trails East Phase 17A 16 City Project No.—102275; X No. — X-26183; FID No. — 30114-0200431-102275-EO7685 17 File No. — W-2657 18 Article 3. CONTRACT TIME 19 3.1 Time is of the essence. 20 All time limits for Milestones, if any, and Final Acceptance as stated in the Contract 21 Documents are of the essence to this Contract. 22 3.2 Final Acceptance. 23 The Work will be complete for Final Acceptance within 120 calendar days after the date 24 when the Contract Time commences to run as provided in Paragraph 12.04 of the Standard 25 City Conditions of the Construction Contract for Developer Awarded Projects. 26 3.3 Liquidated damages 27 Contractor recognizes that time is of the essence of this Agreement and that Developer 28 will suffer financial loss if the Work is not completed within the times specified in 29 Paragraph 3.2 above, plus any extension thereof allowed in accordance with Article 10 of 30 the Standard City Conditions of the Construction Contract for Developer Awarded 31 Projects. The Contractor also recognizes the delays, expense and difficulties involved in 32 proving in a legal proceeding the actual loss suffered by the Developer if the Work is not 33 completed on time. Accordingly, instead of requiring any such proof , Contractor agrees 34 that as liquidated damages for delay (but not as a penalty), Contractor shall pay 35 Developer One thousand Dollars ($1, 000.00) for each day that expires after the time 36 specified in Paragraph 3.2 for Final Acceptance until the City issues the Final Letter of 37 Acceptance. CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS — DEVELOPER AWARDED PROJECTS City Project No. - 1022 75 Revised June 16, 2016 00 52 43 - 2 Developer Awarded Project Agreement Page 2 of 4 38 Article 4. CONTRACT PRICE 39 Developer agrees to pay Contractor for performance of the Work in accordance with the Contract 40 Documents an amount in current funds of Five hundred thirty nine thousand six hundred one 41 dollars and sixty three cents. Dollars ($539,601.63). 42 Article 5. CONTRACT DOCUMENTS 43 5.1 CONTENTS: 44 A. The Contract Documents which comprise the entire agreement between Developer and 45 Contractor concerning the Work consist of the following: 46 1. This Agreement. 47 2. Attachments to this Agreement: 48 a. Bid Form (As provided by Developer) 49 1) Proposal Form (DAP Version) 50 2) Prequalification Statement 51 3) State and Federal documents (project specific) 52 b. Insurance ACORD Form(s) 53 c. Payment Bond (DAP Version) 54 d. Performance Bond (DAP Version) 55 e. Maintenance Bond (DAP Version) 56 f. Power of Attorney for the Bonds 57 g. Worker's Compensation Affidavit 58 h. MBE and/or SBE Commitment Form (If required) 59 3. Standard City General Conditions of the Construction Contract for Developer 60 Awarded Projects. 61 4. Supplementary Conditions. 62 5. Specifications specifically made a part of the Contract Documents by attachment 63 or, if not attached, as incorporated by reference and described in the Table of 64 Contents of the Project's Contract Documents. 65 6. Drawings. 66 7. Addenda. 67 8. Documentation submitted by Contractor prior to Notice of Award. 68 9. The following which may be delivered or issued after the Effective Date of the 69 Agreement and, if issued, become an incorporated part of the Contract Documents: 70 a. Notice to Proceed. 71 b. Field Orders. 72 c. Change Orders. 73 d. Letter of Final Acceptance. 74 75 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS — DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised June 16, 2016 00 52 43 - 3 Developer Awarded Project Agreement Page 3 of 4 76 Article 6. INDEMNIFICATION 77 6.1 Contractor covenants and agrees to indemnify, hold harmless and defend, at its own 78 expense, the city, its officers, servants and employees, from and against any and all 79 claims arising out of, or alleged to arise out of, the work and services to be performed 80 by the contractor, its officers, agents, employees, subcontractors, licenses or invitees 81 under this contract. This indemnification provision is specifically intended to operate 82 and be effective even if it is alleged or proven that all or some of the damages being 83 sought were caused, in whole or in part, by any act, omission or negligence of the city. 84 This indemnity provision is intended to include, without limitation, indemnity for 85 costs, expenses and legal fees incurred by the city in defending against such claims and 86 causes of actions. 87 88 6.2 Contractor covenants and agrees to indemnify and hold harmless, at its own expense, 89 the city, its officers, servants and employees, from and against any and all loss, damage 90 or destruction of property of the city, arising out of, or alleged to arise out of, the work 91 and services to be performed by the contractor, its officers, agents, employees, 92 subcontractors, licensees or invitees under this contract. This indemnification 93 provision is specifically intended to operate and be effective even if it is alleged or 94 proven that all or some of the damages being sought were caused, in whole or in part, 95 by anv act. omission or negligence of the citv. 96 97 Article 7. MISCELLANEOUS 98 7.1 Terms. 99 Terms used in this Agreement are defined in Article 1 of the Standard City Conditions of 100 the Construction Contract for Developer Awarded Projects. 101 7.2 Assignment of Contract. 102 This Agreement, including all of the Contract Documents may not be assigned by the 103 Contractor without the advanced express written consent of the Developer. 104 7.3 Successors and Assigns. 105 Developer and Contractor each binds itself, its partners, successors, assigns and legal 106 representatives to the other party hereto, in respect to all covenants, agreements and 107 obligations contained in the Contract Documents. 108 7.4 Severability. 109 Any provision or part of the Contract Documents held to be unconstitutional, void or 110 unenforceable by a court of competent jurisdiction shall be deemed stricken, and all 111 remaining provisions shall continue to be valid and binding upon DEVELOPER and 112 CONTRACTOR. 113 7.5 Governing Law and Venue. 114 This Agreement, including all of the Contract Documents is performable in the State of 115 Texas. Venue shall be Tarrant County, Texas, or the United States District Court for the 116 Northern District of Texas, Fort Worth Division. CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS — DEVELOPER AWARDED PROJECTS City Project No.-102275 Revised June 16, 2016 00 52 43 - 4 Developer Awarded Project Agreement Page 4 of 4 117 118 7.6 Authority to Sign. 119 Contractor shall attach evidence of authority to sign Agreement, if other than duly 120 authorized signatory of the Contractor. 121 122 IN WITNESS WHEREOF, Developer and Contractor have executed this Agreement in multiple 123 counterparts. 124 125 This Agreement is effective as of the last date signed by the Parties ("Effective Date"). 126 127 Contractor: Stabile and Winn, Inc. (Signature) John Stabile, President (Printed Name) Title: 00021 r e4:y� Company Name: Stabile and Winn, Inc. Address: 301 N Samson Boulevard Developer: CKK Residential Group. II LLC. B lJ 9---- (Signature) Kenneth B. Newell (Printed Name) Title: Managing Partner Company name: CKK Residential Group, II LLC Address: PO Box 185104 Fort Worth, Texas 76179 Fort Worth, Texas 76181 City/State/Zip: City/State/Zip: p/i 9 Date Date CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS — DEVELOPER AWARDED PROJECTS City Project No.-102275 Revised June 16, 2016 0062 13- 1 PERFORMANCE BOND Page 1 of 2 1 SECTION 00 6213 Bond #CA 3243283 2 PERFORMANCE BOND 3 4 THE STATE OF TEXAS § 5 § KNOW ALL BY THESE PRESENTS: 6 COUNTY OF TARRANT § 7 8 That we, Stabile & Winn, Inc. , known as "Principal" 9 herein and Great American Insurance Company of New York , a corporate surety(sureties, if 10 more than one) duly authorized to do business in the State of Texas, known as "Surety" herein 11 (whether one or more), are held and firmly bound unto the Developer, CKK Residential Group II, 12 LLC., authorized to do business in Texas ("Developer") and the City of Fort Worth, a Texas 13 municipal corporation ("City"), in the penal sum of, 14 Five hundred thirty nine thousand six hundred one and 63/100---- Dollars ($ 539,601.63 ), 15 lawful money of the United States, to be paid in Fort Worth, Tarrant County, Texas for the 16 payment of which sum well and truly to be made jointly unto the Developer and the City as dual 17 obligees, we bind ourselves, our heirs, executors, administrators, successors and assigns, jointly 18 and severally, firmly by these presents. 19 WHEREAS, Developer and City have entered into an Agreement for the construction of 20 community facilities in the City of Fort Worth by and through a Community Facilities 21 Agreement, CFA Number CFA19-0137 and 22 WHEREAS, the Principal has entered into a certain written contract with the Developer awarded S'1' Q 23 the 31 day of Gti�%120 /, which Contract is hereby referred to and made a 24 part hereof for all purposes as if fully set forth herein, to furnish all materials, equipment labor 25 and other accessories defined by law, in the prosecution of the Work, including any Change 26 Orders, as provided for in said Contract designated as Lakes of River Trails East Phase 17A. 27 NOW, THEREFORE, the condition of this obligation is such that if the said Principal 28 shall faithfully perform it obligations under the Contract and shall in all respects duly and 29 faithfully perform the Work, including Change Orders, under the Contract, according to the plans, 30 specifications, and contract documents therein referred to, and as well during any period of 31 extension of the Contract that may be granted on the part of the Developer and/or City, then this 32 obligation shall be and become null and void, otherwise to remain in full force and effect. CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CITY CONDITIONS — DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised January 31, 2012 006213-2 PERFORMANCE BOND Page 2 of 2 1 PROVIDED FURTHER, that if any legal action be filed on this Bond, venue shall lie in 2 Tarrant County, Texas or the United States District Court for the Northern District of Texas, Fort 3 Worth Division. 4 This bond is made and executed in compliance with the provisions of Chapter 2253 of the 5 Texas Government Code, as amended, and all liabilities on this bond shall be determined in 6 accordance with the provisions of said statue. 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 IN WITNESS WHEREOF, the Principal and the Surety have SIGNYD and SEALED instrument by duly authorized agents and officers on this thet day of 20 40. ATTEST: (Principal) Secretary Lkimeen,_ Witness as to Principal • ewe604 //9� Witness as to Surety PRINCIPAL: S & Winn Inc. BY: Signature John Stabile. President _ Name and Title Address: PO Box 79380 Saginaw: TX 76179 SURETY: Great American Insurance Company of New York BY: el Signature Tracy Tucker, Attorney -in -Fact Name and Title Address: P O Box 2285 Ft Worth TX 76113 Telephone Number: 817/336-8520 *Note: If signed by an officer of the Surety Company, there must be on file a certified extract from the by-laws showing that this person has authority to sign such obligation. If Surety's physical address is different from its mailing address, both must be provided. The date of the bond shall not be prior to the date the Contract is awarded. CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CITY CONDITIONS — DEVELOPER AWARDED PROJECTS City Project No.-102275 Revised January 31, 2012 006214- 1 PAYMENTBOND Page 1 of 2 1 SECTION 00 6214 Bond #CA 3243283 2 PAYMENT BOND 3 4 THE STATE OF TEXAS § 5 § KNOW ALL BY THESE PRESENTS: 6 COUNTY OF TARRANT § 7 That we, Stabile & Winn. Inc. known as 8 "Principal" herein, and Great American Insurance Company of New York , a 9 corporate surety ( or sureties if more than one), duly authorized to do business in the State of 10 Texas, known as "Surety" herein (whether one or more), are held and firmly bound unto the 11 Developer, CKK Residential Group, H LLC., authorized to do business in Texas "(Developer"), 12 and the City of Fort Worth, a Texas municipal corporation ("City"), in the penal sum 13 of Five hundred thirty nine thousand six hundred one and 63/100--- Dollars ($ 539,601.63 ) , 14 lawful money of the United States, to be paid in Fort Worth, Tarrant County, Texas, for the 15 payment of which sum well and truly be made jointly unto the Developer and the City as dual 16 obligees, we bind ourselves, our heirs, executors, administrators, successors and assigns, jointly 17 and severally, firmly by these presents: 18 WHEREAS, Developer and City have entered into an Agreement for the construction of 19 community facilities in the City of Fort Worth, by and through a Community Facilities 20 Agreement, CFA Number CFA19-0137 ;and 21 WHEREAS, Principal has entered into a certain written Contract with Developer, 22 awarded the 31 day of CCerytber 2011, which Contract is hereby 23 referred to and made a part hereof for all purposes as if fully set forth herein, to furnish all 24 materials, equipment, labor and other accessories as defined by law, in the prosecution of the 25 Work as provided for in said Contract and designated as Lakes of River Trails East Phase 17A. 26 NOW, THEREFORE, THE CONDITION OF THIS OBLIGATION is such that if 27 Principal shall pay all monies owing to any (and all) payment bond beneficiary (as defined in 28 Chapter 2253 of the Texas Government Code, as amended) in the prosecution of the Work under 29 the Contract, then this obligation shall be and become null and void; otherwise to remain in full 30 force and effect. CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CITY CONDITIONS — DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised January 31, 2012 006214-2 PAYMENT BOND Page 2 of 2 1 This bond is made and executed in compliance with the provisions of Chapter 2253 of the 2 Texas Government Code, as amended, and all liabilities on this bond shall be determined in 3 accordance with the provisions of said statute. 4 IN WITNESS WHEREOF, the Principal and Surety have each SIGNED 4nd SEALED 5 is instrrum'ent by duly authorized agents and officers on this the C4 day of 6 q/IIA/L 200 7 ATTEST: John Stabile, President Name and Title Address: PO Box 79380 Saginaw. TX 76179 Witness as to Principal SURETY: Great American Insurance Company of New York ATTEST: BY _ lgnature Tracy Tucker, Attorney -in -Fact (Surety) Secretary Name and Title Witness as to Surety Address: P O Box 2285 Ft Worth TX 76113 Telephone Number: 817/336-8520 9 Note: If signed by an officer of the Surety, there must be on file a certified extract from the 10 bylaws showing that this person has authority to sign such obligation. If Surety's physical 11 address is different from its mailing address, both must be provided. 12 13 The date of the bond shall not be prior to the date the Contract is awarded. 14 END OF SECTION CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CITY CONDITIONS — DEVELOPER AWARDED PROJECTS City Project No.-102275 Revised January 31, 2012 1 2 3 4 5 6 7 SECTION 00 6219 MAINTENANCE BOND 006219-1 MAINTENANCE BOND Page 1 of 3 Bond #CA 3243283 THE STATE OF TEXAS § § KNOW ALL BY THESE PRESENTS: COUNTY OF TARRANT § 8 That we, Stabile & Winn, Inc. , known as "Principal' 9 herein and Great American Insurance Company of New York a corporate surety (sureties, if 10 more than one) duly authorized to do business in the State of Texas, known as "Surety" herein 11 (whether one or more), are held and firmly bound unto the Developer, CKK Residential Group, II 12 LLC., authorized to do business in Texas ("Developer") and the City of Fort Worth, a Texas 13 municipal corporation ("City"), in the sum of Five hundred thirty nine thousand six hundred one and 63/100--- 14 Dollars ($ 539,601.63 ), lawful money of the United States, to be paid in Fort 15 Worth, Tarrant County, Texas, for payment of which sum well and truly be made jointly unto the 16 Developer and the City as dual obligees and their successors, we bind ourselves, our heirs, 17 executors, administrators, successors and assigns, jointly and severally, firmly by these presents. 18 19 WHEREAS, Developer and City have entered into an Agreement for the construction of 20 community facilities in the City of Fort Worth by and through a Community Facilities 21 Agreement, CFA Number CFA19-0137;and 22 WHEREAS the Principal has entered into a certain written contract with the Developer 23 awarded the C�j day of D eCan be r , 20 1 , which Contract is 24 hereby referred to and a made part hereof for all purposes as if fully set forth herein, to furnish all 25 materials, equipment labor and other accessories as defined by law, in the prosecution of the 26 Work, including any Work resulting from a duly authorized Change Order (collectively herein, 27 the "Work") as provided for in said Contract and designated as Lakes of River Trails East Phase 28 17A; and 29 30 WHEREAS, Principal binds itself to use such materials and to so construct the Work in 31 accordance with the plans, specifications and Contract Documents that the Work is and will 32 remain free from defects in materials or workmanship for and during the period of two (2) years 33 after the date of Final Acceptance of the Work by the City ("Maintenance Period"); and 34 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CITY CONDITIONS — DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised January 31, 2012 006219-2 MAINTENANCE BOND Page 2 of 3 1 WHEREAS, Principal binds itself to repair or reconstruct the Work in whole or in part 2 upon receiving notice from the Developer and/or City of the need thereof at any time within the 3 Maintenance Period. 4 5 NOW THEREFORE, the condition of this obligation is such that if Principal shall 6 remedy any defective Work, for which timely notice was provided by Developer or City, to a 7 completion satisfactory to the City, then this obligation shall become null and void; otherwise to 8 remain in full force and effect. 9 10 PROVIDED, HOWEVER, if Principal shall fail so to repair or reconstruct any timely 11 noticed defective Work, it is agreed that the Developer or City may cause any and all such 12 defective Work to be repaired and/or reconstructed with all associated costs thereof being borne 13 by the Principal and the Surety under this Maintenance Bond; and 14 15 PROVIDED FURTHER, that if any legal action be filed on this Bond, venue shall lie in 16 Tarrant County, Texas or the United States District Court for the Northern District of Texas, Fort 17 Worth Division; and 18 19 PROVIDED FURTHER, that this obligation shall be continuous in nature and 20 successive recoveries may be had hereon for successive breaches. 21 22 23 CITY OF FORT WORTH Lakes of River Trails East Phase 174 STANDARD CITY CONDITIONS — DEVELOPER AWARDED PROJECTS City Project No.-102275 Revised January 31, 2012 006219-3 MAINTENANCE BOND Page 3 of 3 1 IN WITNESS WHEREOF, the Principal and the Surety have each SIGNED and SEALED this 2 in ument by duly authorized agents and officers on this the / day of 3 ,200V 4 5 6 7 8 9 10 11 ATTEST: 12 13 J��V4Z�� 14 (Principal) Secretary 15 16 17 18 19 20 Witness as to Principal 21 22 23 24 25 26 27 28 29 ATTEST: 30 31 32 (Sure Secretary 00, 33 34 A�V64��- 35 Witness as to Surety 36 John Stabile President Name and Title Address: PO Box 79380 _ Saginaw: TX 76179 SURETY: Great American Insurance Company of New York BY: _ Signatur Tracy Tucker, Attorney -in -Fact Name and Title Address: P O Box 2285 Et Worth, TX 76113 ~ Telephone Number: S17/336-8520 37 *Note: If signed by an officer of the Surety Company, there must be on file a certified extract 38 from the by-laws showing that this person has authority to sign such obligation. If 39 Surety's physical address is different from its mailing address, both must be provided. 40 41 The date of the bond shall not be prior to the date the Contract is awarded. 42 CITY OF FORT WORTH Lakes of River Trails East Phase 17,4 STANDARD CITY CONDITIONS — DEVELOPER AWARDED PROJECTS City Project No.-102275 Revised January 31, 2012 DUAL OBLIGEE RIDER To be attached to and form a part of contract bond number CA 3243283 issued by the Great American Insurance Company of New York on behalf of Stabile & Winn, Inc. in the amount of Five hundred it nine thousand six hundred one and 63/100------- ------- ($539,601.63) and dated 40A. 1►GihU in favor of CKK Residential Group II, LLC. In consideration of the sum of One Dollar ($1.00), and other good and valuable consideration receipt of which is hereby acknowledged, the Undersigned herby agree as follows: 1. City of Fort Worth, Texas is hereby added to said bond as an additional obligees. 2. The Surety shall not be liable under this bond to the Obligees, or any of them unless the said Obligees, or any of them, shall make payments to the Principal strictly in accordance with the terms of the said contract as to payments, and shall perform all other obligations to be performed under said contract at the time and in the manner therein set forth. 3. No suit, action or proceeding by reason of any default whatever shall be brought on this bond after two (2) years and one (1) month from the day on which the final payment under said construction contract falls due. 4. Aggregate liability of Surety hereunder to Obligees is limited to the penal sum above stated and Surety, upon making payment hereunder, shall be subrogated to, and shall be entitled to an assignment of all rights of the payee with respect to the particular obligation discharged by the payment, either against principal or against any other party liable to the payee on the discharged obligation. Signed, sealed and dated this 01 day of 52(ItA4M 20(11). Stabile & Winn, Inc. Contrac r John Stabile, President CKK Residential Group II, LLC Great American Insurance Company of New York M Tracy Tuc r, Attorney -in -Fact GREAT AMERICAN INSURANCE COMPANY OF NEW YORK New York Administrative Office: 301 E 4TH STREET a CINCINNATI, OHIO 45202 e 513-369-5000 a FAX 513-723-2740 The number of persons authorized by this power of attorney is not more than SIX No. 0 14893 POWER OF ATTORNEY KNOW ALL MEN BY THESE PRESENTS: That the GREAT AMERICAN INSURANCE COMPANY OF NEW YORK, a corporation organized and existing under and by virtue of the laws of the State of New York, does hereby nominate, constitute and appoint the person or persons named below its true and lawful attorney -in -fact, for it and in its name, place and stead to execute on behalf of the said Company, as surety, any and all bonds, undertakings and contracts of suretyship, or other written obligations in the nature thereof; provided that the liability of the said Company on any such bond, undertaking or contract of suretyship executed under this authority shall not exceed the limit stated below. Name Address Limit of Power TRACY TUCKER STEVEN TUCKER ALL OF W. LAWRENCE BROWN BENNETT BROWN FORT WORTH, KEVIN J. DUNN ROBERTA ERB TEXAS ALL $100,000,000.00 This Power of Attorney revokes all previous powers issued on behalf of the attorney(s)-in-fact named above. IN WITNESS WHEREOF, the GREAT AMERICAN INSURANCE COMPANY OF NEW YORK has caused these presents to be signed and attested by its appropriate officers and its corporate seal hereunto affixed this 13TH day of MARCH 9 2018 . Attest g� O F0 Arl $� Assistant Secretary STATE OF OHIO, COUNTY OF HAMILTON-ss: GREAT AMERICAN INSURANCE COMPANY OF NEW YORK (Owde- X4.4 Divisional Senior Vice President DAVID C. KITCHIN (877-377-2405) On this 13TH day of MARCH , 2018 , before me personally appeared DAVID C. KITCHIN, to me known, being duly sworn, deposes and says that he resides in Cincinnati, Ohio, that he is a Divisional Senior Vice President of the Bond Division of Great American Insurance Company of New York, the Company described in and which executed the above instrument; that he knows the seal; that it was so affixed by authority of his office under the By -Laws of said Company, and that he signed his name thereto by like authority. a4�44.uv This Power of Attorney is granted by authority of the following resolutions adopted by the Board of Directors of Great American Insurance Company of New York by unanimous written consent dated May 14, 2009. RESOLVED. That the Divisional President, the several Divisional Senior Vice Presidents, Divisional Vice Presidents and Divisional Assistant Vice Presidents, or any one of them, be and hereby is authorized, from time to time, to appoint one or more Attorneys -in -Fact to execute on behalf of the Company, as surety, any and all bonds, undertakings and contracts of suretyship, or other written obligations in the nature thereof, • to prescribe their respective duties and the respective limits of their authority, • and to revoke any such appointment at any time. RESOLVED FURTHER. That the Company seal and the signature of any of the aforesaid officers and any Secretary or Assistant Secretary of the Company may be affixed by facsimile to any power of attorney or certificate of either given for the execution of any bond, undertaking, contract of suretyship, or other written obligation in the nature thereof, such signature and seal when so used being hereby adopted by the Company as the original signature of such officer and the original seal of the Company, to be valid and binding upon the Company with the same force and effect as though manually affixed. CERTIFICATION I, STEPHEN C. BERAHA, Assistant Secretary of Great American Insurance Company of New York, do hereby certify that the foregoing Power of Attorney and the Resolutions of the Board of Directors of May 14, 2009 have not been revoked and are now in full force and effect. Signed and sealed this day of 3�pOgPOgA7p � € SEAL Assistant Secretary S1185L (06115) Great American Insurance Company of New York GREATAMERICAN. Great American Alliance Insurance Company INSURANCE GROUP Great American Insurance Company IMPORTANT NOTICE: To obtain information or make a complaint: You may contact the Texas Department of Insurance to obtain information on companies, coverages, rights or complaints at: 1-800-252-3439 You may write the Texas Department of Insurance at: P.O. Box 149104 Austin, TX 78714-9104 FAX: 1-512-475-1771 Your notice of claim against the attached bond may be given to the surety company that issued the bond by sending it by certified or registered mail to the following address: Mailing Address: Great American Insurance Company P.O. Box 2119 Cincinnati, Ohio 45202 Physical Address: Great American Insurance Company 301 E. Fourth Street Cincinnati, Ohio 45202 You may also contact the Great American Insurance Company Claim office by: Fax: 1-888-290-3706 Telephone: 1-513-369-5091 Email: bondclaims@gaic.com PREMIUM OR CLAIM DISPUTES: If you have a dispute concerning a premium, you should contact the agent first. If you have a dispute concerning a claim, you should contact the company first. If the dispute is not resolved, you may contact the Texas Department of Insurance. ATTACH THIS NOTICE TO YOUR BOND: This notice is for information only and does not become a part or condition of the attached document. F.9667A (3/11) STREET LIGHTING AND ELECTRIC SECTION 00 42 43 Developer Awarded Projects - PROPOSAL FORM UNIT PRICE BID 00 42 43 DAP - BID PROPOSAL Page 5 of 7 Bidder's Application Project Item Information Bidder's Proposal Bidlist Item No. Description Specification Section No. Unit of Measure Bid Quantity Unit Price Bid Value UNIT V: STREET LIGHTING IMPROVEMENTS 1 2 3 4 5 3441.3301 Rdwy Ilium Foundation TY 1,2, and 4 3441.3002 Rdwy Ilium Assmbly TY 8,11,D-25, and D-30 3441.3104 150W MH PC Lighting Fixture 2605.3015 2" CONDT PVC SCH 80 (T) 3441.1409 NO 8 Insulated Elec Condr 34 41 20 34 41 20 34 41 20 26 05 33 3441 10 EA EA EA LF LF 10 10 10 1331 1331 $650.00 $1,900.00 $405 00 $8.00 $6.75 $6,500.00 $19,000.00 $4,050.00 $10,648.00 $8,984.25 TOTAL UNIT V: STREET LIGHTING IMPROVEMENTS $49,182,25 CITY OF FORT WORTH STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS - DEVELOPER AWARDED PROJECTS Form Version April 2, 2014 00 42 43 Bid Proposal DAP efa 00 45 12 DAP PREQUALIFICATION STATEMENT Page 1 of 1 SECTION 00 4512 DAP — PREQUALIFICATION STATEMENT Each Bidder is required to complete the information below by identifying the prequalified contractors and/or subcontractors whom they intend to utilize for the major work type(s) listed. In the "Major Work Type" box provide the complete major work type and actual description as provided by the Water Department for water and sewer and TPW for paving_ Major Work Type Contractor/Subcontractor Company Name Prequalification Expiration Date Street Lighting and Electric STF Design and Build 03/15/2020 The undersigned hereby certifies that the contractors and/or subcontractors described in the table above are currently prequalified for the work types listed. BIDDER: STF Design and Build BY: 2820 East Belknap Street Fort Worth, Texas 76111 ( gna TITLE: -V-P DATE: //2/20 2-v END OF SECTION CITY OF FORT WORTH STANDARD CONSTRUCTION PREQUALIFICATION STATEMENT— DEVELOPER AWARDED PROJECTS Lights 0045 12_Prequalification Statement 2015—DAP Street Form Version September 1, 2015 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 004526-1 CONTRACTOR COMPLIANCE WITH WORKER'S COMPENSATION LAW Page I of 1 SECTION 00 45 26 CONTRACTOR COMPLIANCE WITH WORKER'S COMPENSATION LAW Pursuant to Texas Labor Code Section 406.096(a), as amended, Contractor certifies that it provides worker's compensation insurance coverage for all of its employees employed on City Project No. 102275. Contractor further certifies that, pursuant to Texas Labor Code, Section 406.096(b), as amended, it will provide to City its subcontractor's certificates of compliance with worker's compensation coverage. CONTRACTOR: STY Design and Build Co. Inc By: Company 2820 E. Belknap Street Signature: Address Ft Worth TX 76111 Title: City/State/Zip THE STATE OF TEXAS § COUNTY OF TARRANT § Larry Hussey (Please Print) BEF MEthe dersigned authority, on this day personally appeared fro41/ u's5eknown to me to be the person whose name is subscribed t the fore oin strument, cknpw edged to me that he/she executed the same as the act and deed of �51 ? 3 ' d �• for the purposes and consideration therein expressed and in the capacity therein stated. /G Gy9V,N UNDER MY HAND AND SEAL OF OFFICE this ! d day of 20�. 1Y � Linda G. Ellis ' ' My Commission Expires Notary Public in and for the State of Texas 10t2112022 `"OF ID No. 6363838 N.' END OF SECTION CITY OF FORT WORTH STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS Revised April 2, 2014 Lakes of river Trails East Phase 17A Citv Proiect No. - 1022 75 00 52 43 - 1 Developer Awarded Project Agreement Page 1 of 4 1 SECTION 00 52 43 2 AGREEMENT 3 THIS AGREEMENT, authorized on /- of-olOcAs made by and between the Developer, 4 CKK Residential Group, II LLC., authorized to do business in Texas ("Developer"), and STF 5 Design & Build., authorized to do business in Texas, acting by and through its duly authorized 6 representative, ("Contractor"). 7 Developer and Contractor, in consideration of the mutual covenants hereinafter set forth, agree as 8 follows: 9 Article 1. WORK 10 Contractor shall complete all Work as specified or indicated in the Contract Documents for the 11 Project identified herein. 12 Article 2. PROJECT 13 The project for which the Work under the Contract Documents may be the whole or only a part is 14 generally described as follows: 15 Lakes of River Trails East Phase 17A 16 City Proiect No.—102275; X No. — X-26183; FID No. — 30114-0200431-102275-EO7685 17 File No. — W-2657 18 Article 3. CONTRACT TIME 19 3.1 Time is of the essence. 20 All time limits for Milestones, if any, and Final Acceptance as stated in the Contract 21 Documents are of the essence to this Contract. 22 3.2 Final Acceptance. 23 The Work will be complete for Final Acceptance within 120 calendar days after the date 24 when the Contract Time commences to run as provided in Paragraph 12.04 of the Standard 25 City Conditions of the Construction Contract for Developer Awarded Projects. 26 3.3 Liquidated damages 27 28 29 30 31 32 33 34 35 36 37 Contractor recognizes that time is of the essence of this Agreement and that Developer will suffer financial loss if the Work is not completed within the times specified in Paragraph 3.2 above, plus any extension thereof allowed in accordance with Article 10 of the Standard City Conditions of the Construction Contract for Developer Awarded Projects. The Contractor also recognizes the delays, expense and difficulties involved in proving in a legal proceeding the actual loss suffered by the Developer if the Work is not completed on time. Accordingly, instead of requiring any such proof , Contractor agrees that as liquidated damages for delay (but not as a penalty), Contractor shall pay Developer One thousand Dollars ($1 0. 00.00) for each day that expires after the time specified in Paragraph 3.2 for Final Acceptance until the City issues the Final Letter of Acceptance. CITY OF FORT WORTH Laker of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS — DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised June 16, 2016 00 52 43 - 2 Developer Awarded Project Agreement Page 2 of 4 38 Article 4. CONTRACT PRICE 39 Developer agrees to pay Contractor for performance of the Work in accordance with the Contract 40 Documents an amount in current funds of Forty nine thousand one hundred eighty two dollars 41 and twenty five cents. ($49,182.25). 42 Article 5. CONTRACT DOCUMENTS 43 5.1 CONTENTS: 44 A. The Contract Documents which comprise the entire agreement between Developer and 45 Contractor concerning the Work consist of the following: 46 1. This Agreement. 47 2. Attachments to this Agreement: 48 a. Bid Form (As provided by Developer) 49 1) Proposal Form (DAP Version) 50 2) Prequalification Statement 51 3) State and Federal documents (project specific) 52 b. Insurance ACORD Form(s) 53 c. Payment Bond (DAP Version) 54 d. Performance Bond (DAP Version) 55 e. Maintenance Bond (DAP Version) 56 f. Power of Attorney for the Bonds 57 g. Worker's Compensation Affidavit 58 h. MBE and/or SBE Commitment Form (If required) 59 3. Standard City General Conditions of the Construction Contract for Developer 60 Awarded Projects. 61 4. Supplementary Conditions. 62 5. Specifications specifically made a part of the Contract Documents by attachment 63 or, if not attached, as incorporated by reference and described in the Table of 64 Contents of the Project's Contract Documents. 65 6. Drawings. 66 7. Addenda. 67 8. Documentation submitted by Contractor prior to Notice of Award. 68 9. The following which may be delivered or issued after the Effective Date of the 69 Agreement and, if issued, become an incorporated part of the Contract Documents: 70 a. Notice to Proceed. 71 b. Field Orders. 72 c. Change Orders. 73 d. Letter of Final Acceptance. 74 75 CITY OF FORT WORTH Lakes gf'River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS — DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised June 16, 2016 005243-3 Developer Awarded Project Agreement Page 3 of 4 76 Article 6. INDEMNIFICATION 77 6.1 Contractor covenants and agrees to indemnify, hold harmless and defend, at its own 78 expense, the city, its officers, servants and employees, from and against any and all 79 claims arising out of, or alleged to arise out of, the work and services to be performed 80 by the contractor, its officers, agents, employees, subcontractors, licenses or invitees 81 under this contract. This indemnification provision is specifically intended to operate 82 and be effective even if it is alleged or proven that all or some of the damages being 83 sought were caused, in whole or in part, by any act, omission or negligence of the city. 84 This indemnity provision is intended to include, without limitation, indemnity for 85 costs, expenses and legal fees incurred by the city in defending against such claims and 86 causes of actions. 87 88 6.2 Contractor covenants and agrees to indemnify and hold harmless, at its own expense, 89 the city, its officers, servants and employees, from and against any and all loss, damage 90 or destruction of property of the city, arising out of, or alleged to arise out of, the work 91 and services to be performed by the contractor, its officers, agents, employees, 92 subcontractors, licensees or invitees under this contract. This indemnification 93 provision is specifically intended to operate and be effective even if it is alleged or 94 proven that all or some of the damages being sought were caused, in whole or in part, 95 by anv act, omission or negligence of the citv. 96 97 Article 7. MISCELLANEOUS 98 7.1 Terms. 99 Terms used in this Agreement are defined in Article 1 of the Standard City Conditions of 100 the Construction Contract for Developer Awarded Projects. 101 7.2 Assignment of Contract. 102 This Agreement, including all of the Contract Documents may not be assigned by the 103 Contractor without the advanced express written consent of the Developer. 104 7.3 Successors and Assigns. 105 Developer and Contractor each binds itself, its partners, successors, assigns and legal 106 representatives to the other party hereto, in respect to all covenants, agreements and 107 obligations contained in the Contract Documents. 108 7.4 Severability. 109 Any provision or part of the Contract Documents held to be unconstitutional, void or 110 unenforceable by a court of competent jurisdiction shall be deemed stricken, and all ill remaining provisions shall continue to be valid and binding upon DEVELOPER and 112 CONTRACTOR. 113 7.5 Governing Law and Venue. 114 This Agreement, including all of the Contract Documents is performable in the State of 115 Texas. Venue shall be Tarrant County, Texas, or the United States District Court for the 116 Northern District of Texas, Fort Worth Division. CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS — DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised June 16, 2016 00 52 43 - 4 Developer Awarded Project Agreement Page 4 of 4 117 118 7.6 Authority to Sign. 119 Contractor shall attach evidence of authority to sign Agreement, if other than duly 120 authorized signatory of the Contractor. 121 122 123 124 125 126 127 IN WITNESS WHEREOF, Developer and Contractor have executed this Agreement in multiple counterparts. This Agreement is effective as of the last date signed by the Parties ("Effective Date") Contractor: ,5LF Ors /�� 411,0 O/J,,O —By: ( re) Developer: CKK Residential Group, 77 LLC (Sign ture) Kenneth B. Newell (Printed Name) (Printed Name) Title: �/ P Title: Managing Partner Company Name: <57-7 WAD Company name: CKK Residential Group, II LLC Address: ,:�12,V F ,Qf.0 f'�/�P sr Address: PO Box 185104 Fort Worth, Texas 76118 City/State/Zip: r-7-lt)0,0,1/ 7;�- &4 City/State/Zip: //2%2�� Date Date � - ap - /�, CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS — DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised June 16, 2016 Bond #4432915 00 62 13 - 1 PERFORMANCE BOND Page 1 of 2 1 SECTION 00 6213 2 PERFORMANCE BOND 3 4 THE STATE OF TEXAS § 5 § KNOW ALL BY THESE PRESENTS: 6 COUNTY OF TARRANT § 7 That we, STF Design & Build known as "Principal" 8 herein and SureTec Insurance Company a corporate surety(sureties, if 9 more than one) duly authorized to do business in the State of Texas, known as "Surety" herein 10 (whether one or more), are held and firmly bound unto the Developer, CKK Residential Group, H 11 LLC., authorized to do business in Texas ("Developer") and the City of Fort Worth, a Texas 12 municipal corporation ("City"), in the penal sum of, Forty-nine Thousand, One Hundred Eighty-two and Twent Five Cents 49 182.25----------------- 13v Dollars ($ � ), 14 lawful money of the United States, to be paid in Fort Worth, Tarrant County, Texas for the 15 payment of which sum well and truly to be made jointly unto the Developer and the City as dual 16 obligees, we bind ourselves, our heirs, executors, administrators, successors and assigns, jointly 17 and severally, firmly by these presents. 18 WHEREAS, Developer and City have entered into an Agreement for the construction of 19 community facilities in the City of Fort Worth by and through a Community Facilities 20 Agreement, CFA Number CFA19-0137; and 21 WHEREAS, the .n ipal has entered into a certain written contract with the Developer awarded 22 the day of 11 fiv,20 � , which Contract is hereby referred to and made a 23 part hereof for all purposes as if fuset forth herein, to furnish all materials, equipment labor 24 and other accessories defined by law, in the prosecution of the Work, including any Change 25 Orders, as provided for in said Contract designated as Lakes of River Trails East Phase 17A. 26 NOW, THEREFORE, the condition of this obligation is such that if the said Principal 27 shall faithfully perform it obligations under the Contract and shall in all respects duly and 28 faithfully perform the Work, including Change Orders, under the Contract, according to the plans, 29 specifications, and contract documents therein referred to, and as well during any period of 30 extension of the Contract that may be granted on the part of the Developer and/or City, then this 31 obligation shall be and become null and void, otherwise to remain in full force and effect. CITY OF FORT WORTH Lakes ofRiver Trails East Phase 17A STANDARD CITY CONDITIONS — DEVELOPER AWARDED PROJECTS City Projec•r No. - 102275 Revised January 31, 2012 006213-2 PERFORMANCE BOND Page 2 of 2 1 PROVIDED FURTHER, that if any legal action be filed on this Bond, venue shall lie in 2 Tarrant County, Texas or the United States District Court for the Northern District of Texas, Fort 3 Worth Division. 4 This bond is made and executed in compliance with the provisions of Chapter 2253 of the 5 Texas Government Code, as amended, and all liabilities on this bond shall be determined in 6 accordance with the provisions of said statue. 7 IN WITNESS WHEREOF, the Principal and the Surety have SIGNED and SEALED 8 this instrument by duly authorized agents and officers on this the � day of 0J 9 Un C ,20-Z. 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 PRINCIPAL: STF Design & Build BY: _ Si tur ATTEST: Ay'5i5:`y U (Principal) Secretary Name and Title Address: 2820 East Belknap Street Fort Worth, TX 76111 Witness as to Principal / L,4e�__AA Witness as to Kureo Li say Gingras SURETY: SureTec Insurance Company 2103 City West Blvd., Suite 1300, Ho ton, TX 77042 B Y: Signature Katie Rogers, Attorney -in -Fact Name and Title Address: 500 W. 13th St. Fort Worth, TX 76102 Telephone Number: 800-728-2374 43 *Note: If signed by an officer of the Surety Company, there must be on file a certified extract 44 from the by-laws showing that this person has authority to sign such obligation. If 45 Surety's physical address is different from its mailing address, both must be provided. 46 47 The date of the bond shall not be prior to the date the Contract is awarded. CITY OF FORT WORTH Lakes of River Trails East Phase l7.A STANDARD CITY CONDITIONS — DEVELOPER AWARDED PROJECTS City Project e' w. - 102275 Revised January 31, 2012 POA #: 4221178 SureTec Insurance Company LIMITED POWER OF ATTORNEY Know All Men by These Presents, That SURETEC INSURANCE COMPANY (the "Company"), a corporation duly organized and existing under the laws of the State of Texas, and having its principal office in Houston, Harris County, Texas, does by these presents make, constitute and appoint Tracy L. Miller, William Mitchell Jennings, Katie Rogers, Lindsay Senior Gingras - its true and lawful Attorney -in -fact, with full power and authority hereby conferred in its name, place and stead, to execute, acknowledge and deliver any and all bonds, recognizances, undertakings or other instruments or contracts of suretyship to include waivers to the conditions of contracts and consents of surety for, providing the bond penalty does not exceed Five Million and 00/100 Dollars ($5,000,000.00) and to bind the Company thereby as fully and to the same extent as if such bond were signed by the CEO, sealed with the corporate seal of the Company and duly attested by its Secretary, hereby ratifying and confirming all.that the said Attorney -in -Fact may do in the premises. Said appointment is made under and by authority of the following resolutions of the Board of Directors of the SureTec Insurance Company: Be it Resolved, that the President, any Vice -President, any Assistant Vice -President, any Secretary or any Assistant Secretary shall be and is hereby vested with full power and authority to appoint any one or more suitable persons as Attorneys) -in -Fact to represent and act for and on behalf of the Company subject to the following provisions: Attorney -in -Fact may be given full power and authority for and in the name of and of behalf of the Company, to execute, acknowledge and deliver, any and all bonds, recognizances, contracts, agreements or indemnity and other conditional or obligatory undertakings and any and all notices and documents canceling or terminating the Company's liability thereunder, and any such instruments so executed by any such Attorney -in -Fact shall be binding upon the Company as if signed by the President and sealed and effected by the Corporate Secretary. Be it Resolved, that the signature of any authorized officer and seal of the Company heretofore or hereafter affixed to any power of attorney or any certificate relating thereto by facsimile, and any power of attorney or certificate bearing facsimile signature or facsimile seal shall be valid and binding upon the Company with respect to any bond or undertaking to which it is attached. (Adopted at a meeting held on 20" of April, 1999) In Witness Whereof, SURETEC INSURANCE COMPANY has caused these presents to be signed by its CEO, and its corporate seal to be hereto affixed this 17th day of May , A.D. 2019 . SVfiAN� SURETEC INS PANY w`�r "FO By. Wt►u z John Kno ., CE State of Texas ss: County of Harris ~' On this 17th day of May , A.D. 2019 before me personally came John Knox Jr., to me known, who, being by me duly sworn, did depose and say, that he resides in Houston, Texas, that he is CEO of SURETEC INSURANCE COMPANY, the company described in and which executed the above instrument; that he knows the seal of said Company; that the seal affixed to said instrument is such corporate seal; that it was so affixed by order of the Board of Directors of said Company; and that he signed his name thereto by like order. �iirirrr� .{h,�YPUe�4 JACOUELYN GREENLEAF Notary Public, State of Texas Comm. Expires 05-18-2021 Or ID 126903029 Jacq elyn Greenleaf, Notary Public My commission expires May 18, 2021 I, M. Brent Beaty, Assistant Secretary of SURETEC INSURANCE COMPANY, do hereby certify that the above and foregoing is a true and correct copy of a Power of Attorney, executed by said Company, which is still in full force and effect; and furthermore, the resolutions of the Board of Directors, set out in the Power of Attorney are in full force and effect. 'l Given under my hand and the seal of said Company at Houston, Texas this 15Y day of /IUCL� _, _11)Q010 , A.D. . Brent Beaty, A`Xistant SecVetary Any instrument issued in excess of the penalty stated.above is totally void and without any validity. For verification of the authority of this power you may'call (713) 812-0800 any business day between 8:30 am and 5:00 pm CST. Bond #4432915 006214-1 PAYMENT BOND Page 1 of 2 1 SECTION 00 6214 2 PAYMENT BOND 3 4 THE STATE OF TEXAS § 5 § KNOW ALL BY THESE PRESENTS: 6 COUNTY OF TARRANT § 7 That we, STF Design & Build known as 8 "Principal' herein, and SureTec Insurance Company ,a 9 corporate surety ( or sureties if more than one), duly authorized to do business in the State of 10 Texas, known as "Surety" herein (whether one or more), are held and firmly bound unto the 11 Developer, CKK Residential Group, H LLC., authorized to do business in Texas "(Developer"), 12 and the City of Fort Worth, a Texas municipal corporation ("City"), in the penal sum 13 Of Forty-nine Thousand, One Hundred Eighty-two and Twenty Five Cents Dollars ($ 49, 1 82.25----------------- ) e 14 lawful money of the United States, to be paid in Fort Worth, Tarrant County, Texas, for the 15 payment of which sum well and truly be made jointly unto the Developer and the City as dual 16 obligees, we bind ourselves, our heirs, executors, administrators, successors and assigns, jointly 17 and severally, firmly by these presents: 18 WHEREAS, Developer and City have entered into an Agreement for the construction of 19 community facilities in the City of Fort Worth, by and through a Community Facilities 20 Agreement, CFA Number CFA19-0137;and 21 WHEREAS, PrincipankyWW-,-q, entered into a certain written Contract with Developer, 22 awarded the day oft20 � , which Contract is hereby 23 referred to and made a part hereof for all purposes as if fully set forth herein, to furnish all 24 materials, equipment, labor and other accessories as defined by law, in the prosecution of the 25 Work as provided for in said Contract and designated as Lakes of River Trails East Phase 17A. 26 NOW, THEREFORE, THE CONDITION OF THIS OBLIGATION is such that if 27 Principal shall pay all monies owing to any (and all) payment bond beneficiary (as defined in 28 Chapter 2253 of the Texas Government Code, as amended) in the prosecution of the Work under 29 the Contract, then this obligation shall be and become null and void; otherwise to remain in full 30 force and effect. CITY OF FORT WORTH Crakes of River Trails Fast Phase 17.4 STANDARD CITY CONDITIONS — DEVELOPER AWARDED PROJECTS Cier Projeci A6p. - 102275 Revised January 31, 2012 006214-2 PAYMENTBOND Page 2 of 2 This bond is made and executed in compliance with the provisions of Chapter 2253 of the 2 Texas Government Code, as amended, and all liabilities on this bond shall be determined in 3 accordance with the provisions of said statute. 4 IN WITNESS WHEREOF, the Principal and Surety have each SIGNED and SEALED 5 thissii strument by duly authorized agents and officers on this the 5-4h day of 6 �J (�►��ll��l , 20 7 8 9 10 11 12 13 14 PRINCIPAL: STF Design & Build ATTEST: BY: Signatu (Principal) Secretary Name and Title Address: 2820 East Belknap Street Fort Worth, TX 76111 Witness as to Principal ATTEST: see attached power of attorney (Surety) Secretary Z111A A4 , A1,411' Witness as to Surfn a ingras SURETY: SureTec Insurance Comaanv 2103 Cit West Blvd., Suite 1300, Houston, TX 77042 BY: M, Signature Katie Rogers, Attorney -in -Fact Name and Title Address: 500 W. 13th St. Fort Worth, TX 76102 Telephone Number: 800-728-2374 Note: If signed by an officer of the Surety, there must be on file a certified extract from the bylaws showing that this person has authority to sign such obligation. If Surety's physical address is different from its mailing address, both must be provided. The date of the bond shall not be prior to the date the Contract is awarded. END OF SECTION CITY OF FORT WORTH Lakes oj" Rirer Trails East Prase 17 i STANDARD CITY CONDITIONS — DEVELOPER AWARDED PROJECTS Cin- Project No. - 102275 Revised January 31, 2012 POA #: 4221178 SureTec Insurance Company LIMITED POWER OF ATTORNEY Know All Men by These Presents, That SURETEC INSURANCE COMPANY (the "Company"), a corporation duly organized and existing under the laws of the State of Texas, and having its principal office in Houston, Harris County, Texas, does by these presents make, constitute and appoint Tracy L. Miller, William Mitchell Jennings, Katie Rogers, Lindsay Senior Gingras its true and lawful Attorney -in -fact, with full power and authority hereby conferred in its name, place and stead, to execute, acknowledge and deliver any and all bonds, recognizances, undertakings or other instruments or contracts of suretyship to include waivers to the conditions of contracts and consents of surety for, providing the bond penalty does not exceed Five Million and 00/100 Dollars ($5,000,000.00) and to bind the Company thereby as fully and to the same extent as if such bond were signed by the CEO, sealed with the corporate seal of the Company and duly attested by its Secretary, hereby ratifying and confirming all that the said Attorney -in -Fact may do in the premises. Said appointment is made under and by authority of the following resolutions of the Board of Directors of the SureTec Insurance Company: Be it Resolved, that the President, any Vice -President, any Assistant Vice -President, any Secretary or any Assistant Secretary shall be and is hereby vested with full power and authority to appoint any one or more suitable persons as Attomey(s)-in-Fact to represent and act for and on behalf of the Company subject to the following provisions: Attorney -in -Fact may be given full power and authority for and in the name of and of behalf of the Company, to execute, acknowledge and deliver, any and all bonds, recognizances, contracts, agreements or indemnity and other conditional or obligatory undertakings and any and all notices and documents canceling or terminating the Company's liability thereunder, and any such instruments so executed by any such Attorney -in -Fact shall be binding upon the Company as if signed by the President and sealed and effected by the Corporate Secretary. Be it Resolved, that the signature of any authorized officer and seal of the Company heretofore or hereafter affixed to any power of attorney or any certificate relating thereto by facsimile, and any power of attorney or certificate bearing facsimile signature or facsimile seal shall be valid and binding upon the Company with respect to any bond or undertaking to which it is attached. (Adopted at a meeting held on 201" of April, 1999.) In Witness Whereof, SURETEC INSURANCE COMPANY has caused these presents to be signed by its CEO, and its corporate seal to be hereto affixed this 17th day of May , A.D. 2019 . I111101111 ,% SURETEC INS7 PANY SORANp� w w X qoD By. ' John Kno , CE dr State of Texas ss: �� County of Harris ......... On this 17th day of May , A.D. 2019 before me personally came John Knox Jr., to me known, who, being by me duly sworn, did depose and say, that he resides in. Houston, Texas, that he is CEO of SURETEC INSURANCE COMPANY, the company described in and which executed the above instrument; that he knows the seal of said Company; that the seal affixed to said instrument is such corporate seal; that it was so affixed by order of the Board of Directors of said Company; and that he signed his name thereto by like order. JACOUELYN GREENLEAF a` tlotary Public, State of Texas I ^'.•'e- Comm. Expires05-18-2021 d( tn°riN4` Notary ID 126903029 ,-AMN7_ Jacq elyn Greenleaf, Notary Public My commission expires May 18, 2021 I, M. Brent Beaty, Assistant Secretary of SURETEC INSURANCE COMPANY, do hereby certify that the above and foregoing is a true and correct copy of a Power of Attorney, executed by said Company, which is still in full force and effect; and furthermore, the resolutions of the Board of Directors, set out in the Power of Attorney are in full force and effect. Given under my hand and the seal of said Company at Houston;. Teims this _ day of ti i� 14a r OZO a0 ; A.D. . Bre'd Beaty, A %stint Sedietary Any instrument issued in excess of the penalty stated above is tot -illy void and without any validity. For verification of the authority of this power you may call (713) 81:2-01!100 any business day between 8:30 am and 5:00 pm CST. Bond #4432915 006219-1 MAINTENANCE BOND Page 1 of 3 1 SECTION 00 6219 2 MAINTENANCE BOND 3 4 THE STATE OF TEXAS § 5 § KNOW ALL BY THESE PRESENTS: 6 COUNTY OF TARRANT § 7 8 That we, STF Design & Build , known as "Principal" 9 herein and SureTec Insurance Company a corporate surety (sureties, if 10 more than one) duly authorized to do business in the State of Texas, known as "Surety" herein 11 (whether one or more), are held and firmly bound unto the Developer, CKK Residential Group, H 12 LLC., authorized to do business in Texas ("Developer") and the City of Fort Worth, a Texas 13 municipal corporation ("City"), in the Sum of Forty-nine Thousand, One Hundred Eighty-two and Twenty Five Cents 14 Dollars ($ 49,182.25 ----------------- ), lawful money of the United States, to be paid in Fort 15 Worth, Tarrant County, Texas, for payment of which sum well and truly be made jointly unto the 16 Developer and the City as dual obligees and their successors, we bind ourselves, our heirs, 17 executors, administrators, successors and assigns, jointly and severally, firmly by these presents. 18 19 WHEREAS, Developer and City have entered into an Agreement for the construction of 20 community facilities in the City of Fort Worth by and through a Community Facilities 21 Agreement, CFA Number CFA19-0137; and 22 WHEREAV the Pri p 1 has entered into a certain written contract with the Developer 23 awarded the day of Lk4, 20 10, which Contract is 24 hereby referred to and a made part hereof for all purposes as if fully set forth herein, to furnish all 25 materials, equipment labor and other accessories as defined by law, in the prosecution of the 26 Work, including any Work resulting from a duly authorized Change Order (collectively herein, 27 the "Work") as provided for in said Contract and designated as Lakes of Rimer Trails East Phase 28 17A; and 29 30 WHEREAS, Principal binds itself to use such materials and to so construct the Work in 31 accordance with the plans, specifications and Contract Documents that the Work is and will 32 remain free from defects in materials or workmanship for and during the period of two (2) years 33 after the date of Final Acceptance of the Work by the City ("Maintenance Period"); and 34 CITY OF FORT WORTH Lakes gj'River Trails East Phase 17A STANDARD CITY CONDITIONS - DEVELOPER AWARDED PROJECTS City Project aX"a. - 102-175 Revised January 31, 2012 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 006219-2 MAINTENANCE BOND Page 2 of 3 WHEREAS, Principal binds itself to repair or reconstruct the Work in whole or in part upon receiving notice from the Developer and/or City of the need thereof at any time within the .. Maintenance Period. NOW THEREFORE, the condition of this obligation is such that if Principal shall remedy any defective Work, for which timely notice was provided by Developer or City, to a completion satisfactory to the City, then this obligation shall become null and void; otherwise to remain in full force and effect. PROVIDED, HOWEVER, if Principal shall fail so to repair or reconstruct any timely noticed defective Work, it is agreed that the Developer or City may cause any and all such defective Work to be repaired and/or reconstructed with all associated costs thereof being borne by the Principal and the Surety under this Maintenance Bond; and PROVIDED FURTHER, that if any legal action be filed on this Bond, venue shall lie in Tarrant County, Texas or the United States District Court for the Northern District of Texas, Fort Worth Division; and PROVIDED FURTHER, that this obligation shall be continuous in nature and successive recoveries may be had hereon for successive breaches. CITY OF FORT WORTH STANDARD CITY CONDITIONS — DEVELOPER AWARDED PROJECTS Revised January 31, 2012 Lakes (if River Trails East Please L?.A City Project e,Ve. - 102275 006219-3 MAINTENANCE BOND Page 3 of 3 1 IN WITNESS WHEREOF, the Principal and the Surety have each SIGNED and SEALED this 2 instrument by duly authorized agents and officers on this the day of 3 20_-D. 4 5 6 7 8 9 10 11 ATTEST: 12 13 14 (Principal) Secretary 15 16 17 18 19 20 Witness as to Principal 21 22 23 24 25 26 27 28 29 ATTEST: 30 31 see attached power of attorney 32 (Suret ) Secre y 33 34 35 Witness as to Surety Li say gras 36 37 *Note 38 39 40 41 42 PRINCIPAL: STF Design & Build BY: Sig ur Z,1� /7 12 -�s f Z Name and Title Address: 2820 East Belknap Street Fort Worth, TX 76111 SURETY: - SureTec Insurance Company_ 2103 Citywest Blvd., Suite 1300, Houston, Tx 77042 BY: Signature Katie Rogers, Attorney -in -Fact Name and Title Address: 500 W. 13th St. Fort Worth, TX 76102 Telephone Number: 800-728-2374 If signed by an officer of the Surety Company, there must be on file a certified extract from the by-laws showing that this person has authority to sign such obligation. If Surety's physical address is different from its mailing address, both must be provided. The date of the bond shall not be prior to the date the Contract is awarded. CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CITY CONDITIONS — DEVELOPER AWARDED PROJECTS ChY Project N 'tk - 102275 Revised January 31, 2012 POA if: 4221178 SureTec Insurance Company. LIMITED ]POWER OF ATTORNEY Know All Men by These Presents, That SURETEC INSURANCE COMPANY (the "Company"), a corporation duly organized and existing under the laws of the State of Texas, and having its principal office in Houston; Harris County, Texas, does by these presents make, constitute and appoint Tracy L. Miller, William Mitchell Jennings, Katie Rogers, Lindsay Senior Gingras its true and lawful Attorney -in -fact, with full power and authority hereby conferred in its name, place and stead, to execute, acknowledge and deliver any and all bonds, recognizances, undertakings or other instruments or contracts of suretyship to include waivers to the conditions of contracts and consents of surety for, providing the bond penalty does not exceed Five Million and 00/100 Dollars ($5,000,000.00) and to bind the Company thereby as fully and to the same extent as if such bond were signed by the CEO, sealed with the corporate seal of the Company and duly attested by its Secretary, hereby ratifying and confirming all that the said Attorney -in -Fact may do in the premises. Said appointment is made under and by authority of the following resolutions of the Board of Directors of the SureTec Insurance Company: Be it Resolved, that the President, any Vice -President, any Assistant Vice -President, any Secretary or any Assistant Secretary shall be and is hereby vested with full power and authority to appoint any one or more suitable persons as Attorney(s)-in-Fact to represent and act for and on behalf of the Company subject to the following provisions: Attorney -in -Fact may be given full power and authority for and in the name of and of behalf of the Company, to execute, acknowledge and deliver, any and all bonds, recognizances, contracts, agreements or indemnity and other conditional or obligatory undertakings and any and all notices and documents canceling or terminating the Company's liability thereunder, and any such instruments so executed by any such Attorney -in -Fact shall be binding upon the Company as if signed by the President and sealed and effected by the Corporate Secretary. Be it Resolved, that the signature of any authorized officer and seal of the Company heretofore or hereafter affixed to any power of attorney or any certificate relating thereto by facsimile, and any power of attorney or certificate bearing facsimile signature or facsimile seal shall be valid and binding upon the Company with respect to any bond or undertaking to which it is attached. (Adopted at a meeting held on 20'* of April, 1999.) In Witness Whereof, SURETEC INSURANCE COMPANY has caused these presents to be signed by its CEO, and its corporate seal to be hereto affixed this firth day of May A.D. 2019 . SURETEC INS PANY SVRANC�*+q \� C� By: w w M John Kno , CE State of Texas ss: 7` d County of Harris s' •••-•"' On this 17th day of May , A.D. 2019 before me personally came John Knox Jr., to me known, who, being by me duly sworn, did depose and say, that he resides in Houston, Texas, that he is CEO of SURETEC INSURANCE COMPANY, the company described in and which executed the above instrument; that he knows the seal of said Company; that the seal affixed to said instrument is such corporate seal; that it was so affixed by order of the Board of Directors of said Company; and that he signed his name thereto by like order. P�/ JACOUELYN GREENLEAF b /i F Notary Public, State of Texas Comm. Expires 05-18-2021 �'i ''�;,p„��` Notary ID 126903029 MOE Jacq elyn Greenleaf, Notary Public My commission expires May 18 2021 I, M. Brent Beaty, Assistant Secretary of SURETEC INSURANCE COMPANY, do hereby certify that the above and foregoing is a true and correct copy of a Power of Attorney, executed by said Company, which is still in full force and effect; and furthermore, the resolutions of the hoard of Directors, set out in the Power of Attorney are in full force and effect. Given under my hand and the seal of said Company at Houston, Texas this r"_ day of�p a t% A.D. . Brenf Beaty, A`>1Sristant SeeVetary Any instrument issued in excess of the penalty stated above is totally void and wiincut ptny validity. For verification of the authority of this power you may call (713) 812-0800 any business day between 8:30 am and.5:00,:pm C�T. SureTec Insurance Company IMPORTANT NOTICE Statutory Complaint Notice/Filing of Claims To obtain information or make a complaint: You may call the Surety's toll free telephone number for information or to make a complaint or file a claim at: 1-866-732-0099. You may also write to the Surety at: SureTec Insurance Company 9737 Great Hills Trail, Suite 320 Austin, TX 78759 You may contact the Texas Department of Insurance to obtain information on companies, coverage, rights or complaints at 1-800-252- 3439. You may write the Texas Department of Insurance at: PO Box 149104 Austin, TX 78714-9104 Fax#: 512-490-1007 Web: http://www.tdi.texas.gov Email: ConsumerProtection@tdi.texas.gov PREMIUM OR CLAIMS DISPUTES: Should you have a dispute concerning your premium or about a claim, you should contact the Surety first. If the dispute is not resolved, you may contact the Texas Department of Insurance. Texas Rider 8/2019 &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ 67$1'$5'&,7<&21',7,216 2)7+(&216758&7,21&2175$&7 )25'(9(/23(5$:$5'('352-(&76 &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ 67$1'$5'&,7<&21',7,2162)7+( &216758&7,21&2175$&7 )25'(9(/23(5$:$5'('352-(&76 7$%/(2)&217(176 3DJH $UWLFOH±'HILQLWLRQVDQG7HUPLQRORJ\ 'HILQHG7HUPV 7HUPLQRORJ\ $UWLFOH±3UHOLPLQDU\0DWWHUV %HIRUH6WDUWLQJ&RQVWUXFWLRQ 3UHFRQVWUXFWLRQ&RQIHUHQFH 3XEOLF0HHWLQJ $UWLFOH±&RQWUDFW'RFXPHQWVDQG$PHQGLQJ 5HIHUHQFH6WDQGDUGV $PHQGLQJDQG6XSSOHPHQWLQJ&RQWUDFW'RFXPHQWV $UWLFOH±%RQGVDQG,QVXUDQFH /LFHQVHG6XUHWLHVDQG,QVXUHUV 3HUIRUPDQFH3D\PHQWDQG0DLQWHQDQFH%RQGV &HUWLILFDWHVRI,QVXUDQFH &RQWUDFWRU¶V,QVXUDQFH $FFHSWDQFHRI%RQGVDQG,QVXUDQFH2SWLRQWR5HSODFH $UWLFOH±&RQWUDFWRU¶V5HVSRQVLELOLWLHV 6XSHUYLVLRQDQG6XSHULQWHQGHQW /DERU:RUNLQJ+RXUV 6HUYLFHV0DWHULDOVDQG(TXLSPHQW 3URMHFW6FKHGXOH 6XEVWLWXWHVDQG³2U(TXDOV´ 3UH4XDOLILFDWLRQRI%LGGHUV3ULPH&RQWUDFWRUVDQG6XEFRQWUDFWRUV &RQFHUQLQJ6XEFRQWUDFWRUV6XSSOLHUVDQG2WKHUV :DJH5DWHV 3DWHQW)HHVDQG5R\DOWLHV /DZVDQG5HJXODWLRQV 8VHRI6LWHDQG2WKHU$UHDV 5HFRUG'RFXPHQWV 6DIHW\DQG3URWHFWLRQ 6DIHW\5HSUHVHQWDWLYH +D]DUG&RPPXQLFDWLRQ3URJUDPV 6XEPLWWDOV &RQWUDFWRU¶V*HQHUDO:DUUDQW\DQG*XDUDQWHH &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ ,QGHPQLILFDWLRQ 'HOHJDWLRQRI3URIHVVLRQDO'HVLJQ6HUYLFHV 5LJKWWR$XGLW 1RQGLVFULPLQDWLRQ $UWLFOH±2WKHU:RUNDWWKH6LWH 5HODWHG:RUNDW6LWH $UWLFOH±&LW\¶V5HVSRQVLELOLWLHV ,QVSHFWLRQV7HVWVDQG$SSURYDOV /LPLWDWLRQVRQ&LW\¶V5HVSRQVLELOLWLHV &RPSOLDQFHZLWK6DIHW\3URJUDP $UWLFOH±&LW\¶V2EVHUYDWLRQ6WDWXV'XULQJ&RQVWUXFWLRQ &LW\¶V3URMHFW5HSUHVHQWDWLYH $XWKRUL]HG9DULDWLRQVLQ:RUN 5HMHFWLQJ'HIHFWLYH:RUN 'HWHUPLQDWLRQVIRU:RUN3HUIRUPHG $UWLFOH±&KDQJHVLQWKH:RUN $XWKRUL]HG&KDQJHVLQWKH:RUN 1RWLILFDWLRQWR6XUHW\ $UWLFOH±&KDQJHRI&RQWUDFW3ULFH&KDQJHRI&RQWUDFW7LPH &KDQJHRI&RQWUDFW3ULFH &KDQJHRI&RQWUDFW7LPH 'HOD\V $UWLFOH±7HVWVDQG,QVSHFWLRQV&RUUHFWLRQ5HPRYDORU$FFHSWDQFHRI'HIHFWLYH:RUN 1RWLFHRI'HIHFWV $FFHVVWR:RUN 7HVWVDQG,QVSHFWLRQV 8QFRYHULQJ:RUN &LW\0D\6WRSWKH:RUN &RUUHFWLRQRU5HPRYDORI'HIHFWLYH:RUN &RUUHFWLRQ3HULRG &LW\0D\&RUUHFW'HIHFWLYH:RUN $UWLFOH±&RPSOHWLRQ &RQWUDFWRU¶V:DUUDQW\RI7LWOH 3DUWLDO8WLOL]DWLRQ )LQDO,QVSHFWLRQ )LQDO$FFHSWDQFH $UWLFOH±6XVSHQVLRQRI:RUN &LW\0D\6XVSHQG:RUN $UWLFOH±0LVFHOODQHRXV *LYLQJ1RWLFH &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ &RPSXWDWLRQRI7LPHV &XPXODWLYH5HPHGLHV 6XUYLYDORI2EOLJDWLRQV +HDGLQJV 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ $57,&/(±'(),1,7,216$1'7(50,12/2*< Defined Terms $ :KHUHYHUXVHGLQWKHVH*HQHUDO&RQGLWLRQVRULQRWKHU&RQWUDFW'RFXPHQWVWKHWHUPVOLVWHG EHORZKDYHWKHPHDQLQJVLQGLFDWHGZKLFKDUHDSSOLFDEOHWRERWKWKHVLQJXODUDQGSOXUDOWKHUHRI DQGZRUGVGHQRWLQJJHQGHUVKDOOLQFOXGHWKHPDVFXOLQHIHPLQLQHDQGQHXWHU6DLGWHUPVDUH JHQHUDOO\FDSLWDOL]HGRUZULWWHQLQLWDOLFVEXWQRWDOZD\V:KHQXVHGLQDFRQWH[WFRQVLVWHQWZLWK WKHGHILQLWLRQRIDOLVWHGGHILQHGWHUPWKHWHUPVKDOOKDYHDPHDQLQJDVGHILQHGEHORZZKHWKHU FDSLWDOL]HGRULWDOLFL]HGRURWKHUZLVH,QDGGLWLRQWRWHUPVVSHFLILFDOO\GHILQHGWHUPVZLWKLQLWLDO FDSLWDOOHWWHUVLQWKH&RQWUDFW'RFXPHQWVLQFOXGHUHIHUHQFHVWRLGHQWLILHGDUWLFOHVDQGSDUDJUDSKV DQGWKHWLWOHVRIRWKHUGRFXPHQWVRUIRUPV Agreement - 7KHZULWWHQLQVWUXPHQWZKLFKLVHYLGHQFHRIWKHDJUHHPHQWEHWZHHQ'HYHORSHU DQG&RQWUDFWRUFRYHULQJWKH:RUN Asbestos—$Q\PDWHULDOWKDWFRQWDLQVPRUHWKDQRQHSHUFHQWDVEHVWRVDQGLVIULDEOHRULV UHOHDVLQJDVEHVWRVILEHUVLQWRWKHDLUDERYHFXUUHQWDFWLRQOHYHOVHVWDEOLVKHGE\WKH8QLWHG 6WDWHV2FFXSDWLRQDO6DIHW\DQG+HDOWK$GPLQLVWUDWLRQ Business Day –$EXVLQHVVGD\LVGHILQHGDVDGD\WKDWWKH&LW\FRQGXFWVQRUPDOEXVLQHVV JHQHUDOO\0RQGD\WKURXJK)ULGD\H[FHSWIRUIHGHUDORUVWDWHKROLGD\VREVHUYHGE\WKH&LW\ Buzzsaw±&LW\¶VRQOLQHHOHFWURQLFGRFXPHQWPDQDJHPHQWDQGFROODERUDWLRQV\VWHP Calendar Day±$GD\FRQVLVWLQJRIKRXUVPHDVXUHGIURPPLGQLJKWWRWKHQH[WPLGQLJKW City— The City of Fort Worth, Texas, a Texas home-rule municipal corporation, acting by, its governing body through its City Manager, his designee, or agents authorized pursuant to its duly authorized charter on his behalf. Community Facilities Agreement (CFA) -–A Contract between the Developer and the City for the Construction of one or more following public facilities within the City public right-of- way or easement: Water, Sanitary Sewer, Street, Storm Drain, Street Light, and Street Signs. A CFA may include private facilities within the right-of-way dedicated as private right-of- way or easement on a recorded plat. Contract—The entire and integrated written document incorporating the Contract Documents between the Developer, Contractor, and/or City concerning the Work. The Contract supersedes prior negotiations, representations, or agreements, whether written or oral. Contract Documents—Those items that make up the contract and which must include the Agreement, and it’s attachments such as standard construction specifications, standard City Conditions, other general conditions of the Developer, including: D $Q$JUHHPHQW 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ E $WWDFKPHQWVWRWKH$JUHHPHQW L %LG)RUP LL 9HQGRU&RPSOLDQFHZLWK6WDWH/DZ1RQ5HVLGHQW%LGGHU LLL 3UHTXDOLILFDWLRQ6WDWHPHQW F &XUUHQW3UHYDLOLQJ:DJH5DWHV7DEOHLIUHTXLUHGE\&LW\ G ,QVXUDQFH$FFRUG)RUP H 3D\PHQW%RQG I 3HUIRUPDQFH%RQG J 0DLQWHQDQFH%RQG K 3RZHURI$WWRUQH\IRU%RQGV L :RUNHUV&RPSHQVDWLRQ$IILGDYLW M 0:%(&RPPLWPHQW)RUP,IUHTXLUHGE\&LW\ N *HQHUDO&RQGLWLRQV O 6XSSOHPHQWDU\&RQGLWLRQV P 7KH6WDQGDUG&LW\&RQGLWLRQV Q 6SHFLILFDWLRQVVSHFLILFDOO\PDGHSDUWRIWKH&RQWUDFW'RFXPHQWVE\DWWDFKPHQWLI QRWDWWDFKHGDVLQFRUSRUDWHGE\UHIHUHQFHDQGGHVFULEHGLQWKH7DEOHRI&RQWHQWVRI WKH3URMHFW¶V&RQWUDFW'RFXPHQWV R 'UDZLQJV S 'RFXPHQWDWLRQVXEPLWWHGE\FRQWUDFWRUSULRUWR1RWLFHRI$ZDUG T 7KH IROORZLQJ ZKLFK PD\ EH GHOLYHUHG RU LVVXHG DIWHU WKH HIIHFWLYH GDWH LI WKH $JUHHPHQWDQGLILVVXHGEHFRPHDQLQFRUSRUDWHGSDUWRIWKH&RQWUDFW'RFXPHQWV L 1RWLFHWR3URFHHG LL )LHOG2UGHUV LLL &KDQJH2UGHUV LY /HWWHUVRI)LQDO$FFHSWDQFH U $SSURYHG6XEPLWWDOVRWKHU&RQWUDFWRUVXEPLWWDOVDQGWKHUHSRUWVDQGGUDZLQJVRI VXEVXUIDFHDQGSK\VLFDOFRQGLWLRQVDUHQRW&RQWUDFW'RFXPHQWV Contractor—The individual or entity with whom Developer has entered into the Agreement. Day or day – A day, unless otherwise defined, shall mean a Calendar Day. Developer – An individual or entity that desires to make certain improvements within the City of Fort Worth Drawings—That part of the Contract Documents prepared or approved by Engineer which graphically shows the scope, extent, and character of the Work to be performed by Contractor. Submittals are not Drawings as so defined. Engineer—The licensed professional engineer or engineering firm registered in the State of Texas performing professional services for the Developer. Final Acceptance – The written notice given by the City to the Developer and/or Contractor that the Work specified in the Contract Documents has been completed to the satisfaction of the City. 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ Final Inspection – Inspection carried out by the City to verify that the Contractor has completed the Work, and each and every part or appurtenance thereof, fully, entirely, and in conformance with the Contract Documents. General Requirements—A part of the Contract Documents between the Developer and a Contractor. Laws and Regulations—Any and all applicable laws, rules, regulations, ordinances, codes, and orders of any and all governmental bodies, agencies, authorities, and courts having jurisdiction. Liens—Charges, security interests, or encumbrances upon Project funds, real property, or personal property. Milestone—A principal event specified in the Contract Documents relating to an intermediate Contract Time prior to Final Acceptance of the Work. Non-Participating Change Order—A document, which is prepared for and reviewed by the City, which is signed by Contractor, and Developer, and authorizes an addition, deletion, or revision in the Work or an adjustment in the Contract Price or the Contract Time, issued on or after the Effective Date of the Agreement. Participating Change Order—A document, which is prepared for and approved by the City, which is signed by Contractor, Developer, and City and authorizes an addition, deletion, or revision in the Work or an adjustment in the Contract Price or the Contract Time, issued on or after the Effective Date of the Agreement. Plans – See definition of Drawings. Project Schedule—A schedule, prepared and maintained by Contractor, in accordance with the General Requirements, describing the sequence and duration of the activities comprising the Contractor’s plan to accomplish the Work within the Contract Time. Project—The Work to be performed under the Contract Documents. Project Representative—The authorized representative of the City who will be assigned to the Site. Public Meeting – An announced meeting conducted by the Developer to facilitate public participation and to assist the public in gaining an informed view of the Project. Regular Working Hours – Hours beginning at 7:00 a.m. and ending at 6:00 p.m., Monday thru Friday (excluding legal holidays). Samples—Physical examples of materials, equipment, or workmanship that are representative of some portion of the Work and which establish the standards by which such portion of the Work will be judged. 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ Schedule of Submittals—A schedule, prepared and maintained by Contractor, of required submittals and the time requirements to support scheduled performance of related construction activities. Site—Lands or areas indicated in the Contract Documents as being furnished by City or Developer upon which the Work is to be performed, including rights-of-way, permits, and easements for access thereto, and such other lands furnished by City or Developer which are designated for the use of Contractor. Specifications—That part of the Contract Documents consisting of written requirements for materials, equipment, systems, standards and workmanship as applied to the Work, and certain administrative requirements and procedural matters applicable thereto. Specifications may be specifically made a part of the Contract Documents by attachment or, if not attached, may be incorporated by reference as indicated in the Table of Contents (Division 00 00 00) of each Project. Standard City Conditions – That part of the Contract Documents setting forth requirements of the City. Subcontractor—An individual or entity having a direct contract with Contractor or with any other Subcontractor for the performance of a part of the Work at the Site. Submittals—All drawings, diagrams, illustrations, schedules, and other data or information which are specifically prepared or assembled by or for Contractor and submitted by Contractor to illustrate some portion of the Work. Superintendent – The representative of the Contractor who is available at all times and able to receive instructions from the City and/or Developer and to act for the Contractor. Supplementary Conditions—That part of the Contract Documents which amends or supplements the General Conditions. Supplier—A manufacturer, fabricator, supplier, distributor, materialman, or vendor having a direct contract with Contractor or with any Subcontractor to furnish materials or equipment to be incorporated in the Work by Contractor or Subcontractor. Underground Facilities—All underground pipelines, conduits, ducts, cables, wires, manholes, vaults, tanks, tunnels, or other such facilities or attachments, and any encasements containing such facilities, including but not limited to, those that convey electricity, gases, steam, liquid petroleum products, telephone or other communications, cable television, water, wastewater, storm water, other liquids or chemicals, or traffic or other control systems. Weekend Working Hours – Hours beginning at 9:00 a.m. and ending at 5:00 p.m., Saturday, Sunday or legal holiday, as approved in advance by the City. 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ Work—The entire construction or the various separately identifiable parts thereof required to be provided under the Contract Documents. Work includes and is the result of performing or providing all labor, services, and documentation necessary to produce such construction including any Participating Change Order, Non-Participating Change Order, or Field Order, and furnishing, installing, and incorporating all materials and equipment into such construction, all as required by the Contract Documents. Working Day – A working day is defined as a day, not including Saturdays, Sundays, or legal holidays authorized by the City for contract purposes, in which weather or other conditions not under the control of the Contractor will permit the performance of the principal unit of work underway for a continuous period of not less than 7 hours between 7 a.m. and 6 p.m. Terminology $ 7KHZRUGVDQGWHUPVGLVFXVVHGLQ3DUDJUDSK%WKURXJK'DUHQRWGHILQHGEXWZKHQXVHGLQ WKH%LGGLQJ5HTXLUHPHQWVRU&RQWUDFW'RFXPHQWVKDYHWKHLQGLFDWHGPHDQLQJ %Defective: 7KH ZRUG ³GHIHFWLYH´ ZKHQ PRGLI\LQJ WKH ZRUG ³:RUN´ UHIHUVWR :RUN WKDW LV XQVDWLVIDFWRU\IDXOW\RUGHILFLHQWLQWKDWLW D GRHVQRWFRQIRUPWRWKH&RQWUDFW'RFXPHQWVRU E GRHVQRWPHHWWKHUHTXLUHPHQWVRIDQ\DSSOLFDEOHLQVSHFWLRQUHIHUHQFHVWDQGDUGWHVWRU DSSURYDOUHIHUUHGWRLQWKH&RQWUDFW'RFXPHQWVRU F KDVEHHQGDPDJHGSULRUWR&LW\¶VZULWWHQDFFHSWDQFH &Furnish, Install, Perform, Provide: 7KHZRUG³)XUQLVK´RUWKHZRUG³,QVWDOO´RUWKHZRUG³3HUIRUP´RUWKHZRUG³3URYLGH´RU WKHZRUG³6XSSO\´RUDQ\FRPELQDWLRQRUVLPLODUGLUHFWLYHRUXVDJHWKHUHRIVKDOOPHDQ IXUQLVKLQJDQGLQFRUSRUDWLQJLQWKH:RUNLQFOXGLQJDOOQHFHVVDU\ODERUPDWHULDOVHTXLSPHQW DQGHYHU\WKLQJQHFHVVDU\WRSHUIRUPWKH:RUNLQGLFDWHGXQOHVVVSHFLILFDOO\OLPLWHGLQWKH FRQWH[WXVHG ' 8QOHVVVWDWHGRWKHUZLVHLQWKH&RQWUDFW'RFXPHQWVZRUGVRUSKUDVHVWKDWKDYHDZHOONQRZQ WHFKQLFDO RU FRQVWUXFWLRQ LQGXVWU\ RU WUDGH PHDQLQJ DUH XVHG LQ WKH &RQWUDFW 'RFXPHQWV LQ DFFRUGDQFHZLWKVXFKUHFRJQL]HGPHDQLQJ 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ $57,&/(±35(/,0,1$5<0$77(56 Before Starting Construction Baseline Schedules: 6XEPLWWR&LW\LQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWVDQGSULRUWRVWDUWLQJ WKH:RUN1HZVFKHGXOHVZLOOEHVXEPLWWHGWR&LW\ZKHQ3DUWLFLSDWLQJ&KDQJH2UGHUVRU1RQ 3DUWLFLSDWLQJ&KDQJH2UGHUVRFFXU Preconstruction Conference %HIRUHDQ\:RUNDWWKH6LWHLVVWDUWHGWKH&RQWUDFWRUVKDOODWWHQGD3UHFRQVWUXFWLRQ&RQIHUHQFHDV VSHFLILHGLQWKH&RQWUDFW'RFXPHQWV Public Meeting &RQWUDFWRUPD\QRWPRELOL]HDQ\HTXLSPHQWPDWHULDOVRUUHVRXUFHVWRWKH6LWHSULRUWR&RQWUDFWRU DWWHQGLQJWKH3XEOLF0HHWLQJDVVFKHGXOHGE\WKH&LW\ $57,&/(±&2175$&7'2&80(176$1'$0(1',1* Reference Standards $ 6WDQGDUGV6SHFLILFDWLRQV&RGHV/DZVDQG5HJXODWLRQV 5HIHUHQFH WR VWDQGDUGV VSHFLILFDWLRQV PDQXDOV RU FRGHV RIDQ\ WHFKQLFDO VRFLHW\ RUJDQL]DWLRQRUDVVRFLDWLRQRUWR/DZVRU5HJXODWLRQVZKHWKHUVXFKUHIHUHQFHEHVSHFLILFRU E\LPSOLFDWLRQVKDOOPHDQWKHVWDQGDUGVSHFLILFDWLRQPDQXDOFRGHRU/DZVRU5HJXODWLRQV LQHIIHFWDWWKHWLPHRIRSHQLQJRI%LGVRURQWKH(IIHFWLYH'DWHRIWKH$JUHHPHQWLIWKHUH ZHUHQR%LGVH[FHSWDVPD\EHRWKHUZLVHVSHFLILFDOO\VWDWHGLQWKH&RQWUDFW'RFXPHQWV 1R SURYLVLRQ RU LQVWUXFWLRQ VKDOO EH HIIHFWLYH WR DVVLJQ WR &LW\ RU DQ\ RI LWV RIILFHUV GLUHFWRUVPHPEHUVSDUWQHUVHPSOR\HHVDJHQWVFRQVXOWDQWVRUVXEFRQWUDFWRUVDQ\GXW\RU DXWKRULW\WRVXSHUYLVHRUGLUHFWWKHSHUIRUPDQFHRIWKH:RUNRUDQ\GXW\RUDXWKRULW\WR XQGHUWDNHUHVSRQVLELOLW\LQFRQVLVWHQWZLWKWKHSURYLVLRQVRIWKH&RQWUDFW'RFXPHQWV Amending and Supplementing Contract Documents $ 7KH&RQWUDFW'RFXPHQWVPD\EHDPHQGHGWRSURYLGHIRUDGGLWLRQVGHOHWLRQVDQGUHYLVLRQVLQ WKH:RUNRUWRPRGLI\WKHWHUPVDQGFRQGLWLRQVWKHUHRIE\D3DUWLFLSDWLQJ&KDQJH2UGHURUD 1RQ3DUWLFLSDWLQJ&KDQJH2UGHU % 7KHUHTXLUHPHQWVRIWKH&RQWUDFW'RFXPHQWVPD\EHVXSSOHPHQWHGDQGPLQRUYDULDWLRQVDQG GHYLDWLRQVLQWKH:RUNQRWLQYROYLQJDFKDQJHLQ&RQWUDFW3ULFHRU&RQWUDFW7LPHPD\EH DXWKRUL]HGE\RQHRUPRUHRIWKHIROORZLQJZD\V $)LHOG2UGHU 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ &LW\¶VRU(QJLQHHU¶VUHYLHZRID6XEPLWWDOVXEMHFWWRWKHSURYLVLRQVRI3DUDJUDSK&RU &LW\¶VZULWWHQLQWHUSUHWDWLRQRUFODULILFDWLRQ $57,&/(±%21'6$1',1685$1&( Licensed Sureties and Insurers $OOERQGVDQGLQVXUDQFHUHTXLUHGE\WKH&RQWUDFW'RFXPHQWVWREHSXUFKDVHGDQGPDLQWDLQHGE\ &RQWUDFWRUVKDOOEHREWDLQHGIURPVXUHW\RULQVXUDQFHFRPSDQLHVWKDWDUHGXO\OLFHQVHGRUDXWKRUL]HG LQWKH6WDWHRI7H[DVWRLVVXHERQGVRULQVXUDQFHSROLFLHVIRUWKHOLPLWVDQGFRYHUDJHVRUHTXLUHG 6XFKVXUHW\DQGLQVXUDQFHFRPSDQLHVVKDOODOVRPHHWVXFKDGGLWLRQDOUHTXLUHPHQWVDQGTXDOLILFDWLRQV DVPD\EHSURYLGHG6HFWLRQ Performance, Payment, and Maintenance Bonds $ &RQWUDFWRUVKDOOIXUQLVKSHUIRUPDQFHDQGSD\PHQWERQGVLQWKHQDPHRI'HYHORSHUDQG&LW\LQ DFFRUGDQFHZLWK7H[DV*RYHUQPHQW&RGH&KDSWHURUVXFFHVVRUVWDWXWHHDFKLQDQDPRXQW HTXDO WR WKH &RQWUDFW 3ULFH DV VHFXULW\ IRU WKH IDLWKIXO SHUIRUPDQFH DQG SD\PHQW RI DOO RI &RQWUDFWRU¶VREOLJDWLRQVXQGHUWKH&RQWUDFW'RFXPHQWV % &RQWUDFWRUVKDOOIXUQLVKPDLQWHQDQFHERQGVLQWKHQDPHRI'HYHORSHUDQG&LW\LQDQDPRXQW HTXDOWRWKH&RQWUDFW3ULFHDVVHFXULW\WRSURWHFWWKH&LW\DJDLQVWDQ\GHIHFWVLQDQ\SRUWLRQRIWKH :RUNGHVFULEHGLQWKH&RQWUDFW'RFXPHQWV0DLQWHQDQFHERQGVVKDOOUHPDLQLQHIIHFWIRUWZR \HDUVDIWHUWKHGDWHRI)LQDO$FFHSWDQFHE\WKH&LW\ & $OO ERQGV VKDOO EH LQ WKH IRUP SUHVFULEHG E\ WKH &RQWUDFW 'RFXPHQWV H[FHSW DV SURYLGHG RWKHUZLVHE\/DZVRU5HJXODWLRQVDQGVKDOOEHH[HFXWHGE\VXFKVXUHWLHVDVDUHQDPHGLQWKHOLVW RI³&RPSDQLHV+ROGLQJ&HUWLILFDWHVRI$XWKRULW\DV$FFHSWDEOH6XUHWLHVRQ)HGHUDO%RQGVDQG DV$FFHSWDEOH5HLQVXULQJ&RPSDQLHV´DVSXEOLVKHGLQ&LUFXODUDPHQGHGE\WKH)LQDQFLDO 0DQDJHPHQW6HUYLFH6XUHW\%RQG%UDQFK86'HSDUWPHQWRIWKH7UHDVXU\$OOERQGVVLJQHG E\DQDJHQWRUDWWRUQH\LQIDFWPXVWEHDFFRPSDQLHGE\DVHDOHGDQGGDWHGSRZHURIDWWRUQH\ ZKLFKVKDOOVKRZWKDWLWLVHIIHFWLYHRQWKHGDWHWKHDJHQWRUDWWRUQH\LQIDFWVLJQHGHDFKERQG ' ,IWKHVXUHW\RQDQ\ERQGIXUQLVKHGE\&RQWUDFWRULVGHFODUHGEDQNUXSWRUEHFRPHVLQVROYHQWRU LWVULJKWWRGREXVLQHVVLVWHUPLQDWHGLQWKH6WDWHRI7H[DVRULWFHDVHVWRPHHWWKHUHTXLUHPHQWVRI 3DUDJUDSK&&RQWUDFWRUVKDOOSURPSWO\QRWLI\&LW\DQGVKDOOZLWKLQGD\VDIWHUWKHHYHQW JLYLQJULVHWRVXFKQRWLILFDWLRQSURYLGHDQRWKHUERQGDQGVXUHW\ERWKRIZKLFKVKDOOFRPSO\ ZLWKWKHUHTXLUHPHQWVRI3DUDJUDSKVDQG& Certificates of Insurance &RQWUDFWRUVKDOOGHOLYHUWR'HYHORSHUDQG&LW\ZLWKFRSLHVWRHDFKDGGLWLRQDOLQVXUHGDQGORVVSD\HH LGHQWLILHG LQ WKHVH 6WDQGDUG &LW\ &RQGLWLRQV FHUWLILFDWHV RI LQVXUDQFH DQG RWKHU HYLGHQFH RI LQVXUDQFH UHTXHVWHG E\ &LW\ RU DQ\ RWKHU DGGLWLRQDO LQVXUHG ZKLFK &RQWUDFWRU LV UHTXLUHG WR SXUFKDVHDQGPDLQWDLQ 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ 7KH FHUWLILFDWH RI LQVXUDQFH VKDOO GRFXPHQW WKH &LW\ DQ DV ³$GGLWLRQDO ,QVXUHG´ RQ DOO OLDELOLW\SROLFLHV 7KH&RQWUDFWRU¶VJHQHUDOOLDELOLW\LQVXUDQFHVKDOOLQFOXGHD³SHUSURMHFW´RU³SHUORFDWLRQ´ HQGRUVHPHQWZKLFKVKDOOEHLGHQWLILHGLQWKHFHUWLILFDWHRILQVXUDQFHSURYLGHGWRWKH&LW\ 7KHFHUWLILFDWHVKDOOEHVLJQHGE\DQDJHQWDXWKRUL]HGWRELQGFRYHUDJHRQEHKDOIRIWKH LQVXUHGEHFRPSOHWHLQLWVHQWLUHW\DQGVKRZFRPSOHWHLQVXUDQFHFDUULHUQDPHVDVOLVWHGLQ WKHFXUUHQW$0%HVW3URSHUW\ &DVXDOW\*XLGH 7KHLQVXUHUVIRUDOOSROLFLHVPXVWEHOLFHQVHGDQGRUDSSURYHGWRGREXVLQHVVLQWKH6WDWHRI 7H[DV([FHSWIRUZRUNHUV¶FRPSHQVDWLRQDOOLQVXUHUVPXVWKDYHDPLQLPXPUDWLQJRI$ 9,,LQWKHFXUUHQW$0%HVW.H\5DWLQJ*XLGHRUKDYHUHDVRQDEO\HTXLYDOHQWILQDQFLDO VWUHQJWKDQGVROYHQF\WRWKHVDWLVIDFWLRQRI5LVN0DQDJHPHQW,IWKHUDWLQJLVEHORZWKDW UHTXLUHGZULWWHQDSSURYDORI&LW\LVUHTXLUHG $OODSSOLFDEOHSROLFLHVVKDOOLQFOXGHD:DLYHURI6XEURJDWLRQ5LJKWVRI5HFRYHU\LQIDYRU RIWKH&LW\,QDGGLWLRQWKH&RQWUDFWRUDJUHHVWRZDLYHDOOULJKWVRIVXEURJDWLRQDJDLQVWWKH (QJLQHHU LI DSSOLFDEOH DQG HDFK DGGLWLRQDO LQVXUHG LGHQWLILHG LQ WKHVH 6WDQGDUG &LW\ &RQGLWLRQV )DLOXUH RI WKH &LW\ WR GHPDQG VXFK FHUWLILFDWHV RURWKHU HYLGHQFH RI IXOO FRPSOLDQFHZLWKWKHLQVXUDQFHUHTXLUHPHQWVRUIDLOXUHRIWKH&LW\WRLGHQWLI\DGHILFLHQF\ IURPHYLGHQFHWKDWLVSURYLGHGVKDOOQRWEHFRQVWUXHGDVDZDLYHURI&RQWUDFWRU¶VREOLJDWLRQ WRPDLQWDLQVXFKOLQHVRILQVXUDQFHFRYHUDJH ,ILQVXUDQFHSROLFLHVDUHQRWZULWWHQIRUVSHFLILHGFRYHUDJHOLPLWVDQ8PEUHOODRU([FHVV /LDELOLW\LQVXUDQFHIRUDQ\GLIIHUHQFHVLVUHTXLUHG([FHVV/LDELOLW\VKDOOIROORZIRUPRIWKH SULPDU\FRYHUDJH 8QOHVVRWKHUZLVHVWDWHGDOOUHTXLUHGLQVXUDQFHVKDOOEHZULWWHQRQWKH³RFFXUUHQFHEDVLV´,I FRYHUDJHLVXQGHUZULWWHQRQDFODLPVPDGHEDVLVWKHUHWURDFWLYHGDWHVKDOOEHFRLQFLGHQWZLWK RUSULRUWRWKHGDWHRIWKHHIIHFWLYHGDWHRIWKHDJUHHPHQWDQGWKHFHUWLILFDWHRILQVXUDQFHVKDOO VWDWHWKDWWKHFRYHUDJHLVFODLPVPDGHDQGWKHUHWURDFWLYHGDWH7KHLQVXUDQFHFRYHUDJHVKDOO EH PDLQWDLQHG IRU WKH GXUDWLRQ RI WKH &RQWUDFW DQG IRU WKUHH \HDUV IROORZLQJ )LQDO $FFHSWDQFHSURYLGHGXQGHUWKH&RQWUDFW'RFXPHQWVRUIRUWKHZDUUDQW\SHULRGZKLFKHYHULV ORQJHU $Q DQQXDO FHUWLILFDWH RI LQVXUDQFH VXEPLWWHG WR WKH &LW\ VKDOO HYLGHQFH VXFK LQVXUDQFHFRYHUDJH 3ROLFLHVVKDOOKDYHQRH[FOXVLRQVE\HQGRUVHPHQWVZKLFKQHLWKHUQXOOLI\RUDPHQGWKH UHTXLUHGOLQHVRIFRYHUDJHQRUGHFUHDVHWKHOLPLWVRIVDLGFRYHUDJHXQOHVVVXFKHQGRUVHPHQWV DUHDSSURYHGLQZULWLQJE\WKH&LW\,QWKHHYHQWD&RQWUDFWKDVEHHQELGRUH[HFXWHGDQGWKH H[FOXVLRQV DUH GHWHUPLQHG WR EH XQDFFHSWDEOH RU WKH &LW\ GHVLUHV DGGLWLRQDO LQVXUDQFH FRYHUDJHDQGWKH&LW\GHVLUHVWKHFRQWUDFWRUHQJLQHHUWRREWDLQVXFKFRYHUDJHWKHFRQWUDFW SULFHVKDOOEHDGMXVWHGE\WKHFRVWRIWKHSUHPLXPIRUVXFKDGGLWLRQDOFRYHUDJHSOXV $Q\ VHOILQVXUHG UHWHQWLRQ 6,5 LQ H[FHVV RI DIIHFWLQJ UHTXLUHG LQVXUDQFH FRYHUDJHVKDOOEHDSSURYHGE\WKH&LW\LQUHJDUGVWRDVVHWYDOXHDQGVWRFNKROGHUV HTXLW\,Q 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ OLHXRIWUDGLWLRQDOLQVXUDQFHDOWHUQDWLYHFRYHUDJHPDLQWDLQHGWKURXJKLQVXUDQFHSRROVRUULVN UHWHQWLRQJURXSVPXVWDOVREHDSSURYHGE\&LW\ $Q\GHGXFWLEOHLQH[FHVVRIIRUDQ\SROLF\WKDWGRHVQRWSURYLGHFRYHUDJHRQD ILUVWGROODUEDVLVPXVWEHDFFHSWDEOHWRDQGDSSURYHGE\WKH&LW\ &LW\DWLWVVROHGLVFUHWLRQUHVHUYHVWKHULJKWWRUHYLHZWKHLQVXUDQFHUHTXLUHPHQWVDQGWR PDNH UHDVRQDEOH DGMXVWPHQWV WR LQVXUDQFH FRYHUDJH¶V DQG WKHLU OLPLWV ZKHQ GHHPHG QHFHVVDU\DQGSUXGHQWE\WKH&LW\EDVHGXSRQFKDQJHVLQVWDWXWRU\ODZFRXUWGHFLVLRQRUWKH FODLPVKLVWRU\RIWKHLQGXVWU\DVZHOODVRIWKHFRQWUDFWLQJSDUW\WRWKH&LW\7KH&LW\VKDOO EH UHTXLUHG WR SURYLGH SULRU QRWLFH RI GD\V DQG WKH LQVXUDQFH DGMXVWPHQWV VKDOO EH LQFRUSRUDWHGLQWRWKH:RUNE\&KDQJH2UGHU &LW\VKDOOEHHQWLWOHGXSRQZULWWHQUHTXHVWDQGZLWKRXWH[SHQVHWRUHFHLYHFRSLHVRISROLFLHV DQGHQGRUVHPHQWVWKHUHWRDQGPD\PDNHDQ\UHDVRQDEOHUHTXHVWVIRUGHOHWLRQRUUHYLVLRQRU PRGLILFDWLRQVRISDUWLFXODUSROLF\WHUPVFRQGLWLRQVOLPLWDWLRQVRUH[FOXVLRQVQHFHVVDU\WR FRQIRUP WKH SROLF\ DQG HQGRUVHPHQWV WR WKH UHTXLUHPHQWV RI WKH&RQWUDFW 'HOHWLRQV UHYLVLRQVRUPRGLILFDWLRQVVKDOOQRWEHUHTXLUHGZKHUHSROLF\SURYLVLRQVDUHHVWDEOLVKHGE\ ODZRUUHJXODWLRQVELQGLQJXSRQHLWKHUSDUW\RUWKHXQGHUZULWHURQDQ\VXFKSROLFLHV &LW\ VKDOO QRW EH UHVSRQVLEOH IRU WKH GLUHFW SD\PHQW RI LQVXUDQFH SUHPLXP FRVWV IRU &RQWUDFWRU¶VLQVXUDQFH Contractor’s Insurance $Workers Compensation and Employers’ Liability. &RQWUDFWRUVKDOOSXUFKDVHDQGPDLQWDLQVXFK LQVXUDQFHFRYHUDJHZLWKOLPLWVFRQVLVWHQWZLWKVWDWXWRU\EHQHILWVRXWOLQHGLQWKH7H[DV:RUNHUV¶ &RPSHQVDWLRQ $FW 7H[DV /DERU &RGH &K DV DPHQGHG DQG PLQLPXP OLPLWV IRU (PSOR\HUV¶ /LDELOLW\ DV LV DSSURSULDWH IRU WKH :RUN EHLQJ SHUIRUPHG DQG DV ZLOO SURYLGH SURWHFWLRQ IURP FODLPV VHW IRUWK EHORZ ZKLFK PD\ DULVH RXW RI RU UHVXOW IURP &RQWUDFWRU¶V SHUIRUPDQFHRIWKH:RUNDQG&RQWUDFWRU¶VRWKHUREOLJDWLRQVXQGHUWKH&RQWUDFW'RFXPHQWV ZKHWKHULWLVWREHSHUIRUPHGE\&RQWUDFWRUDQ\6XEFRQWUDFWRURU6XSSOLHURUE\DQ\RQHGLUHFWO\ RULQGLUHFWO\HPSOR\HGE\DQ\RIWKHPWRSHUIRUPDQ\RIWKH:RUNRUE\DQ\RQHIRUZKRVHDFWV DQ\RIWKHPPD\EHOLDEOH FODLPVXQGHUZRUNHUV¶FRPSHQVDWLRQGLVDELOLW\EHQHILWVDQGRWKHUVLPLODUHPSOR\HHEHQHILW DFWV FODLPVIRUGDPDJHVEHFDXVHRIERGLO\LQMXU\RFFXSDWLRQDOVLFNQHVVRUGLVHDVHRUGHDWKRI &RQWUDFWRU¶VHPSOR\HHV 7KHOLPLWVRIOLDELOLW\IRUWKHLQVXUDQFHVKDOOSURYLGHWKHIROORZLQJFRYHUDJHVIRUQRWOHVV WKDQWKHIROORZLQJDPRXQWVRUJUHDWHUZKHUHUHTXLUHGE\/DZVDQG5HJXODWLRQV D 6WDWXWRU\OLPLWV E (PSOR\HU VOLDELOLW\ 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ HDFKDFFLGHQWRFFXUUHQFH 'LVHDVHHDFKHPSOR\HH 'LVHDVHSROLF\OLPLW % &RPPHUFLDO*HQHUDO/LDELOLW\&RYHUDJHVKDOOLQFOXGHEXWQRWEHOLPLWHGWRFRYHULQJOLDELOLW\ ERGLO\LQMXU\RUSURSHUW\GDPDJHDULVLQJIURPSUHPLVHVRSHUDWLRQVLQGHSHQGHQWFRQWUDFWRUV SURGXFWVFRPSOHWHGRSHUDWLRQVSHUVRQDOLQMXU\DQGOLDELOLW\XQGHUDQLQVXUHGFRQWUDFW,QVXUDQFH VKDOO EH SURYLGHG RQ DQ RFFXUUHQFH EDVLV DQG DV FRPSUHKHQVLYHDV WKH FXUUHQW ,QVXUDQFH 6HUYLFHV2IILFH,62SROLF\7KLVLQVXUDQFHVKDOODSSO\DVSULPDU\LQVXUDQFHZLWKUHVSHFWWR DQ\RWKHULQVXUDQFHRUVHOILQVXUDQFHSURJUDPVDIIRUGHGWRWKH&LW\7KH&RPPHUFLDO*HQHUDO /LDELOLW\ SROLF\ VKDOO KDYH QR H[FOXVLRQV E\ HQGRUVHPHQWV WKDW ZRXOG DOWHU RI QXOOLI\ SUHPLVHVRSHUDWLRQVSURGXFWVFRPSOHWHGRSHUDWLRQVFRQWUDFWXDOSHUVRQDOLQMXU\RUDGYHUWLVLQJ LQMXU\ZKLFKDUHQRUPDOO\FRQWDLQHGZLWKWKHSROLF\XQOHVVWKH&LW\DSSURYHVVXFKH[FOXVLRQV LQZULWLQJ )RUFRQVWUXFWLRQSURMHFWVWKDWSUHVHQWDVXEVWDQWLDOFRPSOHWHGRSHUDWLRQH[SRVXUHWKH&LW\ PD\UHTXLUHWKHFRQWUDFWRUWRPDLQWDLQFRPSOHWHGRSHUDWLRQVFRYHUDJHIRUDPLQLPXPRIQR OHVVWKDQWKUHH\HDUVIROORZLQJWKHFRPSOHWLRQRIWKHSURMHFW &RQWUDFWRU V/LDELOLW\,QVXUDQFHXQGHUWKLV6HFWLRQZKLFKVKDOOEHRQDSHUSURMHFWEDVLV FRYHULQJWKH&RQWUDFWRUZLWKPLQLPXPOLPLWVRI D HDFKRFFXUUHQFH E DJJUHJDWHOLPLW 7KH SROLF\ PXVW KDYH DQ HQGRUVHPHQW $PHQGPHQW ± $JJUHJDWH /LPLWV RI ,QVXUDQFH PDNLQJWKH*HQHUDO$JJUHJDWH/LPLWVDSSO\VHSDUDWHO\WRHDFKMREVLWH 7KH &RPPHUFLDO *HQHUDO /LDELOLW\ ,QVXUDQFH SROLFLHV VKDOO SURYLGH ³;´ ³&´ DQG ³8´ FRYHUDJH¶V9HULILFDWLRQRIVXFKFRYHUDJHPXVWEHVKRZQLQWKH5HPDUNV$UWLFOHRIWKH &HUWLILFDWHRI,QVXUDQFH &Automobile Liability. $FRPPHUFLDOEXVLQHVVDXWRSROLF\VKDOOSURYLGHFRYHUDJHRQ³DQ\DXWR´ GHILQHGDVDXWRVRZQHGKLUHGDQGQRQRZQHGDQGSURYLGHLQGHPQLW\IRUFODLPVIRUGDPDJHV EHFDXVHERGLO\LQMXU\RUGHDWKRIDQ\SHUVRQDQGRUSURSHUW\GDPDJHDULVLQJRXWRIWKHZRUN PDLQWHQDQFHRUXVHRIDQ\PRWRUYHKLFOHE\WKH&RQWUDFWRUDQ\6XEFRQWUDFWRURU6XSSOLHURUE\ DQ\RQHGLUHFWO\RULQGLUHFWO\HPSOR\HGE\DQ\RIWKHPWRSHUIRUPDQ\RIWKH:RUNRUE\DQ\RQH IRUZKRVHDFWVDQ\RIWKHPPD\EHOLDEOH $XWRPRELOH/LDELOLW\&RQWUDFWRU¶V/LDELOLW\,QVXUDQFHXQGHUWKLV6HFWLRQZKLFKVKDOOEHLQ DQDPRXQWQRWOHVVWKDQWKHIROORZLQJDPRXQWV a.$XWRPRELOH/LDELOLW\DFRPPHUFLDOEXVLQHVVSROLF\VKDOOSURYLGHFRYHUDJHRQ$Q\ $XWRGHILQHGDVDXWRVRZQHGKLUHGDQGQRQRZQHG 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ 1) $1,000,000 HDFK DFFLGHQW RQ D FRPELQHG VLQJOH OLPLW EDVLV 6SOLW OLPLWV DUH DFFHSWDEOHLIOLPLWVDUHDWOHDVW 2) %RGLO\,QMXU\SHUSHUVRQ 3) %RGLO\,QMXU\SHUDFFLGHQW 4) 3URSHUW\'DPDJH 'Railroad Protective Liability. ,IDQ\RIWKHZRUNRUDQ\ZDUUDQW\ZRUNLVZLWKLQWKHOLPLWVRI UDLOURDGULJKWRIZD\WKH&RQWUDFWRUVKDOOFRPSO\ZLWKWKHIROORZLQJUHTXLUHPHQWV 7KH&RQWUDFWRU¶VFRQVWUXFWLRQDFWLYLWLHVZLOOUHTXLUHLWVHPSOR\HHVDJHQWVVXEFRQWUDFWRUV HTXLSPHQW DQG PDWHULDO GHOLYHULHs WR FURVV UDLOURDG SURSHUWLHV DQG WUDFNV RZQHG DQG RSHUDWHGE\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB :ULWHWKHQDPHRIWKHUDLOURDGFRPSDQ\,IQRQHWKHQZULWHQRQH 7KH&RQWUDFWRUVKDOOFRQGXFWLWVRSHUDWLRQVRQUDLOURDGSURSHUWLHVLQVXFKDPDQQHUDVQRWWR LQWHUIHUHZLWKKLQGHURUREVWUXFWWKHUDLOURDGFRPSDQ\LQDQ\PDQQHUZKDWVRHYHULQWKHXVH RURSHUDWLRQRILWVWKHLUWUDLQVRURWKHUSURSHUW\6XFKRSHUDWLRQVRQUDLOURDGSURSHUWLHVPD\ UHTXLUHWKDW&RQWUDFWRUWRH[HFXWHD³5LJKWRI(QWU\$JUHHPHQW´ZLWKWKHSDUWLFXODUUDLOURDG FRPSDQ\RUFRPSDQLHVLQYROYHGDQGWRWKLVHQGWKH&RQWUDFWRUVKRXOGVDWLVI\LWVHOIDVWRWKH UHTXLUHPHQWVRIHDFKUDLOURDGFRPSDQ\DQGEHSUHSDUHGWRH[HFXWHWKHULJKWRIHQWU\LIDQ\ UHTXLUHGE\DUDLOURDGFRPSDQ\7KHUHTXLUHPHQWVVSHFLILHGKHUHLQOLNHZLVHUHODWHWRWKH &RQWUDFWRU¶VXVHRISULYDWHDQGRUFRQVWUXFWLRQDFFHVVURDGVFURVVLQJVDLGUDLOURDGFRPSDQ\¶V SURSHUWLHV 7KH&RQWUDFWXDO/LDELOLW\FRYHUDJHUHTXLUHGE\3DUDJUDSK'RIWKH*HQHUDO&RQGLWLRQV VKDOO SURYLGH FRYHUDJH IRU QRW OHVV WKDQ WKH IROORZLQJ DPRXQWV LVVXHG E\ FRPSDQLHV VDWLVIDFWRU\WRWKH&LW\DQGWRWKH5DLOURDG&RPSDQ\IRUDWHUPWKDWFRQWLQXHVIRUVRORQJDV WKH&RQWUDFWRU¶VRSHUDWLRQVDQGZRUNFURVVRFFXS\RUWRXFKUDLOURDGSURSHUW\ D *HQHUDO$JJUHJDWHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB (QWHUOLPLWVSURYLGHGE\5DLOURDG&RPSDQ\,IQRQHZULWHQRQH E (DFK2FFXUUHQFHBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB (QWHUOLPLWVSURYLGHGE\5DLOURDG&RPSDQ\,IQRQHZULWHQRQH :LWKUHVSHFWWRWKHDERYHRXWOLQHGLQVXUDQFHUHTXLUHPHQWVWKHIROORZLQJVKDOOJRYHUQ D :KHUHDVLQJOHUDLOURDGFRPSDQ\LVLQYROYHGWKH&RQWUDFWRUVKDOOSURYLGHRQHLQVXUDQFH SROLF\LQWKHQDPHRIWKHUDLOURDGFRPSDQ\+RZHYHULIPRUHWKDQRQHJUDGHVHSDUDWLRQ RUDWJUDGHFURVVLQJLVDIIHFWHGE\WKH3URMHFWDWHQWLUHO\VHSDUDWHORFDWLRQVRQWKHOLQHRU OLQHVRIWKHVDPHUDLOURDGFRPSDQ\VHSDUDWHFRYHUDJHPD\EHUHTXLUHGHDFKLQWKH DPRXQWVWDWHGDERYH E :KHUHPRUHWKDQRQHUDLOURDGFRPSDQ\LVRSHUDWLQJRQWKHVDPHULJKWRIZD\RUZKHUH VHYHUDOUDLOURDGFRPSDQLHVDUHLQYROYHGDQGRSHUDWHGRQWKHLURZQVHSDUDWHULJKWVRI 1RQH 1RQH 1RQH 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ ZD\WKH&RQWUDFWRUPD\EHUHTXLUHGWRSURYLGHVHSDUDWHLQVXUDQFHSROLFLHVLQWKHQDPH RIHDFKUDLOURDGFRPSDQ\ F ,ILQDGGLWLRQWRDJUDGHVHSDUDWLRQRUDQDWJUDGHFURVVLQJRWKHUZRUNRUDFWLYLW\LV SURSRVHGRQDUDLOURDGFRPSDQ\¶VULJKWRIZD\DWDORFDWLRQHQWLUHO\VHSDUDWHIURPWKH JUDGHVHSDUDWLRQRUDWJUDGHFURVVLQJLQVXUDQFHFRYHUDJHIRUWKLVZRUNPXVWEHLQFOXGHG LQWKHSROLF\FRYHULQJWKHJUDGHVHSDUDWLRQ G ,IQRJUDGHVHSDUDWLRQLVLQYROYHGEXWRWKHUZRUNLVSURSRVHGRQDUDLOURDGFRPSDQ\¶V ULJKWRIZD\DOOVXFKRWKHUZRUNPD\EHFRYHUHGLQDVLQJOHSROLF\IRUWKDWUDLOURDGHYHQ WKRXJKWKHZRUNPD\EHDWWZRRUPRUHVHSDUDWHORFDWLRQV 1RZRUNRUDFWLYLWLHVRQDUDLOURDGFRPSDQ\¶VSURSHUW\WREHSHUIRUPHGE\WKH&RQWUDFWRU VKDOOEHFRPPHQFHGXQWLOWKH&RQWUDFWRUKDVIXUQLVKHGWKH&LW\ZLWKDQRULJLQDOSROLF\RU SROLFLHVRIWKHLQVXUDQFHIRUHDFKUDLOURDGFRPSDQ\QDPHGDVUHTXLUHGDERYH$OOVXFK LQVXUDQFHPXVWEHDSSURYHGE\WKH&LW\DQGHDFKDIIHFWHG5DLOURDG&RPSDQ\SULRUWRWKH &RQWUDFWRU¶VEHJLQQLQJZRUN 7KHLQVXUDQFHVSHFLILHGDERYHPXVWEHFDUULHGXQWLODOO:RUNWREHSHUIRUPHGRQWKHUDLOURDG ULJKWRIZD\KDVEHHQFRPSOHWHGDQGWKHJUDGHFURVVLQJLIDQ\LVQRORQJHUXVHGE\WKH &RQWUDFWRU,QDGGLWLRQLQVXUDQFHPXVWEHFDUULHGGXULQJDOOPDLQWHQDQFHDQGRUUHSDLUZRUN SHUIRUPHGLQWKHUDLOURDGULJKWRIZD\6XFKLQVXUDQFHPXVWQDPHWKHUDLOURDGFRPSDQ\DV WKHLQVXUHGWRJHWKHUZLWKDQ\WHQDQWRUOHVVHHRIWKHUDLOURDGFRPSDQ\RSHUDWLQJRYHUWUDFNV LQYROYHGLQWKH3URMHFW (Notification of Policy Cancellation: &RQWUDFWRUVKDOOLPPHGLDWHO\QRWLI\&LW\XSRQFDQFHOODWLRQ RURWKHUORVVRILQVXUDQFHFRYHUDJH&RQWUDFWRUVKDOOVWRSZRUNXQWLOUHSODFHPHQWLQVXUDQFHKDV EHHQSURFXUHG7KHUHVKDOOEHQRWLPHFUHGLWIRUGD\VQRWZRUNHGSXUVXDQWWRWKLVVHFWLRQ Acceptance of Bonds and Insurance; Option to Replace ,I&LW\KDVDQ\REMHFWLRQWRWKHFRYHUDJHDIIRUGHGE\RURWKHUSURYLVLRQVRIWKHERQGVRULQVXUDQFH UHTXLUHGWREHSXUFKDVHGDQGPDLQWDLQHGE\WKH&RQWUDFWRULQDFFRUGDQFHZLWK$UWLFOHRQWKHEDVLV RI QRQFRQIRUPDQFH ZLWK WKH &RQWUDFW 'RFXPHQWV WKH 'HYHORSHU DQG &LW\ VKDOO VR QRWLI\ WKH &RQWUDFWRULQZULWLQJZLWKLQ%XVLQHVV'D\VDIWHUUHFHLSWRIWKHFHUWLILFDWHVRURWKHUHYLGHQFH UHTXHVWHG&RQWUDFWRUVKDOOSURYLGHWRWKH&LW\VXFKDGGLWLRQDOLQIRUPDWLRQLQUHVSHFWRILQVXUDQFH SURYLGHG DV WKH 'HYHORSHU RU &LW\ PD\ UHDVRQDEO\ UHTXHVW ,I &RQWUDFWRU GRHV QRW SXUFKDVH RU PDLQWDLQDOORIWKHERQGVDQGLQVXUDQFHUHTXLUHGE\WKH&RQWUDFW'RFXPHQWVWKH'HYHORSHURU&LW\ VKDOOQRWLI\WKH&RQWUDFWRULQZULWLQJRIVXFKIDLOXUHSULRUWRWKHVWDUWRIWKH:RUNRURIVXFKIDLOXUH WRPDLQWDLQSULRUWRDQ\FKDQJHLQWKHUHTXLUHGFRYHUDJH $57,&/(±&2175$&725¶65(63216,%,/,7,(6 Supervision and Superintendent $ &RQWUDFWRUVKDOOVXSHUYLVHLQVSHFWDQGGLUHFWWKH:RUNFRPSHWHQWO\DQGHIILFLHQWO\GHYRWLQJ VXFKDWWHQWLRQWKHUHWRDQGDSSO\LQJVXFKVNLOOVDQGH[SHUWLVHDVPD\EHQHFHVVDU\WRSHUIRUPWKH 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ :RUNLQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWV&RQWUDFWRUVKDOOEHVROHO\UHVSRQVLEOHIRUWKH PHDQVPHWKRGVWHFKQLTXHVVHTXHQFHVDQGSURFHGXUHVRIFRQVWUXFWLRQ % $WDOOWLPHVGXULQJWKHSURJUHVVRIWKH:RUN&RQWUDFWRUVKDOODVVLJQDFRPSHWHQW(QJOLVK VSHDNLQJ 6XSHULQWHQGHQW ZKR VKDOO QRW EH UHSODFHG ZLWKRXW ZULWWHQ QRWLFH WR &LW\ 7KH 6XSHULQWHQGHQWZLOOEH&RQWUDFWRU¶VUHSUHVHQWDWLYHDWWKH6LWHDQGVKDOOKDYHDXWKRULW\WRDFWRQ EHKDOIRI&RQWUDFWRU$OOFRPPXQLFDWLRQJLYHQWRRUUHFHLYHGIURPWKH6XSHULQWHQGHQWVKDOOEH ELQGLQJRQ&RQWUDFWRU & &RQWUDFWRU VKDOO QRWLI\ WKH &LW\ KRXUV SULRU WR PRYLQJ DUHDV GXULQJ WKH VHTXHQFH RI FRQVWUXFWLRQ Labor; Working Hours $ &RQWUDFWRU VKDOO SURYLGH FRPSHWHQW VXLWDEO\ TXDOLILHG SHUVRQQHO WR SHUIRUP FRQVWUXFWLRQ DV UHTXLUHGE\WKH&RQWUDFW'RFXPHQWV&RQWUDFWRUVKDOODWDOOWLPHVPDLQWDLQJRRGGLVFLSOLQHDQG RUGHUDWWKH6LWH % ([FHSWDVRWKHUZLVHUHTXLUHGIRUWKHVDIHW\RUSURWHFWLRQRISHUVRQVRUWKH:RUNRUSURSHUW\DW WKH6LWHRUDGMDFHQWWKHUHWRDQGH[FHSWDVRWKHUZLVHVWDWHGLQWKH&RQWUDFW'RFXPHQWVDOO:RUN DWWKH6LWHVKDOOEHSHUIRUPHGGXULQJ5HJXODU:RUNLQJ+RXUV&RQWUDFWRUZLOOQRWSHUPLWWKH SHUIRUPDQFHRI:RUNEH\RQG5HJXODU:RUNLQJ+RXUVRUIRU:HHNHQG:RUNLQJ+RXUVZLWKRXW &LW\¶VZULWWHQFRQVHQWZKLFKZLOOQRWEHXQUHDVRQDEO\ZLWKKHOG:ULWWHQUHTXHVWE\OHWWHURU HOHFWURQLFFRPPXQLFDWLRQWRSHUIRUP:RUN IRUEH\RQG5HJXODU:RUNLQJ+RXUVUHTXHVWPXVWEHPDGHE\QRRQDWOHDVWWZR%XVLQHVV 'D\VSULRU IRU:HHNHQG:RUNLQJ+RXUVUHTXHVWPXVWEHPDGHE\QRRQRIWKHSUHFHGLQJ7KXUVGD\ IRU OHJDO KROLGD\V UHTXHVW PXVW EH PDGH E\ QRRQ WZR %XVLQHVV'D\V SULRU WR WKH OHJDO KROLGD\ Services, Materials, and Equipment $ 8QOHVVRWKHUZLVHVSHFLILHGLQWKH&RQWUDFW'RFXPHQWV&RQWUDFWRUVKDOOSURYLGHDQGDVVXPHIXOO UHVSRQVLELOLW\ IRU DOO VHUYLFHV PDWHULDOV HTXLSPHQW ODERU WUDQVSRUWDWLRQ FRQVWUXFWLRQ HTXLSPHQWDQGPDFKLQHU\WRROVDSSOLDQFHVIXHOSRZHUOLJKWKHDWWHOHSKRQHZDWHUVDQLWDU\ IDFLOLWLHV WHPSRUDU\ IDFLOLWLHV DQG DOO RWKHU IDFLOLWLHV DQGLQFLGHQWDOV QHFHVVDU\ IRU WKH SHUIRUPDQFH&RQWUDFWRUUHTXLUHGWHVWLQJVWDUWXSDQGFRPSOHWLRQRIWKH:RUN % $OOPDWHULDOVDQGHTXLSPHQWLQFRUSRUDWHGLQWRWKH:RUNVKDOOEHDVVSHFLILHGRULIQRWVSHFLILHG VKDOOEHRIJRRGTXDOLW\DQGQHZH[FHSWDVRWKHUZLVHSURYLGHGLQWKH&RQWUDFW'RFXPHQWV$OO VSHFLDOZDUUDQWLHVDQGJXDUDQWHHVUHTXLUHGE\WKH6SHFLILFDWLRQVVKDOOH[SUHVVO\UXQWRWKHEHQHILW RI&LW\,IUHTXLUHGE\&LW\&RQWUDFWRUVKDOOIXUQLVKVDWLVIDFWRU\HYLGHQFHLQFOXGLQJUHSRUWVRI UHTXLUHGWHVWVDVWRWKHVRXUFHNLQGDQGTXDOLW\RIPDWHULDOVDQGHTXLSPHQW 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ & $OOPDWHULDOVDQGHTXLSPHQWWREHLQFRUSRUDWHGLQWRWKH:RUNVKDOOEHVWRUHGDSSOLHGLQVWDOOHG FRQQHFWHGHUHFWHGSURWHFWHGXVHGFOHDQHGDQGFRQGLWLRQHGLQDFFRUGDQFHZLWKLQVWUXFWLRQVRI WKHDSSOLFDEOH6XSSOLHUH[FHSWDVRWKHUZLVHPD\EHSURYLGHGLQWKH&RQWUDFW'RFXPHQWV Project Schedule $ &RQWUDFWRUVKDOODGKHUHWRWKH3URMHFW6FKHGXOHHVWDEOLVKHGLQDFFRUGDQFHZLWK3DUDJUDSK DQGWKH*HQHUDO5HTXLUHPHQWVDVLWPD\EHDGMXVWHGIURPWLPHWRWLPHDVSURYLGHGEHORZ &RQWUDFWRUVKDOOVXEPLWWR&LW\IRUDFFHSWDQFHWRWKHH[WHQWLQGLFDWHGLQ3DUDJUDSKDQG WKH*HQHUDO5HTXLUHPHQWVSURSRVHGDGMXVWPHQWVLQWKH3URMHFW6FKHGXOH 3URSRVHGDGMXVWPHQWVLQWKH3URMHFW6FKHGXOHWKDWZLOOFKDQJHWKH&RQWUDFW7LPHVKDOOEH VXEPLWWHGLQDFFRUGDQFHZLWKWKHUHTXLUHPHQWVRI$UWLFOH$GMXVWPHQWVLQ&RQWUDFW7LPH IRUSURMHFWVZLWK&LW\SDUWLFLSDWLRQVKDOOEHPDGHE\SDUWLFLSDWLQJFKDQJHRUGHUV Substitutes and “Or-Equals” $ :KHQHYHUDQLWHPRIPDWHULDORUHTXLSPHQWLVVSHFLILHGRUGHVFULEHGLQWKH&RQWUDFW'RFXPHQWV E\XVLQJWKHQDPHRIDSURSULHWDU\LWHPRUWKHQDPHRIDSDUWLFXODU6XSSOLHUWKHVSHFLILFDWLRQRU GHVFULSWLRQLVLQWHQGHGWRHVWDEOLVKWKHW\SHIXQFWLRQDSSHDUDQFHDQGTXDOLW\UHTXLUHG8QOHVV WKHVSHFLILFDWLRQRUGHVFULSWLRQFRQWDLQVRULVIROORZHGE\ZRUGVUHDGLQJWKDWQROLNHHTXLYDOHQW RU³RUHTXDO´LWHPRUQRVXEVWLWXWLRQLVSHUPLWWHGRWKHULWHPVRIPDWHULDORUHTXLSPHQWRIRWKHU 6XSSOLHUVPD\EHVXEPLWWHGWR&LW\IRUUHYLHZXQGHUWKHFLUFXPVWDQFHVGHVFULEHGEHORZ “Or-Equal” Items: ,ILQ&LW\¶VVROHGLVFUHWLRQDQLWHPRIPDWHULDORUHTXLSPHQWSURSRVHGE\ &RQWUDFWRULVIXQFWLRQDOO\HTXDOWRWKDWQDPHGDQGVXIILFLHQWO\VLPLODUVRWKDWQRFKDQJHLQ UHODWHG:RUNZLOOEHUHTXLUHGLWPD\EHFRQVLGHUHGE\&LW\DVDQ³RUHTXDO´LWHPLQZKLFK FDVH UHYLHZ DQG DSSURYDO RI WKH SURSRVHG LWHP PD\ LQ &LW\¶V VROH GLVFUHWLRQ EH DFFRPSOLVKHG ZLWKRXW FRPSOLDQFH ZLWK VRPH RU DOO RI WKH UHTXLUHPHQWV IRU DSSURYDO RI SURSRVHGVXEVWLWXWHLWHPV)RUWKHSXUSRVHVRIWKLV3DUDJUDSK$DSURSRVHGLWHPRI PDWHULDORUHTXLSPHQWZLOOEHFRQVLGHUHGIXQFWLRQDOO\HTXDOWRDQLWHPVRQDPHGLI D &LW\GHWHUPLQHVWKDW LW LV DW OHDVW HTXDO LQ PDWHULDOV RI FRQVWUXFWLRQ TXDOLW\ GXUDELOLW\ DSSHDUDQFH VWUHQJWKDQGGHVLJQFKDUDFWHULVWLFV LWZLOOUHOLDEO\SHUIRUPDWOHDVWHTXDOO\ZHOOWKHIXQFWLRQDQGDFKLHYHWKHUHVXOWV LPSRVHGE\WKHGHVLJQFRQFHSWRIWKHFRPSOHWHG3URMHFWDVDIXQFWLRQLQJZKROHDQG LWKDVDSURYHQUHFRUGRISHUIRUPDQFHDQGDYDLODELOLW\RIUHVSRQVLYHVHUYLFHDQG E &RQWUDFWRUFHUWLILHVWKDWLIDSSURYHGDQGLQFRUSRUDWHGLQWRWKH:RUN WKHUHZLOOEHQRLQFUHDVHLQFRVWWRWKH&LW\RULQFUHDVHLQ&RQWUDFW7LPHDQG 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ LWZLOOFRQIRUPVXEVWDQWLDOO\WRWKHGHWDLOHGUHTXLUHPHQWVRIWKHLWHPQDPHGLQWKH &RQWUDFW'RFXPHQWV Substitute Items: D ,ILQ&LW\¶VVROHGLVFUHWLRQDQLWHPRIPDWHULDORUHTXLSPHQWSURSRVHGE\&RQWUDFWRUGRHV QRWTXDOLI\DVDQ³RUHTXDO´LWHPXQGHU3DUDJUDSK$LWPD\EHVXEPLWWHGDVD SURSRVHGVXEVWLWXWHLWHP E &RQWUDFWRU VKDOO VXEPLW VXIILFLHQW LQIRUPDWLRQ DV SURYLGHG EHORZ WR DOORZ &LW\ WR GHWHUPLQHLIWKHLWHPRIPDWHULDORUHTXLSPHQWSURSRVHGLVHVVHQWLDOO\HTXLYDOHQWWRWKDW QDPHGDQGDQDFFHSWDEOHVXEVWLWXWHWKHUHIRU5HTXHVWVIRUUHYLHZRISURSRVHGVXEVWLWXWH LWHPVRIPDWHULDORUHTXLSPHQWZLOOQRWEHDFFHSWHGE\&LW\IURPDQ\RQHRWKHUWKDQ &RQWUDFWRU F &RQWUDFWRUVKDOOPDNHZULWWHQDSSOLFDWLRQWR&LW\IRUUHYLHZRIDSURSRVHGVXEVWLWXWHLWHP RIPDWHULDORUHTXLSPHQWWKDW&RQWUDFWRUVHHNVWRIXUQLVKRUXVH7KHDSSOLFDWLRQVKDOO FRPSO\ZLWK6HFWLRQDQG VKDOOFHUWLI\WKDWWKHSURSRVHGVXEVWLWXWHLWHPZLOO L SHUIRUPDGHTXDWHO\WKHIXQFWLRQVDQGDFKLHYHWKHUHVXOWVFDOOHGIRUE\WKHJHQHUDO GHVLJQ LL EHVLPLODULQVXEVWDQFHWRWKDWVSHFLILHG LLL EHVXLWHGWRWKHVDPHXVHDVWKDWVSHFLILHGDQG ZLOOVWDWH L WKHH[WHQWLIDQ\WRZKLFKWKHXVHRIWKHSURSRVHGVXEVWLWXWHLWHPZLOOSUHMXGLFH &RQWUDFWRU¶VDFKLHYHPHQWRIILQDOFRPSOHWLRQRQWLPH LL ZKHWKHUXVHRIWKHSURSRVHGVXEVWLWXWHLWHPLQWKH:RUNZLOOUHTXLUHDFKDQJHLQ DQ\RIWKH&RQWUDFW'RFXPHQWVRULQWKHSURYLVLRQVRIDQ\RWKHUGLUHFWFRQWUDFW ZLWK&LW\IRURWKHUZRUNRQWKH3URMHFWWRDGDSWWKHGHVLJQWRWKHSURSRVHG VXEVWLWXWHLWHP LLL ZKHWKHULQFRUSRUDWLRQRUXVHRIWKHSURSRVHGVXEVWLWXWHLWHPLQFRQQHFWLRQZLWK WKH:RUNLVVXEMHFWWRSD\PHQWRIDQ\OLFHQVHIHHRUUR\DOW\DQG ZLOOLGHQWLI\ L DOOYDULDWLRQVRIWKHSURSRVHGVXEVWLWXWHLWHPIURPWKDWVSHFLILHG LL DYDLODEOHHQJLQHHULQJVDOHVPDLQWHQDQFHUHSDLUDQGUHSODFHPHQWVHUYLFHVDQG 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ VKDOOFRQWDLQDQLWHPL]HGHVWLPDWHRIDOOFRVWVRUFUHGLWVWKDWZLOOUHVXOWGLUHFWO\RU LQGLUHFWO\IURPXVHRIVXFKVXEVWLWXWHLWHPLQFOXGLQJFRVWVRIUHGHVLJQDQG'DPDJH &ODLPVRIRWKHUFRQWUDFWRUVDIIHFWHGE\DQ\UHVXOWLQJFKDQJH %Substitute Construction Methods or Procedures: ,I D VSHFLILF PHDQV PHWKRG WHFKQLTXH VHTXHQFH RU SURFHGXUH RI FRQVWUXFWLRQ LV H[SUHVVO\ UHTXLUHG E\ WKH &RQWUDFW 'RFXPHQWV &RQWUDFWRUPD\IXUQLVKRUXWLOL]HDVXEVWLWXWHPHDQVPHWKRGWHFKQLTXHVHTXHQFHRUSURFHGXUH RIFRQVWUXFWLRQDSSURYHGE\&LW\&RQWUDFWRUVKDOOVXEPLWVXIILFLHQWLQIRUPDWLRQWRDOORZ&LW\LQ &LW\¶VVROHGLVFUHWLRQWRGHWHUPLQHWKDWWKHVXEVWLWXWHSURSRVHGLVHTXLYDOHQWWRWKDWH[SUHVVO\ FDOOHGIRUE\WKH&RQWUDFW'RFXPHQWV&RQWUDFWRUVKDOOPDNHZULWWHQDSSOLFDWLRQWR&LW\IRU UHYLHZLQWKHVDPHPDQQHUDVWKRVHSURYLGHGLQ3DUDJUDSK$ &City’s Evaluation:&LW\ ZLOO EH DOORZHG D UHDVRQDEOH WLPH ZLWKLQ ZKLFK WR HYDOXDWHHDFK SURSRVDO RU VXEPLWWDO PDGH SXUVXDQW WR 3DUDJUDSKV $ DQG % &LW\ PD\ UHTXLUH &RQWUDFWRUWRIXUQLVKDGGLWLRQDOGDWDDERXWWKHSURSRVHGVXEVWLWXWH&LW\ZLOOEHWKHVROHMXGJHRI DFFHSWDELOLW\1R³RUHTXDO´RUVXEVWLWXWHZLOOEHRUGHUHGLQVWDOOHGRUXWLOL]HGXQWLO&LW\¶VUHYLHZ LVFRPSOHWHZKLFKZLOOEHHYLGHQFHGE\D&KDQJH2UGHULQWKHFDVHRIDVXEVWLWXWHDQGDQ DFFHSWHG6XEPLWWDOIRUDQ³RUHTXDO´&LW\ZLOODGYLVH&RQWUDFWRULQZULWLQJRILWVGHWHUPLQDWLRQ 'Special Guarantee:&LW\PD\UHTXLUH&RQWUDFWRUWRIXUQLVKDW&RQWUDFWRU¶VH[SHQVHDVSHFLDO SHUIRUPDQFHJXDUDQWHHZDUUDQW\RURWKHUVXUHW\ZLWKUHVSHFWWRDQ\VXEVWLWXWHContractor shall indemnify and hold harmless City and anyone directly or indirectly employed by them from and against any and all claims, damages, losses and expenses (including attorneys fees) arising out of the use of substituted materials or equipment. (City’s Cost Reimbursement&LW\ZLOOUHFRUG&LW\¶VFRVWVLQHYDOXDWLQJDVXEVWLWXWHSURSRVHGRU VXEPLWWHG E\ &RQWUDFWRU SXUVXDQW WR 3DUDJUDSKV $ DQG % :KHWKHU RU QRW &LW\ DSSURYHVDVXEVWLWXWHVRSURSRVHGRUVXEPLWWHGE\&RQWUDFWRU&RQWUDFWRUPD\EHUHTXLUHGWR UHLPEXUVH&LW\IRUHYDOXDWLQJHDFKVXFKSURSRVHGVXEVWLWXWH&RQWUDFWRUPD\DOVREHUHTXLUHGWR UHLPEXUVH&LW\IRUWKHFKDUJHVIRUPDNLQJFKDQJHVLQWKH&RQWUDFW'RFXPHQWV )Contractor’s Expense&RQWUDFWRUVKDOOSURYLGHDOOGDWDLQVXSSRUWRIDQ\SURSRVHGVXEVWLWXWHRU ³RUHTXDO´DW&RQWUDFWRU¶VH[SHQVH *Substitute Reimbursement&RVWVVDYLQJVRUFKDUJHVDWWULEXWDEOHWRDFFHSWDQFHRIDVXEVWLWXWH VKDOOEHLQFRUSRUDWHGWRWKH&RQWUDFWE\3DUWLFLSDWLQJ&KDQJH2UGHU Pre-Qualification of Bidders (Prime Contractors and Subcontractors) $ 7KH &RQWUDFWRU DQG DQ\ VXEFRQWUDFWRUV DUH UHTXLUHG WR EH SUHTXDOLILHG IRU WKH ZRUN W\SHV UHTXLULQJSUHTXDOLILFDWLRQ Concerning Subcontractors, Suppliers, and Others $Minority and Women Owned Business Enterprise Compliance: 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ 5HTXLUHGIRUWKLV&RQWUDFW &KHFNWKLVER[LIWKHUHLVDQ\&LW\3DUWLFLSDWLRQ 1RW5HTXLUHGIRUWKLV&RQWUDFW ,WLV&LW\SROLF\WRHQVXUHWKHIXOODQGHTXLWDEOHSDUWLFLSDWLRQE\0LQRULW\DQG:RPHQ%XVLQHVV (QWHUSULVHV0:%(LQWKHSURFXUHPHQWRIJRRGVDQGVHUYLFHVRQDFRQWUDFWXDOEDVLV,IWKH &RQWUDFW'RFXPHQWVSURYLGHIRUD0:%(JRDO&RQWUDFWRULVUHTXLUHGWRFRPSO\ZLWKWKHLQWHQW RIWKH&LW\¶V0:%(2UGLQDQFHDVDPHQGHGE\WKHIROORZLQJ &RQWUDFWRUVKDOOXSRQUHTXHVWE\&LW\SURYLGHFRPSOHWHDQGDFFXUDWHLQIRUPDWLRQUHJDUGLQJ DFWXDOZRUNSHUIRUPHGE\D0:%(RQWKH&RQWUDFWDQGSD\PHQWWKHUHIRU &RQWUDFWRUZLOOQRWPDNHDGGLWLRQVGHOHWLRQVRUVXEVWLWXWLRQVRIDFFHSWHG0:%(ZLWKRXW ZULWWHQFRQVHQWRIWKH&LW\$Q\XQMXVWLILHGFKDQJHRUGHOHWLRQVKDOOEHDPDWHULDOEUHDFKRI &RQWUDFWDQGPD\UHVXOWLQGHEDUPHQWLQDFFRUGDQFHZLWKWKHSURFHGXUHVRXWOLQHGLQWKH 2UGLQDQFH &RQWUDFWRUVKDOOXSRQUHTXHVWE\&LW\DOORZDQDXGLWDQGRUH[DPLQDWLRQRIDQ\ERRNV UHFRUGVRUILOHVLQWKHSRVVHVVLRQRIWKH&RQWUDFWRUWKDWZLOOVXEVWDQWLDWHWKHDFWXDOZRUN SHUIRUPHG E\ DQ 0:%( 0DWHULDO PLVUHSUHVHQWDWLRQ RI DQ\ QDWXUHZLOO EH JURXQGV IRU WHUPLQDWLRQRIWKH&RQWUDFW$Q\VXFKPLVUHSUHVHQWDWLRQPD\EHJURXQGVIRUGLVTXDOLILFDWLRQ RI&RQWUDFWRUWRELGRQIXWXUHFRQWUDFWVZLWKWKH&LW\IRUDSHULRGRIQRWOHVVWKDQWKUHH\HDUV % &RQWUDFWRUVKDOOEHIXOO\UHVSRQVLEOHWR&LW\IRUDOODFWVDQGRPLVVLRQVRIWKH6XEFRQWUDFWRUV 6XSSOLHUVDQGRWKHULQGLYLGXDOVRUHQWLWLHVSHUIRUPLQJRUIXUQLVKLQJDQ\RIWKH:RUNMXVWDV &RQWUDFWRU LV UHVSRQVLEOH IRU &RQWUDFWRU¶V RZQ DFWV DQG RPLVVLRQV 1RWKLQJ LQ WKH &RQWUDFW 'RFXPHQWV VKDOOFUHDWHIRUWKHEHQHILWRIDQ\VXFK6XEFRQWUDFWRU6XSSOLHURURWKHULQGLYLGXDORUHQWLW\ DQ\FRQWUDFWXDOUHODWLRQVKLSEHWZHHQ&LW\DQGDQ\VXFK6XEFRQWUDFWRU6XSSOLHURURWKHU LQGLYLGXDORUHQWLW\QRU VKDOOFUHDWHDQ\REOLJDWLRQRQWKHSDUWRI&LW\WRSD\RUWRVHHWRWKHSD\PHQWRIDQ\PRQH\V GXHDQ\VXFK6XEFRQWUDFWRU6XSSOLHURURWKHULQGLYLGXDORUHQWLW\H[FHSWDVPD\RWKHUZLVH EHUHTXLUHGE\/DZVDQG5HJXODWLRQV & &RQWUDFWRU VKDOO EH VROHO\ UHVSRQVLEOH IRU VFKHGXOLQJ DQG FRRUGLQDWLQJ WKH :RUN RI 6XEFRQWUDFWRUV6XSSOLHUVDQGRWKHULQGLYLGXDOVRUHQWLWLHVSHUIRUPLQJRUIXUQLVKLQJDQ\RIWKH :RUNXQGHUDGLUHFWRULQGLUHFWFRQWUDFWZLWK&RQWUDFWRU ' $OO6XEFRQWUDFWRUV6XSSOLHUVDQGVXFKRWKHULQGLYLGXDOVRUHQWLWLHVSHUIRUPLQJRUIXUQLVKLQJ DQ\RIWKH:RUNVKDOOFRPPXQLFDWHZLWK&LW\WKURXJK&RQWUDFWRU ( $OO :RUN SHUIRUPHG IRU &RQWUDFWRU E\ D 6XEFRQWUDFWRU RU 6XSSOLHU ZLOO EH SXUVXDQW WR DQ DSSURSULDWHDJUHHPHQWEHWZHHQ&RQWUDFWRUDQGWKH6XEFRQWUDFWRURU6XSSOLHUZKLFKVSHFLILFDOO\ ELQGVWKH6XEFRQWUDFWRURU6XSSOLHUWRWKHDSSOLFDEOHWHUPVDQGFRQGLWLRQVRIWKHVH&RQWUDFW ; 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ 'RFXPHQWV &RQWUDFWRU VKDOO SURYLGH &LW\ FRQWUDFW QXPEHUV DQG UHIHUHQFH QXPEHUV WR WKH 6XEFRQWUDFWRUVDQGRU6XSSOLHUV Wage Rates 5HTXLUHGIRUWKLV&RQWUDFW 1RW5HTXLUHGIRUWKLV&RQWUDFW $Duty to pay Prevailing Wage Rates. 7KH &RQWUDFWRU VKDOO FRPSO\ ZLWK DOO UHTXLUHPHQWV RI &KDSWHU7H[DV*RYHUQPHQW&RGHDVDPHQGHGLQFOXGLQJWKHSD\PHQWRIQRWOHVVWKDQWKH UDWHVGHWHUPLQHGE\WKH&LW\&RXQFLORIWKH&LW\RI)RUW:RUWKWREHWKHSUHYDLOLQJZDJHUDWHVLQ DFFRUGDQFH ZLWK &KDSWHU 6XFK SUHYDLOLQJ ZDJH UDWHV DUH LQFOXGHG LQ WKHVH &RQWUDFW 'RFXPHQWV %Penalty for Violation.$&RQWUDFWRURUDQ\6XEFRQWUDFWRUZKRGRHVQRWSD\WKHSUHYDLOLQJZDJH VKDOOXSRQGHPDQGPDGHE\WKH&LW\SD\WRWKH&LW\IRUHDFKZRUNHUHPSOR\HGIRUHDFK FDOHQGDU GD\ RU SDUW RI WKH GD\ WKDW WKH ZRUNHU LV SDLG OHVV WKDQ WKH SUHYDLOLQJ ZDJH UDWHV VWLSXODWHGLQWKHVHFRQWUDFWGRFXPHQWV7KLVSHQDOW\VKDOOEHUHWDLQHGE\WKH&LW\WRRIIVHWLWV DGPLQLVWUDWLYHFRVWVSXUVXDQWWR7H[DV*RYHUQPHQW&RGH &Complaints of Violations and City Determination of Good Cause.2QUHFHLSWRILQIRUPDWLRQ LQFOXGLQJ D FRPSODLQW E\ D ZRUNHU FRQFHUQLQJ DQ DOOHJHG YLRODWLRQ RI 7H[DV *RYHUQPHQW &RGH E\ D &RQWUDFWRU RU 6XEFRQWUDFWRU WKH &LW\ VKDOO PDNH DQ LQLWLDO GHWHUPLQDWLRQEHIRUHWKHVWGD\DIWHUWKHGDWHWKH&LW\UHFHLYHVWKHLQIRUPDWLRQDVWRZKHWKHU JRRGFDXVHH[LVWVWREHOLHYHWKDWWKHYLRODWLRQRFFXUUHG7KH&LW\VKDOOQRWLI\LQZULWLQJWKH &RQWUDFWRU RU 6XEFRQWUDFWRUDQGDQ\DIIHFWHGZRUNHURILWVLQLWLDOGHWHUPLQDWLRQ8SRQWKH &LW\¶VGHWHUPLQDWLRQWKDWWKHUHLVJRRGFDXVHWREHOLHYHWKH&RQWUDFWRURU6XEFRQWUDFWRUKDV YLRODWHG &KDSWHU WKH &LW\ VKDOO UHWDLQ WKH IXOO DPRXQWV FODLPHG E\ WKH FODLPDQW RU FODLPDQWVDVWKHGLIIHUHQFHEHWZHHQZDJHVSDLGDQGZDJHVGXHXQGHUWKHSUHYDLOLQJZDJHUDWHV VXFKDPRXQWVEHLQJVXEWUDFWHGIURPVXFFHVVLYHSURJUHVVSD\PHQWVSHQGLQJDILQDOGHWHUPLQDWLRQ RIWKHYLRODWLRQ 'Arbitration Required if Violation Not Resolved.$QLVVXHUHODWLQJWRDQDOOHJHGYLRODWLRQRI 6HFWLRQ7H[DV*RYHUQPHQW&RGHLQFOXGLQJDSHQDOW\RZHGWRWKH&LW\RUDQDIIHFWHG ZRUNHU VKDOO EH VXEPLWWHG WR ELQGLQJ DUELWUDWLRQ LQ DFFRUGDQFH ZLWK WKH 7H[DV *HQHUDO $UELWUDWLRQ$FW$UWLFOHHWVHT5HYLVHG6WDWXWHVLIWKH&RQWUDFWRURU6XEFRQWUDFWRUDQGDQ\ DIIHFWHGZRUNHUGRHVQRWUHVROYHWKHLVVXHE\DJUHHPHQWEHIRUHWKHWKGD\DIWHUWKHGDWHWKH &LW\PDNHVLWVLQLWLDOGHWHUPLQDWLRQSXUVXDQWWR3DUDJUDSK&DERYH,IWKHSHUVRQVUHTXLUHGWR DUELWUDWHXQGHUWKLVVHFWLRQGRQRWDJUHHRQDQDUELWUDWRUEHIRUHWKHWKGD\DIWHUWKHGDWHWKDW DUELWUDWLRQLVUHTXLUHGDGLVWULFWFRXUWVKDOODSSRLQWDQDUELWUDWRURQWKHSHWLWLRQRIDQ\RIWKH SHUVRQV7KH&LW\LVQRWDSDUW\LQWKHDUELWUDWLRQ7KHGHFLVLRQDQGDZDUGRIWKHDUELWUDWRULV ILQDODQGELQGLQJRQDOOSDUWLHVDQGPD\EHHQIRUFHGLQDQ\FRXUWRIFRPSHWHQWMXULVGLFWLRQ (Records to be Maintained.7KH&RQWUDFWRUDQGHDFK6XEFRQWUDFWRUVKDOOIRUDSHULRGRIWKUHH \HDUVIROORZLQJWKHGDWHRIDFFHSWDQFHRIWKHZRUNPDLQWDLQUHFRUGVWKDWVKRZLWKHQDPHDQG ; 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ RFFXSDWLRQRIHDFKZRUNHUHPSOR\HGE\WKH&RQWUDFWRULQWKHFRQVWUXFWLRQRIWKH:RUNSURYLGHG IRULQWKLV&RQWUDFWDQGLLWKHDFWXDOSHUGLHPZDJHVSDLGWRHDFKZRUNHU7KHUHFRUGVVKDOOEH RSHQDWDOOUHDVRQDEOHKRXUVIRULQVSHFWLRQE\WKH&LW\7KHSURYLVLRQVRI3DUDJUDSK5LJKW WR$XGLWVKDOOSHUWDLQWRWKLVLQVSHFWLRQ )Progress Payments :LWK HDFK SURJUHVV SD\PHQW RU SD\UROO SHULRG ZKLFKHYHU LV OHVV WKH &RQWUDFWRU VKDOO VXEPLW DQ DIILGDYLW VWDWLQJ WKDW WKH &RQWUDFWRU KDV FRPSOLHG ZLWK WKH UHTXLUHPHQWVRI&KDSWHU7H[DV*RYHUQPHQW&RGH *Posting of Wage Rates7KH&RQWUDFWRUVKDOOSRVWSUHYDLOLQJZDJHUDWHVLQDFRQVSLFXRXVSODFHDW DOOWLPHV +Subcontractor Compliance 7KH &RQWUDFWRU VKDOO LQFOXGH LQ LWV VXEFRQWUDFWV DQGRU VKDOO RWKHUZLVHUHTXLUHDOORILWV6XEFRQWUDFWRUVWRFRPSO\ZLWK3DUDJUDSKV$WKURXJK*DERYH Patent Fees and Royalties $To the fullest extent permitted by Laws and Regulations, Contractor shall indemnify and hold harmless City, from and against all claims, costs, losses, and damages (including but not limited to all fees and charges of engineers, architects, attorneys, and other professionals and all court or arbitration or other dispute resolution costs) arising out of or relating to any infringement of patent rights or copyrights incident to the use in the performance of the Work or resulting from the incorporation in the Work of any invention, design, process, product, or device not specified in the Contract Documents. Laws and Regulations $ &RQWUDFWRUVKDOOJLYHDOOQRWLFHVUHTXLUHGE\DQGVKDOOFRPSO\ZLWKDOO/DZVDQG5HJXODWLRQV DSSOLFDEOH WR WKH SHUIRUPDQFH RI WKH :RUN ([FHSW ZKHUH RWKHUZLVH H[SUHVVO\ UHTXLUHG E\ DSSOLFDEOH/DZVDQG5HJXODWLRQVWKH&LW\VKDOOQRWEHUHVSRQVLEOHIRUPRQLWRULQJ&RQWUDFWRU¶V FRPSOLDQFHZLWKDQ\/DZVRU5HJXODWLRQV % ,I&RQWUDFWRUSHUIRUPVDQ\:RUNNQRZLQJRUKDYLQJUHDVRQWRNQRZWKDWLWLVFRQWUDU\WR/DZV RU5HJXODWLRQV&RQWUDFWRUVKDOOEHDUDOOFODLPVFRVWVORVVHVDQGGDPDJHVLQFOXGLQJEXWQRW OLPLWHGWRDOOIHHVDQGFKDUJHVRIHQJLQHHUVDUFKLWHFWVDWWRUQH\VDQGRWKHUSURIHVVLRQDOVDQGDOO FRXUWRUDUELWUDWLRQRURWKHUGLVSXWHUHVROXWLRQFRVWVDULVLQJRXWRIRUUHODWLQJWRVXFK:RUN +RZHYHULWVKDOOQRWEH&RQWUDFWRU¶VUHVSRQVLELOLW\WRPDNHFHUWDLQWKDWWKH6SHFLILFDWLRQVDQG 'UDZLQJVDUHLQDFFRUGDQFHZLWK/DZVDQG5HJXODWLRQVEXWWKLVVKDOOQRWUHOLHYH&RQWUDFWRURI &RQWUDFWRU¶VREOLJDWLRQVXQGHU3DUDJUDSK Use of Site and Other Areas $Limitation on Use of Site and Other Areas: &RQWUDFWRUVKDOOFRQILQHFRQVWUXFWLRQHTXLSPHQWWKHVWRUDJHRIPDWHULDOVDQGHTXLSPHQWDQG WKHRSHUDWLRQVRIZRUNHUVWRWKH6LWHDQGRWKHUDUHDVSHUPLWWHGE\/DZVDQG5HJXODWLRQVDQG VKDOOQRWXQUHDVRQDEO\HQFXPEHUWKH6LWHDQGRWKHUDUHDVZLWKFRQVWUXFWLRQHTXLSPHQWRU 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ RWKHUPDWHULDOVRUHTXLSPHQW&RQWUDFWRUVKDOODVVXPHIXOOUHVSRQVLELOLW\IRUDQ\GDPDJHWR DQ\VXFKODQGRUDUHDRUWRWKHRZQHURURFFXSDQWWKHUHRIRURIDQ\DGMDFHQWODQGRUDUHDV UHVXOWLQJIURPWKHSHUIRUPDQFHRIWKH:RUN $WDQ\WLPHZKHQLQWKHMXGJPHQWRIWKH&LW\WKH&RQWUDFWRUKDVREVWUXFWHGRUFORVHGRULV FDUU\LQJRQRSHUDWLRQVLQDSRUWLRQRIDVWUHHWULJKWRIZD\RUHDVHPHQWJUHDWHUWKDQLV QHFHVVDU\IRUSURSHUH[HFXWLRQRIWKH:RUNWKH&LW\PD\UHTXLUHWKH&RQWUDFWRUWRILQLVKWKH VHFWLRQRQZKLFKRSHUDWLRQVDUHLQSURJUHVVEHIRUHZRUNLVFRPPHQFHGRQDQ\DGGLWLRQDO DUHDRIWKH6LWH 6KRXOG DQ\ 'DPDJH &ODLP EH PDGH E\ DQ\ VXFK RZQHU RU RFFXSDQW EHFDXVH RI WKH SHUIRUPDQFHRIWKH:RUN&RQWUDFWRUVKDOOSURPSWO\DWWHPSWWRUHVROYHWKH'DPDJH&ODLP Pursuant to Paragraph 5.18, Contractor shall indemnify and hold harmless City, from and against all claims, costs, losses, and damages arising out of or relating to any claim or action, legal or equitable, brought by any such owner or occupant against City. %Removal of Debris During Performance of the Work: 'XULQJ WKH SURJUHVV RI WKH :RUN &RQWUDFWRU VKDOO NHHS WKH 6LWH DQG RWKHU DUHDV IUHH IURP DFFXPXODWLRQV RI ZDVWH PDWHULDOV UXEELVKDQGRWKHUGHEULV5HPRYDODQGGLVSRVDORIVXFKZDVWHPDWHULDOVUXEELVKDQGRWKHU GHEULVVKDOOFRQIRUPWRDSSOLFDEOH/DZVDQG5HJXODWLRQV &Site Maintenance Cleaning:KRXUVDIWHUZULWWHQQRWLFHLVJLYHQWRWKH&RQWUDFWRUWKDWWKH FOHDQXSRQWKHMREVLWHLVSURFHHGLQJLQDPDQQHUXQVDWLVIDFWRU\WRWKH&LW\RU'HYHORSHULIWKH &RQWUDFWRUIDLOVWRFRUUHFWWKHXQVDWLVIDFWRU\SURFHGXUHWKH&LW\PD\WDNHVXFKGLUHFWDFWLRQDV WKH&LW\GHHPVDSSURSULDWHWRFRUUHFWWKHFOHDQXSGHILFLHQFLHVFLWHGWRWKH&RQWUDFWRULQWKH ZULWWHQQRWLFHE\OHWWHURUHOHFWURQLFFRPPXQLFDWLRQDQGVKDOOEHHQWLWOHGWRUHFRYHULWVFRVWLQ GRLQJVR7KH&LW\PD\ZLWKKROG)LQDO$FFHSWDQFHXQWLOFOHDQXSLVFRPSOHWHDQGFRVWDUH UHFRYHUHG 'Final Site Cleaning: 3ULRUWR)LQDO$FFHSWDQFHRIWKH:RUN&RQWUDFWRUVKDOOFOHDQWKH6LWHDQG WKH:RUNDQGPDNHLWUHDG\IRUXWLOL]DWLRQE\&LW\RUDGMDFHQWSURSHUW\RZQHU$WWKHFRPSOHWLRQ RIWKH:RUN&RQWUDFWRUVKDOOUHPRYHIURPWKH6LWHDOOWRROVDSSOLDQFHVFRQVWUXFWLRQHTXLSPHQW DQGPDFKLQHU\DQGVXUSOXVPDWHULDOVDQGVKDOOUHVWRUHWRRULJLQDOFRQGLWLRQRUEHWWHUDOOSURSHUW\ GLVWXUEHGE\WKH:RUN (Loading Structures:&RQWUDFWRUVKDOOQRWORDGQRUSHUPLWDQ\SDUWRIDQ\VWUXFWXUHWREHORDGHG LQDQ\PDQQHUWKDWZLOOHQGDQJHUWKHVWUXFWXUHQRUVKDOO&RQWUDFWRUVXEMHFWDQ\SDUWRIWKH:RUN RUDGMDFHQWSURSHUW\WRVWUHVVHVRUSUHVVXUHVWKDWZLOOHQGDQJHULW Record Documents $ &RQWUDFWRUVKDOOPDLQWDLQLQDVDIHSODFHDWWKH6LWHRULQDSODFHGHVLJQDWHGE\WKH&RQWUDFWRU DQGDSSURYHGE\WKH&LW\RQHUHFRUGFRS\RIDOO'UDZLQJV6SHFLILFDWLRQV$GGHQGD&KDQJH 2UGHUV)LHOG2UGHUVDQGZULWWHQLQWHUSUHWDWLRQVDQGFODULILFDWLRQVLQJRRGRUGHUDQGDQQRWDWHG WRVKRZFKDQJHVPDGHGXULQJFRQVWUXFWLRQ7KHVHUHFRUGGRFXPHQWVWRJHWKHUZLWKDOODSSURYHG 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ 6DPSOHVDQGDFRXQWHUSDUWRIDOODFFHSWHG6XEPLWWDOVZLOOEHDYDLODEOHWR&LW\IRUUHIHUHQFH 8SRQFRPSOHWLRQRIWKH:RUNWKHVHUHFRUGGRFXPHQWVDQ\RSHUDWLRQDQGPDLQWHQDQFHPDQXDOV DQG 6XEPLWWDOV ZLOO EH GHOLYHUHG WR &LW\ SULRU WR )LQDO ,QVSHFWLRQ &RQWUDFWRU VKDOO LQFOXGH DFFXUDWHORFDWLRQVIRUEXULHGDQGLPEHGGHGLWHPV Safety and Protection $ &RQWUDFWRU VKDOO EH VROHO\ UHVSRQVLEOH IRU LQLWLDWLQJ PDLQWDLQLQJ DQG VXSHUYLVLQJ DOO VDIHW\ SUHFDXWLRQVDQGSURJUDPVLQFRQQHFWLRQZLWKWKH:RUN6XFKUHVSRQVLELOLW\GRHVQRWUHOLHYH 6XEFRQWUDFWRUVRIWKHLUUHVSRQVLELOLW\IRUWKHVDIHW\RISHUVRQVRUSURSHUW\LQWKHSHUIRUPDQFHRI WKHLUZRUNQRUIRUFRPSOLDQFHZLWKDSSOLFDEOHVDIHW\/DZVDQG5HJXODWLRQV&RQWUDFWRUVKDOO WDNHDOOQHFHVVDU\SUHFDXWLRQVIRUWKHVDIHW\RIDQGVKDOOSURYLGHWKHQHFHVVDU\SURWHFWLRQWR SUHYHQWGDPDJHLQMXU\RUORVVWR DOOSHUVRQVRQWKH6LWHRUZKRPD\EHDIIHFWHGE\WKH:RUN DOOWKH:RUNDQGPDWHULDOVDQGHTXLSPHQWWREHLQFRUSRUDWHGWKHUHLQZKHWKHULQVWRUDJHRQ RURIIWKH6LWHDQG RWKHU SURSHUW\ DW WKH 6LWH RU DGMDFHQW WKHUHWR LQFOXGLQJ WUHHV VKUXEV ODZQV ZDONV SDYHPHQWV URDGZD\V VWUXFWXUHV XWLOLWLHV DQG 8QGHUJURXQG )DFLOLWLHV QRW GHVLJQDWHG IRU UHPRYDOUHORFDWLRQRUUHSODFHPHQWLQWKHFRXUVHRIFRQVWUXFWLRQ % &RQWUDFWRU VKDOO FRPSO\ ZLWK DOO DSSOLFDEOH /DZV DQG 5HJXODWLRQV UHODWLQJ WR WKH VDIHW\ RI SHUVRQVRUSURSHUW\RUWRWKHSURWHFWLRQRISHUVRQVRUSURSHUW\IURPGDPDJHLQMXU\RUORVVDQG VKDOOHUHFWDQGPDLQWDLQDOOQHFHVVDU\VDIHJXDUGVIRUVXFKVDIHW\DQGSURWHFWLRQ&RQWUDFWRUVKDOO QRWLI\RZQHUVRIDGMDFHQWSURSHUW\DQGRI8QGHUJURXQG)DFLOLWLHVDQGRWKHUXWLOLW\RZQHUVZKHQ SURVHFXWLRQRIWKH:RUNPD\DIIHFWWKHPDQGVKDOOFRRSHUDWHZLWKWKHPLQWKHSURWHFWLRQ UHPRYDOUHORFDWLRQDQGUHSODFHPHQWRIWKHLUSURSHUW\ & &RQWUDFWRUVKDOOFRPSO\ZLWKWKHDSSOLFDEOHUHTXLUHPHQWVRI&LW\¶VVDIHW\SURJUDPVLIDQ\ ' &RQWUDFWRUVKDOOLQIRUP&LW\RIWKHVSHFLILFUHTXLUHPHQWVRI&RQWUDFWRU¶VVDIHW\SURJUDPLIDQ\ ZLWKZKLFK&LW\¶VHPSOR\HHVDQGUHSUHVHQWDWLYHVPXVWFRPSO\ZKLOHDWWKH6LWH ( $OOGDPDJHLQMXU\RUORVVWRDQ\SURSHUW\UHIHUUHGWRLQ3DUDJUDSK$RU$FDXVHG GLUHFWO\RULQGLUHFWO\LQZKROHRULQSDUWE\&RQWUDFWRUDQ\6XEFRQWUDFWRU6XSSOLHURUDQ\ RWKHULQGLYLGXDORUHQWLW\GLUHFWO\RULQGLUHFWO\HPSOR\HGE\DQ\RIWKHPWRSHUIRUPDQ\RIWKH :RUNRUDQ\RQHIRUZKRVHDFWVDQ\RIWKHPPD\EHOLDEOHVKDOOEHUHPHGLHGE\&RQWUDFWRU ) &RQWUDFWRU¶VGXWLHVDQGUHVSRQVLELOLWLHVIRUVDIHW\DQGIRUSURWHFWLRQRIWKH:RUNVKDOOFRQWLQXH XQWLOVXFKWLPHDVDOOWKH:RUNLVFRPSOHWHGDQG&LW\KDVDFFHSWHGWKH:RUN Safety Representative &RQWUDFWRUVKDOOLQIRUP&LW\LQZULWLQJRI&RQWUDFWRU¶VGHVLJQDWHGVDIHW\UHSUHVHQWDWLYHDWWKH6LWH 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ Hazard Communication Programs &RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUFRRUGLQDWLQJDQ\H[FKDQJHRIPDWHULDOVDIHW\GDWDVKHHWVRURWKHU KD]DUG FRPPXQLFDWLRQ LQIRUPDWLRQ UHTXLUHG WR EH PDGH DYDLODEOHWR RU H[FKDQJHG EHWZHHQ RU DPRQJHPSOR\HUVLQDFFRUGDQFHZLWK/DZVRU5HJXODWLRQV Submittals $ &RQWUDFWRUVKDOOVXEPLWUHTXLUHG6XEPLWWDOVWR&LW\IRUUHYLHZDQGDFFHSWDQFH(DFKVXEPLWWDO ZLOOEHLGHQWLILHGDVUHTXLUHGE\&LW\ 6XEPLWQXPEHURIFRSLHVVSHFLILHGLQWKH*HQHUDO5HTXLUHPHQWV 'DWD VKRZQ RQ WKH 6XEPLWWDOV ZLOO EH FRPSOHWH ZLWK UHVSHFW WR TXDQWLWLHV GLPHQVLRQV VSHFLILHG SHUIRUPDQFH DQG GHVLJQ FULWHULD PDWHULDOV DQG VLPLODUGDWDWRVKRZ&LW\WKH VHUYLFHVPDWHULDOVDQGHTXLSPHQW&RQWUDFWRUSURSRVHVWRSURYLGHDQGWRHQDEOH&LW\WR UHYLHZWKHLQIRUPDWLRQIRUWKHOLPLWHGSXUSRVHVUHTXLUHGE\3DUDJUDSK& 6XEPLWWDOV VXEPLWWHG DV KHUHLQ SURYLGHG E\ &RQWUDFWRU DQG UHYLHZHG E\ &LW\ IRU FRQIRUPDQFHZLWKWKHGHVLJQFRQFHSWVKDOOEHH[HFXWHGLQFRQIRUPLW\ZLWKWKH&RQWUDFW 'RFXPHQWVXQOHVVRWKHUZLVHUHTXLUHGE\&LW\ :KHQ6XEPLWWDOVDUHVXEPLWWHGIRUWKHSXUSRVHRIVKRZLQJWKHLQVWDOODWLRQLQJUHDWHUGHWDLO WKHLUUHYLHZVKDOOQRWH[FXVH&RQWUDFWRUIURPUHTXLUHPHQWVVKRZQRQWKH'UDZLQJVDQG 6SHFLILFDWLRQV )RU,QIRUPDWLRQ2QO\VXEPLWWDOVXSRQZKLFKWKH&LW\LVQRWH[SHFWHGWRFRQGXFWUHYLHZRU WDNHUHVSRQVLYHDFWLRQPD\EHVRLGHQWLILHGLQWKH&RQWUDFW'RFXPHQWV 6XEPLWUHTXLUHGQXPEHURI6DPSOHVVSHFLILHGLQWKH6SHFLILFDWLRQV &OHDUO\LGHQWLI\HDFK6DPSOHDVWRPDWHULDO6XSSOLHUSHUWLQHQWGDWDVXFKDVFDWDORJQXPEHUV WKHXVHIRUZKLFKLQWHQGHGDQGRWKHUGDWDDV&LW\PD\UHTXLUHWRHQDEOH&LW\WRUHYLHZWKH VXEPLWWDOIRUWKHOLPLWHGSXUSRVHVUHTXLUHGE\3DUDJUDSK& % :KHUHD6XEPLWWDOLVUHTXLUHGE\WKH&RQWUDFW'RFXPHQWVRUWKH6FKHGXOHRI6XEPLWWDOVDQ\ UHODWHG:RUNSHUIRUPHGSULRUWR&LW\¶VUHYLHZDQGDFFHSWDQFHRIWKHSHUWLQHQWVXEPLWWDOZLOOEH DWWKHVROHH[SHQVHDQGUHVSRQVLELOLW\RI&RQWUDFWRU &City’s Review: &LW\ZLOOSURYLGHWLPHO\UHYLHZRIUHTXLUHG6XEPLWWDOVLQDFFRUGDQFHZLWKWKH6FKHGXOHRI 6XEPLWWDOVDFFHSWDEOHWR&LW\&LW\¶VUHYLHZDQGDFFHSWDQFHZLOOEHRQO\WRGHWHUPLQHLIWKH LWHPVFRYHUHGE\WKHVXEPLWWDOVZLOODIWHULQVWDOODWLRQRULQFRUSRUDWLRQLQWKH:RUNFRQIRUP WR WKH LQIRUPDWLRQ JLYHQ LQ WKH &RQWUDFW 'RFXPHQWV DQG EH FRPSDWLEOH ZLWK WKH GHVLJQ FRQFHSW RI WKH FRPSOHWHG 3URMHFW DV D IXQFWLRQLQJ ZKROH DV LQGLFDWHG E\ WKH &RQWUDFW 'RFXPHQWV 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ &LW\¶VUHYLHZDQGDFFHSWDQFHZLOOQRWH[WHQGWRPHDQVPHWKRGVWHFKQLTXHVVHTXHQFHVRU SURFHGXUHVRIFRQVWUXFWLRQH[FHSWZKHUHDSDUWLFXODUPHDQVPHWKRGWHFKQLTXHVHTXHQFH RU SURFHGXUH RI FRQVWUXFWLRQ LV VSHFLILFDOO\ DQG H[SUHVVO\ FDOOHG IRU E\ WKH &RQWUDFW 'RFXPHQWV RU WR VDIHW\ SUHFDXWLRQV RU SURJUDPV LQFLGHQW WKHUHWR 7KH UHYLHZ DQG DFFHSWDQFHRIDVHSDUDWHLWHPDVVXFKZLOOQRWLQGLFDWHDSSURYDORIWKHDVVHPEO\LQZKLFKWKH LWHPIXQFWLRQV &LW\¶V UHYLHZ DQG DFFHSWDQFH VKDOO QRW UHOLHYH &RQWUDFWRU IURP UHVSRQVLELOLW\ IRU DQ\ YDULDWLRQIURPWKHUHTXLUHPHQWVRIWKH&RQWUDFW'RFXPHQWVXQOHVV&RQWUDFWRUKDVFRPSOLHG ZLWKWKHUHTXLUHPHQWVRI6HFWLRQDQG&LW\KDVJLYHQZULWWHQDFFHSWDQFHRIHDFK VXFK YDULDWLRQ E\ VSHFLILF ZULWWHQ QRWDWLRQ WKHUHRI LQFRUSRUDWHG LQ RU DFFRPSDQ\LQJ WKH 6XEPLWWDO&LW\¶VUHYLHZDQGDFFHSWDQFHVKDOOQRWUHOLHYH&RQWUDFWRUIURPUHVSRQVLELOLW\IRU FRPSO\LQJZLWKWKHUHTXLUHPHQWVRIWKH&RQWUDFW'RFXPHQWV Contractor’s General Warranty and Guarantee $ &RQWUDFWRUZDUUDQWVDQGJXDUDQWHHVWR&LW\WKDWDOO:RUNZLOOEHLQDFFRUGDQFHZLWKWKH&RQWUDFW 'RFXPHQWV DQG ZLOO QRW EH GHIHFWLYH &LW\ DQG LWV RIILFHUV GLUHFWRUV PHPEHUV SDUWQHUV HPSOR\HHVDJHQWVFRQVXOWDQWVDQGVXEFRQWUDFWRUVVKDOOEHHQWLWOHGWRUHO\RQUHSUHVHQWDWLRQRI &RQWUDFWRU¶VZDUUDQW\DQGJXDUDQWHH % &RQWUDFWRU¶VZDUUDQW\DQGJXDUDQWHHKHUHXQGHUH[FOXGHVGHIHFWVRUGDPDJHFDXVHGE\ DEXVHPRGLILFDWLRQRULPSURSHUPDLQWHQDQFHRURSHUDWLRQE\SHUVRQVRWKHUWKDQ&RQWUDFWRU 6XEFRQWUDFWRUV 6XSSOLHUV RU DQ\ RWKHU LQGLYLGXDO RU HQWLW\ IRU ZKRP &RQWUDFWRU LV UHVSRQVLEOHRU QRUPDOZHDUDQGWHDUXQGHUQRUPDOXVDJH & &RQWUDFWRU¶V REOLJDWLRQ WR SHUIRUP DQG FRPSOHWH WKH :RUN LQ DFFRUGDQFH ZLWK WKH &RQWUDFW 'RFXPHQWVVKDOOEHDEVROXWH1RQHRIWKHIROORZLQJZLOOFRQVWLWXWHDQDFFHSWDQFHRI:RUNWKDWLV QRW LQ DFFRUGDQFH ZLWK WKH &RQWUDFW 'RFXPHQWV RU D UHOHDVH RI &RQWUDFWRU¶V REOLJDWLRQ WR SHUIRUPWKH:RUNLQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWV REVHUYDWLRQVE\&LW\ UHFRPPHQGDWLRQRUSD\PHQWE\&LW\RU'HYHORSHURIDQ\SURJUHVVRUILQDOSD\PHQW WKHLVVXDQFHRIDFHUWLILFDWHRI)LQDO$FFHSWDQFHE\&LW\RUDQ\SD\PHQWUHODWHGWKHUHWRE\ &LW\ XVHRURFFXSDQF\RIWKH:RUNRUDQ\SDUWWKHUHRIE\&LW\ DQ\UHYLHZDQGDFFHSWDQFHRID6XEPLWWDOE\&LW\ DQ\LQVSHFWLRQWHVWRUDSSURYDOE\RWKHUVRU 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ DQ\FRUUHFWLRQRIGHIHFWLYH:RUNE\&LW\ ' 7KH&RQWUDFWRUVKDOOUHPHG\DQ\GHIHFWVRUGDPDJHVLQWKH:RUNDQGSD\IRUDQ\GDPDJHWR RWKHUZRUNRUSURSHUW\UHVXOWLQJWKHUHIURPZKLFKVKDOODSSHDUZLWKLQDSHULRGRIWZR\HDUV IURPWKHGDWHRI)LQDO$FFHSWDQFHRIWKH:RUNXQOHVVDORQJHUSHULRGLVVSHFLILHGDQGVKDOO IXUQLVKDJRRGDQGVXIILFLHQWPDLQWHQDQFHERQGFRPSO\LQJZLWKWKHUHTXLUHPHQWVRI$UWLFOH %7KH&LW\ZLOOJLYHQRWLFHRIREVHUYHGGHIHFWVZLWKUHDVRQDEOHSURPSWQHVV ,QGHPQLILFDWLRQ $ &RQWUDFWRUFRYHQDQWVDQGDJUHHVWRLQGHPQLI\KROGKDUPOHVVDQGGHIHQGDWLWVRZQH[SHQVHWKH &LW\LWVRIILFHUVVHUYDQWVDQGHPSOR\HHVIURPDQGDJDLQVWDQ\DQGDOOFODLPVDULVLQJRXWRIRU DOOHJHGWRDULVHRXWRIWKHZRUNDQGVHUYLFHVWREHSHUIRUPHGE\WKH&RQWUDFWRULWVRIILFHUV DJHQWV HPSOR\HHV VXEFRQWUDFWRUV OLFHQVHV RU LQYLWHHV XQGHU WKLV &RQWUDFW7+,6 ,1'(01,),&$7,21 3529,6,21 ,6 63(&,),&$//< ,17(1'(' 72 23(5$7( $1'%(())(&7,9((9(1,),7,6$//(*('253529(17+$7$//25620( 2)7+('$0$*(6%(,1*628*+7:(5(&$86(',1:+2/(25,13$57%< $1<$&720,66,21251(*/,*(1&(2)7+(&,7<7KLVLQGHPQLW\SURYLVLRQLV LQWHQGHGWRLQFOXGHZLWKRXWOLPLWDWLRQLQGHPQLW\IRUFRVWVH[SHQVHVDQGOHJDOIHHVLQFXUUHGE\ WKH&LW\LQGHIHQGLQJDJDLQVWVXFKFODLPVDQGFDXVHVRIDFWLRQV % &RQWUDFWRUFRYHQDQWVDQGDJUHHVWRLQGHPQLI\DQGKROGKDUPOHVVDWLWVRZQH[SHQVHWKH&LW\LWV RIILFHUVVHUYDQWVDQGHPSOR\HHVIURPDQGDJDLQVWDQ\DQGDOOORVVGDPDJHRUGHVWUXFWLRQRI SURSHUW\ RI WKH &LW\ DULVLQJ RXW RI RU DOOHJHG WR DULVH RXW RI WKH ZRUN DQG VHUYLFHV WR EH SHUIRUPHGE\WKH&RQWUDFWRULWVRIILFHUVDJHQWVHPSOR\HHVVXEFRQWUDFWRUVOLFHQVHHVRULQYLWHHV XQGHU WKLV &RQWUDFW 7+,6 ,1'(01,),&$7,21 3529,6,21 ,6 63(&,),&$//< ,17(1'(' 72 23(5$7( $1' %( ())(&7,9( (9(1 ,) ,7 ,6 $//(*(' 25 3529(1 7+$7 $// 25 620( 2) 7+( '$0$*(6 %(,1* 628*+7 :(5( &$86(',1:+2/(25,13$57%<$1<$&720,66,21251(*/,*(1&(2) 7+(&,7< Delegation of Professional Design Services $ &RQWUDFWRUZLOOQRWEHUHTXLUHGWRSURYLGHSURIHVVLRQDOGHVLJQVHUYLFHVXQOHVVVXFKVHUYLFHVDUH VSHFLILFDOO\ UHTXLUHG E\ WKH &RQWUDFW 'RFXPHQWV IRU D SRUWLRQ RI WKH :RUN RU XQOHVV VXFK VHUYLFHVDUHUHTXLUHGWRFDUU\RXW&RQWUDFWRU¶VUHVSRQVLELOLWLHVIRUFRQVWUXFWLRQPHDQVPHWKRGV WHFKQLTXHVVHTXHQFHVDQGSURFHGXUHV % ,I SURIHVVLRQDO GHVLJQ VHUYLFHV RU FHUWLILFDWLRQV E\ D GHVLJQ SURIHVVLRQDO UHODWHG WR V\VWHPV PDWHULDOVRUHTXLSPHQWDUHVSHFLILFDOO\UHTXLUHGRI&RQWUDFWRUE\WKH&RQWUDFW'RFXPHQWV&LW\ ZLOOVSHFLI\DOOSHUIRUPDQFHDQGGHVLJQFULWHULDWKDWVXFKVHUYLFHVPXVWVDWLVI\&RQWUDFWRUVKDOO FDXVHVXFKVHUYLFHVRUFHUWLILFDWLRQVWREHSURYLGHGE\DSURSHUO\OLFHQVHGSURIHVVLRQDOZKRVH VLJQDWXUHDQGVHDOVKDOODSSHDURQDOOGUDZLQJVFDOFXODWLRQVVSHFLILFDWLRQVFHUWLILFDWLRQVDQG 6XEPLWWDOVSUHSDUHGE\VXFKSURIHVVLRQDO6XEPLWWDOVUHODWHGWRWKH:RUNGHVLJQHGRUFHUWLILHG E\VXFKSURIHVVLRQDOLISUHSDUHGE\RWKHUVVKDOOEHDUVXFKSURIHVVLRQDO¶VZULWWHQDSSURYDOZKHQ VXEPLWWHGWR&LW\ 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ & &LW\VKDOOEHHQWLWOHGWRUHO\XSRQWKHDGHTXDF\DFFXUDF\DQGFRPSOHWHQHVVRIWKHVHUYLFHV FHUWLILFDWLRQVRUDSSURYDOVSHUIRUPHGE\VXFKGHVLJQSURIHVVLRQDOVSURYLGHG&LW\KDVVSHFLILHG WR&RQWUDFWRUSHUIRUPDQFHDQGGHVLJQFULWHULDWKDWVXFKVHUYLFHVPXVWVDWLVI\ ' 3XUVXDQWWRWKLV3DUDJUDSK&LW\¶VUHYLHZDQGDFFHSWDQFHRIGHVLJQFDOFXODWLRQVDQGGHVLJQ GUDZLQJVZLOOEHRQO\IRUWKHOLPLWHGSXUSRVHRIFKHFNLQJIRUFRQIRUPDQFHZLWKSHUIRUPDQFH DQGGHVLJQFULWHULDJLYHQDQGWKHGHVLJQFRQFHSWH[SUHVVHGLQWKH&RQWUDFW'RFXPHQWV&LW\¶V UHYLHZDQGDFFHSWDQFHRI6XEPLWWDOVH[FHSWGHVLJQFDOFXODWLRQVDQGGHVLJQGUDZLQJVZLOOEH RQO\IRUWKHSXUSRVHVWDWHGLQ3DUDJUDSK& Right to Audit: $ 7KH&LW\UHVHUYHVWKHULJKWWRDXGLWDOOSURMHFWVXWLOL]LQJ&LW\IXQGV % 7KH &RQWUDFWRU DJUHHV WKDW WKH &LW\ VKDOO XQWLO WKH H[SLUDWLRQ RI WKUHH \HDUV DIWHU ILQDO SD\PHQWXQGHUWKLV&RQWUDFWKDYHDFFHVVWRDQGWKHULJKWWRH[DPLQHDQGSKRWRFRS\DQ\GLUHFWO\ SHUWLQHQWERRNVGRFXPHQWVSDSHUVDQGUHFRUGVRIWKH&RQWUDFWRULQYROYLQJWUDQVDFWLRQVUHODWLQJ WRWKLV&RQWUDFW&RQWUDFWRUDJUHHVWKDWWKH&LW\VKDOOKDYHDFFHVVGXULQJ5HJXODU:RUNLQJ+RXUV WRDOOQHFHVVDU\&RQWUDFWRUIDFLOLWLHVDQGVKDOOEHSURYLGHGDGHTXDWHDQGDSSURSULDWHZRUNVSDFH LQRUGHUWRFRQGXFWDXGLWVLQFRPSOLDQFHZLWKWKHSURYLVLRQVRIWKLV3DUDJUDSK7KH&LW\VKDOO JLYH&RQWUDFWRUUHDVRQDEOHDGYDQFHQRWLFHRILQWHQGHGDXGLWV & &RQWUDFWRUIXUWKHUDJUHHVWRLQFOXGHLQDOOLWVVXEFRQWUDFWVKHUHXQGHUDSURYLVLRQWRWKHHIIHFWWKDW WKHVXEFRQWUDFWRUDJUHHVWKDWWKH&LW\VKDOOXQWLOWKHH[SLUDWLRQRIWKUHH\HDUVDIWHUILQDO SD\PHQWXQGHUWKLV&RQWUDFWKDYHDFFHVVWRDQGWKHULJKWWRH[DPLQHDQGSKRWRFRS\DQ\GLUHFWO\ SHUWLQHQWERRNVGRFXPHQWVSDSHUVDQGUHFRUGVRIVXFK6XEFRQWUDFWRULQYROYLQJWUDQVDFWLRQVWR WKHVXEFRQWUDFWDQGIXUWKHUWKDW&LW\VKDOOKDYHDFFHVVGXULQJ5HJXODU:RUNLQJ+RXUVWRDOO 6XEFRQWUDFWRUIDFLOLWLHVDQGVKDOOEHSURYLGHGDGHTXDWHDQGDSSURSULDWHZRUNVSDFHLQRUGHUWR FRQGXFW DXGLWV LQ FRPSOLDQFH ZLWK WKH SURYLVLRQV RI WKLV 3DUDJUDSK 7KH &LW\ VKDOO JLYH 6XEFRQWUDFWRUUHDVRQDEOHDGYDQFHQRWLFHRILQWHQGHGDXGLWV ' &RQWUDFWRUDQG6XEFRQWUDFWRUDJUHHWRSKRWRFRS\VXFKGRFXPHQWVDVPD\EHUHTXHVWHGE\WKH &LW\7KH&LW\DJUHHVWRUHLPEXUVH&RQWUDFWRUIRUWKHFRVWRIWKHFRSLHVDVIROORZVDWWKHUDWH SXEOLVKHGLQWKH7H[DV$GPLQLVWUDWLYH&RGHLQHIIHFWDVRIWKHWLPHFRS\LQJLVSHUIRUPHG Nondiscrimination $ 7KH&LW\LVUHVSRQVLEOHIRURSHUDWLQJ3XEOLF7UDQVSRUWDWLRQ3URJUDPVDQGLPSOHPHQWLQJWUDQVLW UHODWHGSURMHFWVZKLFKDUHIXQGHGLQSDUWZLWK)HGHUDOILQDQFLDODVVLVWDQFHDZDUGHGE\WKH86 'HSDUWPHQW RI 7UDQVSRUWDWLRQ DQG WKH )HGHUDO 7UDQVLW $GPLQLVWUDWLRQ )7$ ZLWKRXW GLVFULPLQDWLQJDJDLQVWDQ\SHUVRQLQWKH8QLWHG6WDWHVRQWKHEDVLVRIUDFHFRORURUQDWLRQDO RULJLQ %Title VI, Civil Rights Act of 1964 as amended:&RQWUDFWRUVKDOOFRPSO\ZLWKWKHUHTXLUHPHQWVRI WKH$FWDQGWKH5HJXODWLRQVDVIXUWKHUGHILQHGLQWKH6XSSOHPHQWDU\&RQGLWLRQVIRUDQ\SURMHFW UHFHLYLQJ)HGHUDODVVLVWDQFH 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ $57,&/(±27+(5:25.$77+(6,7( Related Work at Site $ &LW\PD\SHUIRUPRWKHUZRUNUHODWHGWRWKH3URMHFWDWWKH6LWHZLWK&LW\¶VHPSOR\HHVRURWKHU &LW\FRQWUDFWRUVRUWKURXJKRWKHUGLUHFWFRQWUDFWVWKHUHIRURUKDYHRWKHUZRUNSHUIRUPHGE\ XWLOLW\RZQHUV,IVXFKRWKHUZRUNLVQRWQRWHGLQWKH&RQWUDFW'RFXPHQWVWKHQZULWWHQQRWLFH WKHUHRIZLOOEHJLYHQWR&RQWUDFWRUSULRUWRVWDUWLQJDQ\VXFKRWKHUZRUNDQG % &RQWUDFWRUVKDOODIIRUGHDFKRWKHUFRQWUDFWRUZKRLVDSDUW\WRVXFKDGLUHFWFRQWUDFWHDFKXWLOLW\ RZQHU DQG &LW\ LI &LW\ LV SHUIRUPLQJ RWKHU ZRUN ZLWK &LW\¶V HPSOR\HHV RU RWKHU &LW\ FRQWUDFWRUV SURSHU DQG VDIH DFFHVV WR WKH 6LWH SURYLGH D UHDVRQDEOH RSSRUWXQLW\ IRU WKH LQWURGXFWLRQDQGVWRUDJHRIPDWHULDOVDQGHTXLSPHQWDQGWKHH[HFXWLRQRIVXFKRWKHUZRUNDQG SURSHUO\FRRUGLQDWHWKH:RUNZLWKWKHLUV&RQWUDFWRUVKDOOGRDOOFXWWLQJILWWLQJDQGSDWFKLQJRI WKH:RUNWKDWPD\EHUHTXLUHGWRSURSHUO\FRQQHFWRURWKHUZLVHPDNHLWVVHYHUDOSDUWVFRPH WRJHWKHUDQGSURSHUO\LQWHJUDWHZLWKVXFKRWKHUZRUN&RQWUDFWRUVKDOOQRWHQGDQJHUDQ\ZRUNRI RWKHUV E\ FXWWLQJ H[FDYDWLQJ RU RWKHUZLVH DOWHULQJ VXFK ZRUN SURYLGHG KRZHYHU WKDW &RQWUDFWRUPD\FXWRUDOWHURWKHUV ZRUNZLWKWKHZULWWHQFRQVHQWRI&LW\DQGWKHRWKHUVZKRVH ZRUNZLOOEHDIIHFWHG & ,I WKH SURSHU H[HFXWLRQ RU UHVXOWV RI DQ\ SDUW RI &RQWUDFWRU¶V :RUN GHSHQGV XSRQ ZRUN SHUIRUPHGE\RWKHUVXQGHUWKLV$UWLFOH&RQWUDFWRUVKDOOLQVSHFWVXFKRWKHUZRUNDQGSURPSWO\ UHSRUWWR&LW\LQZULWLQJDQ\GHOD\VGHIHFWVRUGHILFLHQFLHVLQVXFKRWKHUZRUNWKDWUHQGHULW XQDYDLODEOHRUXQVXLWDEOHIRUWKHSURSHUH[HFXWLRQDQGUHVXOWVRI&RQWUDFWRU¶V:RUN&RQWUDFWRU¶V IDLOXUH WR VR UHSRUW ZLOO FRQVWLWXWH DQ DFFHSWDQFH RI VXFK RWKHU ZRUN DV ILW DQG SURSHU IRU LQWHJUDWLRQZLWK&RQWUDFWRU¶V:RUNH[FHSWIRUODWHQWGHIHFWVLQWKHZRUNSURYLGHGE\RWKHUV $57,&/(±&,7<¶65(63216,%,/,7,(6 Inspections, Tests, and Approvals &LW\¶VUHVSRQVLELOLW\ZLWKUHVSHFWWRFHUWDLQLQVSHFWLRQVWHVWVDQGDSSURYDOVLVVHWIRUWKLQ3DUDJUDSK Limitations on City’s Responsibilities $ 7KH&LW\VKDOOQRWVXSHUYLVHGLUHFWRUKDYHFRQWURORUDXWKRULW\RYHUQRUEHUHVSRQVLEOHIRU &RQWUDFWRU¶VPHDQVPHWKRGVWHFKQLTXHVVHTXHQFHVRUSURFHGXUHVRIFRQVWUXFWLRQRUWKHVDIHW\ SUHFDXWLRQVDQGSURJUDPVLQFLGHQWWKHUHWRRUIRUDQ\IDLOXUHRI&RQWUDFWRUWRFRPSO\ZLWK/DZV DQG5HJXODWLRQVDSSOLFDEOHWRWKHSHUIRUPDQFHRIWKH:RUN&LW\ZLOOQRWEHUHVSRQVLEOHIRU &RQWUDFWRU¶VIDLOXUHWRSHUIRUPWKH:RUNLQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWV % &LW\ZLOOQRWLI\WKH&RQWUDFWRURIDSSOLFDEOHVDIHW\SODQVSXUVXDQWWR3DUDJUDSK 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ Compliance with Safety Program :KLOHDWWKH6LWH&LW\¶VHPSOR\HHVDQGUHSUHVHQWDWLYHVVKDOOFRPSO\ZLWKWKHVSHFLILFDSSOLFDEOH UHTXLUHPHQWV RI &RQWUDFWRU¶V VDIHW\ SURJUDPV RI ZKLFK &LW\ KDVEHHQ LQIRUPHG SXUVXDQW WR 3DUDJUDSK $57,&/(±&,7<¶62%6(59$7,2167$786'85,1*&216758&7,21 City’s Project Representative &LW\ZLOOSURYLGHRQHRUPRUH3URMHFW5HSUHVHQWDWLYHVGXULQJWKHFRQVWUXFWLRQSHULRG7KHGXWLHV DQGUHVSRQVLELOLWLHVDQGWKHOLPLWDWLRQVRIDXWKRULW\RI&LW\¶VUHSUHVHQWDWLYHGXULQJFRQVWUXFWLRQDUH VHWIRUWKLQWKH&RQWUDFW'RFXPHQWV $ &LW\¶V3URMHFW5HSUHVHQWDWLYHZLOOPDNHYLVLWVWRWKH6LWHDWLQWHUYDOVDSSURSULDWHWRWKHYDULRXV VWDJHVRIFRQVWUXFWLRQDV&LW\GHHPVQHFHVVDU\LQRUGHUWRREVHUYHWKHSURJUHVVWKDWKDVEHHQ PDGH DQG WKH TXDOLW\ RI WKH YDULRXV DVSHFWV RI &RQWUDFWRU¶V H[HFXWHG :RUN %DVHG RQ LQIRUPDWLRQ REWDLQHG GXULQJ VXFK YLVLWV DQG REVHUYDWLRQV &LW\¶V 3URMHFW 5HSUHVHQWDWLYH ZLOO GHWHUPLQHLQJHQHUDOLIWKH:RUNLVSURFHHGLQJLQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWV &LW\¶V3URMHFW5HSUHVHQWDWLYHZLOOQRWEHUHTXLUHGWRPDNHH[KDXVWLYHRUFRQWLQXRXVLQVSHFWLRQV RQWKH6LWHWRFKHFNWKHTXDOLW\RUTXDQWLW\RIWKH:RUN&LW\¶V3URMHFW5HSUHVHQWDWLYH¶VHIIRUWV ZLOOEHGLUHFWHGWRZDUGSURYLGLQJ&LW\DJUHDWHUGHJUHHRIFRQILGHQFHWKDWWKHFRPSOHWHG:RUN ZLOOFRQIRUPJHQHUDOO\WRWKH&RQWUDFW'RFXPHQWV % &LW\¶V 3URMHFW 5HSUHVHQWDWLYH¶V YLVLWV DQG REVHUYDWLRQV DUH VXEMHFW WR DOO WKH OLPLWDWLRQV RQ DXWKRULW\DQGUHVSRQVLELOLW\LQWKH&RQWUDFW'RFXPHQWV Authorized Variations in Work &LW\¶V3URMHFW5HSUHVHQWDWLYHPD\DXWKRUL]HPLQRUYDULDWLRQVLQWKH:RUNIURPWKHUHTXLUHPHQWVRI WKH&RQWUDFW'RFXPHQWVZKLFKGRQRWLQYROYHDQDGMXVWPHQWLQWKH&RQWUDFW3ULFHRUWKH&RQWUDFW 7LPHDQGDUHFRPSDWLEOHZLWKWKHGHVLJQFRQFHSWRIWKHFRPSOHWHG3URMHFWDVDIXQFWLRQLQJZKROHDV LQGLFDWHGE\WKH&RQWUDFW'RFXPHQWV7KHVHPD\EHDFFRPSOLVKHGE\D)LHOG2UGHUDQGZLOOEH ELQGLQJRQ&LW\'HYHORSHUDQGDOVRRQ&RQWUDFWRUZKRVKDOOSHUIRUPWKH:RUNLQYROYHGSURPSWO\ Rejecting Defective Work &LW\ZLOOKDYHDXWKRULW\WRUHMHFW:RUNZKLFK&LW\¶V3URMHFW5HSUHVHQWDWLYHEHOLHYHVWREHGHIHFWLYH RU ZLOO QRW SURGXFH D FRPSOHWHG 3URMHFW WKDW FRQIRUPV WR WKH &RQWUDFW 'RFXPHQWV RU WKDW ZLOO SUHMXGLFHWKHLQWHJULW\RIWKHGHVLJQFRQFHSWRIWKHFRPSOHWHG3URMHFWDVDIXQFWLRQLQJZKROHDV LQGLFDWHGE\WKH&RQWUDFW'RFXPHQWV&LW\ZLOOKDYHDXWKRULW\WRFRQGXFWVSHFLDOLQVSHFWLRQRU WHVWLQJRIWKH:RUNDVSURYLGHGLQ$UWLFOHZKHWKHURUQRWWKH:RUNLVIDEULFDWHGLQVWDOOHGRU FRPSOHWHG 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ Determinations for Work Performed &RQWUDFWRUZLOOGHWHUPLQHWKHDFWXDOTXDQWLWLHVDQGFODVVLILFDWLRQVRI:RUNSHUIRUPHG&LW\¶V3URMHFW 5HSUHVHQWDWLYHZLOOUHYLHZZLWK&RQWUDFWRUWKHSUHOLPLQDU\GHWHUPLQDWLRQVRQVXFKPDWWHUVEHIRUH UHQGHULQJDZULWWHQUHFRPPHQGDWLRQ&LW\¶VZULWWHQGHFLVLRQZLOOEHILQDOH[FHSWDVPRGLILHGWR UHIOHFWFKDQJHGIDFWXDOFRQGLWLRQVRUPRUHDFFXUDWHGDWD $57,&/(±&+$1*(6,17+(:25. Authorized Changes in the Work $ :LWKRXWLQYDOLGDWLQJWKH&RQWUDFWDQGZLWKRXWQRWLFHWRDQ\VXUHW\&LW\PD\DWDQ\WLPHRU IURP WLPH WR WLPH RUGHU ([WUD :RUN 8SRQ QRWLFH RI VXFK ([WUD:RUN &RQWUDFWRU VKDOO SURPSWO\ SURFHHG ZLWK WKH :RUN LQYROYHG ZKLFK ZLOO EH SHUIRUPHG XQGHU WKH DSSOLFDEOH FRQGLWLRQVRIWKH&RQWUDFW'RFXPHQWVH[FHSWDVRWKHUZLVHVSHFLILFDOO\SURYLGHG([WUD:RUN VKDOOEHPHPRULDOL]HGE\D3DUWLFLSDWLQJ&KDQJH2UGHUZKLFKPD\RUPD\QRWSUHFHGHDQRUGHU RI([WUDZRUN % )RUPLQRUFKDQJHVRI:RUNQRWUHTXLULQJFKDQJHVWR&RQWUDFW7LPHRU&RQWUDFW3ULFHRQD SURMHFWZLWK&LW\SDUWLFLSDWLRQD)LHOG2UGHUPD\EHLVVXHGE\WKH&LW\ Notification to Surety ,IWKHSURYLVLRQVRIDQ\ERQGUHTXLUHQRWLFHWREHJLYHQWRDVXUHW\RIDQ\FKDQJHDIIHFWLQJWKH JHQHUDOVFRSHRIWKH:RUNRUWKHSURYLVLRQVRIWKH&RQWUDFW'RFXPHQWVLQFOXGLQJEXWQRWOLPLWHG WR &RQWUDFW 3ULFH RU &RQWUDFW 7LPH WKH JLYLQJ RI DQ\ VXFK QRWLFH ZLOO EH &RQWUDFWRU¶V UHVSRQVLELOLW\7KHDPRXQWRIHDFKDSSOLFDEOHERQGZLOOEHDGMXVWHGE\WKH&RQWUDFWRUWRUHIOHFWWKH HIIHFWRIDQ\VXFKFKDQJH $57,&/(±&+$1*(2)&2175$&735,&(&+$1*(2)&2175$&77,0( Change of Contract Price $ 7KH&RQWUDFW3ULFHPD\RQO\EHFKDQJHGE\D3DUWLFLSDWLQJ&KDQJH2UGHUIRUSURMHFWVZLWK&LW\ SDUWLFLSDWLRQ Change of Contract Time $ 7KH&RQWUDFW7LPHPD\RQO\EHFKDQJHGE\D3DUWLFLSDWLQJ&KDQJH2UGHUIRUSURMHFWVZLWK&LW\ SDUWLFLSDWLRQ Delays $ ,I&RQWUDFWRULVGHOD\HG&LW\VKDOOQRWEHOLDEOHWR&RQWUDFWRUIRUDQ\FODLPVFRVWVORVVHVRU GDPDJHVLQFOXGLQJEXWQRWOLPLWHGWRDOOIHHVDQGFKDUJHVRIHQJLQHHUVDUFKLWHFWVDWWRUQH\VDQG RWKHUSURIHVVLRQDOVDQGDOOFRXUWRUDUELWUDWLRQRURWKHUGLVSXWHUHVROXWLRQFRVWVVXVWDLQHGE\ &RQWUDFWRURQRULQFRQQHFWLRQZLWKDQ\RWKHUSURMHFWRUDQWLFLSDWHGSURMHFW 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ $57,&/(±7(676$1',163(&7,216&255(&7,215(029$/25$&&(37$1&(2) '()(&7,9(:25. Notice of Defects 1RWLFH RI DOO GHIHFWLYH :RUN RI ZKLFK &LW\ KDV DFWXDO NQRZOHGJH ZLOO EH JLYHQ WR &RQWUDFWRU 'HIHFWLYH:RUNPD\EHUHMHFWHGFRUUHFWHGRUDFFHSWHGDVSURYLGHGLQWKLV$UWLFOH Access to Work &LW\LQGHSHQGHQWWHVWLQJODERUDWRULHVDQGJRYHUQPHQWDODJHQFLHVZLWKMXULVGLFWLRQDOLQWHUHVWVZLOO KDYHDFFHVVWRWKH6LWHDQGWKH:RUNDWUHDVRQDEOHWLPHVIRUWKHLUREVHUYDWLRQLQVSHFWLRQDQG WHVWLQJ&RQWUDFWRUVKDOOSURYLGHWKHPSURSHUDQGVDIHFRQGLWLRQVIRUVXFKDFFHVVDQGDGYLVHWKHPRI &RQWUDFWRU¶VVDIHW\SURFHGXUHVDQGSURJUDPVVRWKDWWKH\PD\FRPSO\WKHUHZLWKDVDSSOLFDEOH Tests and Inspections $ &RQWUDFWRUVKDOOJLYH&LW\WLPHO\QRWLFHRIUHDGLQHVVRIWKH:RUNIRUDOOUHTXLUHGLQVSHFWLRQV WHVWVRUDSSURYDOVDQGVKDOOFRRSHUDWHZLWKLQVSHFWLRQDQGWHVWLQJSHUVRQQHOWRIDFLOLWDWHUHTXLUHG LQVSHFWLRQVRUWHVWV % ,I&RQWUDFW'RFXPHQWV/DZVRU5HJXODWLRQVRIDQ\SXEOLFERG\KDYLQJMXULVGLFWLRQUHTXLUHDQ\ RIWKH:RUNRUSDUWWKHUHRIWREHLQVSHFWHGWHVWHGRUDSSURYHG&RQWUDFWRUVKDOODVVXPHIXOO UHVSRQVLELOLW\ IRU DUUDQJLQJ DQG REWDLQLQJ VXFK LQGHSHQGHQW LQVSHFWLRQV WHVWV UHWHVWV RU DSSURYDOVSD\DOOFRVWVLQFRQQHFWLRQWKHUHZLWKDQGIXUQLVK&LW\WKHUHTXLUHGFHUWLILFDWHVRI LQVSHFWLRQ RU DSSURYDO H[FHSWLQJ KRZHYHU WKRVH IHHV VSHFLILFDOO\ LGHQWLILHG LQ WKH 6XSSOHPHQWDU\ &RQGLWLRQV RU DQ\ 7H[DV 'HSDUWPHQW RI /LFHQVXUH DQG 5HJXODWLRQ 7'/5 LQVSHFWLRQVZKLFKVKDOOEHSDLGDVGHVFULEHGLQWKH6XSSOHPHQWDU\&RQGLWLRQV & &RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUDUUDQJLQJDQGREWDLQLQJDQGVKDOOSD\DOOFRVWVLQFRQQHFWLRQ ZLWKDQ\LQVSHFWLRQVWHVWVUHWHVWVRUDSSURYDOVUHTXLUHGIRU&LW\¶VDFFHSWDQFHRIPDWHULDOVRU HTXLSPHQWWREHLQFRUSRUDWHGLQWKH:RUNRUDFFHSWDQFHRIPDWHULDOVPL[GHVLJQVRUHTXLSPHQW VXEPLWWHGIRUDSSURYDOSULRUWR&RQWUDFWRU¶VSXUFKDVHWKHUHRIIRULQFRUSRUDWLRQLQWKH:RUN 6XFKLQVSHFWLRQVWHVWVUHWHVWVRUDSSURYDOVVKDOOEHSHUIRUPHGE\RUJDQL]DWLRQVDSSURYHGE\ &LW\ ' &LW\ PD\ DUUDQJH IRU WKH VHUYLFHV RI DQ LQGHSHQGHQW WHVWLQJ ODERUDWRU\ ³7HVWLQJ /DE´ WR SHUIRUPDQ\LQVSHFWLRQVRUWHVWV³7HVWLQJ´IRUDQ\SDUWRIWKH:RUNDVGHWHUPLQHGVROHO\E\ &LW\ &LW\ZLOOFRRUGLQDWHVXFK7HVWLQJWRWKHH[WHQWSRVVLEOHZLWK&RQWUDFWRU 6KRXOGDQ\7HVWLQJXQGHUWKLV6HFWLRQ'UHVXOWLQD³IDLO´³GLGQRWSDVV´RURWKHU VLPLODUQHJDWLYHUHVXOWWKH&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUSD\LQJIRUDQ\DQGDOOUHWHVWV &RQWUDFWRU¶VFDQFHOODWLRQZLWKRXWFDXVHRI&LW\LQLWLDWHG7HVWLQJVKDOOEHGHHPHGDQHJDWLYH UHVXOWDQGUHTXLUHDUHWHVW 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ $Q\DPRXQWVRZHGIRUDQ\UHWHVWXQGHUWKLV6HFWLRQ'VKDOOEHSDLGGLUHFWO\WRWKH 7HVWLQJ /DE E\ &RQWUDFWRU &LW\ ZLOO IRUZDUG DOO LQYRLFHV IRUUHWHVWV WR 'HYHORSHU&RQWUDFWRU ,I&RQWUDFWRUIDLOVWRSD\WKH7HVWLQJ/DE&LW\ZLOOQRWLVVXHDOHWWHURI)LQDO$FFHSWDQFH XQWLOWKH7HVWLQJ/DELV3DLG ( ,IDQ\:RUNRUWKHZRUNRIRWKHUVWKDWLVWREHLQVSHFWHGWHVWHGRUDSSURYHGLVFRYHUHGE\ &RQWUDFWRUZLWKRXWZULWWHQFRQFXUUHQFHRI&LW\&RQWUDFWRUVKDOOLIUHTXHVWHGE\&LW\XQFRYHU VXFK:RUNIRUREVHUYDWLRQ Uncovering Work $ ,IDQ\:RUNLVFRYHUHGFRQWUDU\WRWKH&RQWUDFW'RFXPHQWVRUVSHFLILFLQVWUXFWLRQVE\WKH&LW\LW PXVWLIUHTXHVWHGE\&LW\EHXQFRYHUHGIRU&LW\¶VREVHUYDWLRQDQGUHSODFHGDW&RQWUDFWRU¶V H[SHQVH City May Stop the Work ,IWKH:RUNLVGHIHFWLYHRU&RQWUDFWRUIDLOVWRVXSSO\VXIILFLHQWVNLOOHGZRUNHUVRUVXLWDEOHPDWHULDOV RUHTXLSPHQWRUIDLOVWRSHUIRUPWKH:RUNLQVXFKDZD\WKDWWKHFRPSOHWHG:RUNZLOOFRQIRUPWR WKH&RQWUDFW'RFXPHQWV&LW\PD\RUGHU&RQWUDFWRUWRVWRSWKH:RUNRUDQ\SRUWLRQWKHUHRIXQWLO WKHFDXVHIRUVXFKRUGHUKDVEHHQHOLPLQDWHGKRZHYHUWKLVULJKWRI&LW\WRVWRSWKH:RUNVKDOOQRW JLYHULVHWRDQ\GXW\RQWKHSDUWRI&LW\WRH[HUFLVHWKLVULJKWIRUWKHEHQHILWRI&RQWUDFWRUDQ\ 6XEFRQWUDFWRUDQ\6XSSOLHUDQ\RWKHULQGLYLGXDORUHQWLW\RUDQ\VXUHW\IRURUHPSOR\HHRUDJHQW RIDQ\RIWKHP Correction or Removal of Defective Work $ 3URPSWO\DIWHUUHFHLSWRIZULWWHQQRWLFH&RQWUDFWRUVKDOOFRUUHFWDOOGHIHFWLYH:RUNSXUVXDQWWR DQDFFHSWDEOHVFKHGXOHZKHWKHURUQRWIDEULFDWHGLQVWDOOHGRUFRPSOHWHGRULIWKH:RUNKDV EHHQUHMHFWHGE\&LW\UHPRYHLWIURPWKH3URMHFWDQGUHSODFHLWZLWK:RUNWKDWLVQRWGHIHFWLYH &RQWUDFWRUVKDOOSD\DOOFODLPVFRVWVDGGLWLRQDOWHVWLQJORVVHVDQGGDPDJHVLQFOXGLQJEXWQRW OLPLWHGWRDOOIHHVDQGFKDUJHVRIHQJLQHHUVDUFKLWHFWVDWWRUQH\VDQGRWKHUSURIHVVLRQDOVDQGDOO FRXUWRUDUELWUDWLRQRURWKHUGLVSXWHUHVROXWLRQFRVWVDULVLQJRXWRIRUUHODWLQJWRVXFKFRUUHFWLRQ RUUHPRYDOLQFOXGLQJEXWQRWOLPLWHGWRDOOFRVWVRIUHSDLURUUHSODFHPHQWRIZRUNRIRWKHUV )DLOXUHWRUHTXLUHWKHUHPRYDORIDQ\GHIHFWLYH:RUNVKDOOQRWFRQVWLWXWHDFFHSWDQFHRIVXFK :RUN % :KHQFRUUHFWLQJGHIHFWLYH:RUNXQGHUWKHWHUPVRIWKLV3DUDJUDSKRU3DUDJUDSK &RQWUDFWRUVKDOOWDNHQRDFWLRQWKDWZRXOGYRLGRURWKHUZLVHLPSDLU&LW\¶VVSHFLDOZDUUDQW\DQG JXDUDQWHHLIDQ\RQVDLG:RUN Correction Period $ ,IZLWKLQWZR\HDUVDIWHUWKHGDWHRI)LQDO$FFHSWDQFHRUVXFKORQJHUSHULRGRIWLPHDVPD\ EH SUHVFULEHG E\ WKH WHUPV RI DQ\ DSSOLFDEOH VSHFLDO JXDUDQWHHUHTXLUHG E\ WKH &RQWUDFW 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ 'RFXPHQWVDQ\:RUNLVIRXQGWREHGHIHFWLYHRULIWKHUHSDLURIDQ\GDPDJHVWRWKHODQGRU DUHDVPDGHDYDLODEOHIRU&RQWUDFWRU¶VXVHE\&LW\RUSHUPLWWHGE\/DZVDQG5HJXODWLRQVDV FRQWHPSODWHGLQ3DUDJUDSK$LVIRXQGWREHGHIHFWLYH&RQWUDFWRUVKDOOSURPSWO\ZLWKRXW FRVWWR&LW\DQGLQDFFRUGDQFHZLWK&LW\¶VZULWWHQLQVWUXFWLRQV UHSDLUVXFKGHIHFWLYHODQGRUDUHDVRU FRUUHFWVXFKGHIHFWLYH:RUNRU LIWKHGHIHFWLYH:RUNKDVEHHQUHMHFWHGE\&LW\UHPRYHLWIURPWKH3URMHFWDQGUHSODFHLW ZLWK:RUNWKDWLVQRWGHIHFWLYHDQG VDWLVIDFWRULO\FRUUHFWRUUHSDLURUUHPRYHDQGUHSODFHDQ\GDPDJHWRRWKHU:RUNWRWKHZRUN RIRWKHUVRURWKHUODQGRUDUHDVUHVXOWLQJWKHUHIURP % ,I&RQWUDFWRUGRHVQRWSURPSWO\FRPSO\ZLWKWKHWHUPVRI&LW\¶VZULWWHQLQVWUXFWLRQVRULQDQ HPHUJHQF\ZKHUHGHOD\ZRXOGFDXVHVHULRXVULVNRIORVVRUGDPDJH&LW\PD\KDYHWKHGHIHFWLYH :RUNFRUUHFWHGRUUHSDLUHGRUPD\KDYHWKHUHMHFWHG:RUNUHPRYHGDQGUHSODFHG$OOFODLPV FRVWV ORVVHV DQG GDPDJHV LQFOXGLQJ EXW QRW OLPLWHG WR DOO IHHV DQG FKDUJHV RI HQJLQHHUV DUFKLWHFWV DWWRUQH\V DQG RWKHU SURIHVVLRQDOV DQG DOO FRXUW RU RWKHU GLVSXWH UHVROXWLRQ FRVWV DULVLQJRXWRIRUUHODWLQJWRVXFKFRUUHFWLRQRUUHSDLURUVXFKUHPRYDODQGUHSODFHPHQWLQFOXGLQJ EXWQRWOLPLWHGWRDOOFRVWVRIUHSDLURUUHSODFHPHQWRIZRUNRIRWKHUVZLOOEHSDLGE\&RQWUDFWRU & :KHUHGHIHFWLYH:RUNDQGGDPDJHWRRWKHU:RUNUHVXOWLQJWKHUHIURPKDVEHHQFRUUHFWHGRU UHPRYHGDQGUHSODFHGXQGHUWKLV3DUDJUDSKWKHFRUUHFWLRQSHULRGKHUHXQGHUZLWKUHVSHFW WRVXFK:RUNPD\EHUHTXLUHGWREHH[WHQGHGIRUDQDGGLWLRQDOSHULRGRIRQH\HDUDIWHUWKHHQG RI WKH LQLWLDO FRUUHFWLRQ SHULRG &LW\ VKDOO SURYLGH GD\V ZULWWHQ QRWLFH WR &RQWUDFWRU DQG 'HYHORSHUVKRXOGVXFKDGGLWLRQDOZDUUDQW\FRYHUDJHEHUHTXLUHG&RQWUDFWRU¶VREOLJDWLRQVXQGHU WKLV3DUDJUDSKDUHLQDGGLWLRQWRDQ\RWKHUREOLJDWLRQRUZDUUDQW\7KHSURYLVLRQVRIWKLV 3DUDJUDSKVKDOOQRWEHFRQVWUXHGDVDVXEVWLWXWHIRURUDZDLYHURIWKHSURYLVLRQVRIDQ\ DSSOLFDEOHVWDWXWHRIOLPLWDWLRQRUUHSRVH City May Correct Defective Work $ ,I&RQWUDFWRUIDLOVZLWKLQDUHDVRQDEOHWLPHDIWHUZULWWHQQRWLFHIURP&LW\WRFRUUHFWGHIHFWLYH :RUNRUWRUHPRYHDQGUHSODFHUHMHFWHG:RUNDVUHTXLUHGE\&LW\LQDFFRUGDQFHZLWK3DUDJUDSK $RULI&RQWUDFWRUIDLOVWRSHUIRUPWKH:RUNLQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWV RULI&RQWUDFWRUIDLOVWRFRPSO\ZLWKDQ\RWKHUSURYLVLRQRIWKH&RQWUDFW'RFXPHQWV&LW\PD\ DIWHUVHYHQGD\VZULWWHQQRWLFHWR&RQWUDFWRUDQGWKH'HYHORSHUFRUUHFWRUUHPHG\DQ\VXFK GHILFLHQF\ % ,Q H[HUFLVLQJ WKH ULJKWV DQG UHPHGLHV XQGHU WKLV 3DUDJUDSK &LW\ VKDOO SURFHHG H[SHGLWLRXVO\ ,Q FRQQHFWLRQ ZLWK VXFK FRUUHFWLYH RU UHPHGLDO DFWLRQ &LW\ PD\ H[FOXGH &RQWUDFWRUIURPDOORUSDUWRIWKH6LWHWDNHSRVVHVVLRQRIDOORUSDUWRIWKH:RUNDQGVXVSHQG &RQWUDFWRU¶VVHUYLFHVUHODWHGWKHUHWRDQGLQFRUSRUDWHLQWKH:RUNDOOPDWHULDOVDQGHTXLSPHQW LQFRUSRUDWHGLQWKH:RUNVWRUHGDWWKH6LWHRUIRUZKLFK&LW\KDVSDLG&RQWUDFWRUEXWZKLFKDUH 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ VWRUHG HOVHZKHUH &RQWUDFWRU VKDOO DOORZ &LW\ &LW\¶V UHSUHVHQWDWLYHV DJHQWV FRQVXOWDQWV HPSOR\HHVDQG&LW\¶VRWKHUFRQWUDFWRUVDFFHVVWRWKH6LWHWRHQDEOH&LW\WRH[HUFLVHWKHULJKWV DQGUHPHGLHVXQGHUWKLV3DUDJUDSK & $OOFODLPVFRVWVORVVHVDQGGDPDJHVLQFOXGLQJEXWQRWOLPLWHGWRDOOIHHVDQGFKDUJHVRI HQJLQHHUVDUFKLWHFWVDWWRUQH\VDQGRWKHUSURIHVVLRQDOVDQGDOOFRXUWRURWKHUGLVSXWHUHVROXWLRQ FRVWVLQFXUUHGRUVXVWDLQHGE\&LW\LQH[HUFLVLQJWKHULJKWVDQGUHPHGLHVXQGHUWKLV3DUDJUDSK ZLOOEHFKDUJHGDJDLQVW&RQWUDFWRUDQGD&KDQJH2UGHUZLOOEHLVVXHGLQFRUSRUDWLQJWKH QHFHVVDU\UHYLVLRQVLQWKH&RQWUDFW'RFXPHQWVZLWKUHVSHFWWRWKH:RUNDQG&LW\VKDOOEH HQWLWOHGWRDQDSSURSULDWHGHFUHDVHLQWKH&RQWUDFW3ULFH ' &RQWUDFWRUVKDOOQRWEHDOORZHGDQH[WHQVLRQRIWKH&RQWUDFW7LPHEHFDXVHRIDQ\GHOD\LQWKH SHUIRUPDQFHRIWKH:RUNDWWULEXWDEOHWRWKHH[HUFLVHRI&LW\¶VULJKWVDQGUHPHGLHVXQGHUWKLV 3DUDJUDSK $57,&/(±&203/(7,21 Contractor’s Warranty of Title &RQWUDFWRUZDUUDQWVDQGJXDUDQWHHVWKDWWLWOHWRDOO:RUNPDWHULDOVDQGHTXLSPHQWFRYHUHGE\DQ\ $SSOLFDWLRQIRU3D\PHQWZLOOSDVVWR&LW\QRODWHUWKDQWKHWLPHRI)LQDO$FFHSWDQFHDQGVKDOOEH IUHHDQGFOHDURIDOO/LHQV Partial Utilization $ 3ULRUWR)LQDO$FFHSWDQFHRIDOOWKH:RUN&LW\PD\XVHRURFFXS\DQ\VXEVWDQWLDOO\FRPSOHWHG SDUWRIWKH:RUNZKLFKKDVVSHFLILFDOO\EHHQLGHQWLILHGLQWKH&RQWUDFW'RFXPHQWVRUZKLFK &LW\GHWHUPLQHVFRQVWLWXWHVDVHSDUDWHO\IXQFWLRQLQJDQGXVDEOHSDUWRIWKH:RUNWKDWFDQEH XVHG E\ &LW\ IRU LWV LQWHQGHG SXUSRVH ZLWKRXW VLJQLILFDQW LQWHUIHUHQFH ZLWK &RQWUDFWRU¶V SHUIRUPDQFHRIWKHUHPDLQGHURIWKH:RUN&LW\DWDQ\WLPHPD\QRWLI\&RQWUDFWRULQZULWLQJWR SHUPLW&LW\WRXVHRURFFXS\DQ\VXFKSDUWRIWKH:RUNZKLFK&LW\GHWHUPLQHVWREHUHDG\IRULWV LQWHQGHGXVHVXEMHFWWRWKHIROORZLQJFRQGLWLRQV &RQWUDFWRUDWDQ\WLPHPD\QRWLI\&LW\LQZULWLQJWKDW&RQWUDFWRUFRQVLGHUVDQ\VXFKSDUWRI WKH:RUNUHDG\IRULWVLQWHQGHGXVH :LWKLQDUHDVRQDEOHWLPHDIWHUQRWLILFDWLRQDVHQXPHUDWHGLQ3DUDJUDSK$&LW\DQG &RQWUDFWRU VKDOO PDNH DQ LQVSHFWLRQ RI WKDW SDUW RI WKH :RUN WR GHWHUPLQH LWV VWDWXV RI FRPSOHWLRQ,I&LW\GRHVQRWFRQVLGHUWKDWSDUWRIWKH:RUNWREHVXEVWDQWLDOO\FRPSOHWH&LW\ ZLOOQRWLI\&RQWUDFWRULQZULWLQJJLYLQJWKHUHDVRQVWKHUHIRU 3DUWLDO8WLOL]DWLRQZLOOQRWFRQVWLWXWH)LQDO$FFHSWDQFHE\&LW\ Final Inspection $ 8SRQZULWWHQQRWLFHIURP&RQWUDFWRUWKDWWKHHQWLUH:RUNLVFRPSOHWHLQDFFRUGDQFHZLWKWKH &RQWUDFW'RFXPHQWV 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ ZLWKLQGD\V&LW\ZLOOVFKHGXOHD)LQDO,QVSHFWLRQZLWK&RQWUDFWRU &LW\ZLOOQRWLI\&RQWUDFWRULQZULWLQJRIDOOSDUWLFXODUVLQZKLFKWKLVLQVSHFWLRQUHYHDOVWKDW WKH:RUNLVLQFRPSOHWHRUGHIHFWLYH&RQWUDFWRUVKDOOLPPHGLDWHO\WDNHVXFKPHDVXUHVDVDUH QHFHVVDU\WRFRPSOHWHVXFK:RUNRUUHPHG\VXFKGHILFLHQFLHV Final Acceptance $ 8SRQFRPSOHWLRQE\&RQWUDFWRUWR&LW\¶VVDWLVIDFWLRQRIDQ\DGGLWLRQDO:RUNLGHQWLILHGLQWKH )LQDO,QVSHFWLRQ&LW\ZLOOLVVXHWR&RQWUDFWRUDOHWWHURI)LQDO$FFHSWDQFHXSRQWKHVDWLVIDFWLRQ RIWKHIROORZLQJ $OOGRFXPHQWDWLRQFDOOHGIRULQWKH&RQWUDFW'RFXPHQWVLQFOXGLQJEXWQRWOLPLWHGWRWKH HYLGHQFHRILQVXUDQFHUHTXLUHGE\3DUDJUDSK FRQVHQWRIWKHVXUHW\LIDQ\WR)LQDO$FFHSWDQFH DOLVWRIDOOSHQGLQJRUUHOHDVHG'DPDJH&ODLPVDJDLQVW&LW\WKDW&RQWUDFWRUEHOLHYHVDUH XQVHWWOHGDQG DIILGDYLWVRISD\PHQWVDQGFRPSOHWHDQGOHJDOO\HIIHFWLYHUHOHDVHVRUZDLYHUVVDWLVIDFWRU\WR &LW\RIDOO/LHQULJKWVDULVLQJRXWRIRU/LHQVILOHGLQFRQQHFWLRQZLWKWKH:RUN DIWHUDOO'DPDJH&ODLPVKDYHEHHQUHVROYHG D GLUHFWO\E\WKH&RQWUDFWRURU E &RQWUDFWRUSURYLGHVHYLGHQFHWKDWWKH'DPDJH&ODLPKDVEHHQUHSRUWHGWR&RQWUDFWRU¶V LQVXUDQFHSURYLGHUIRUUHVROXWLRQ ,VVXLQJ)LQDO$FFHSWDQFHE\WKH&LW\VKDOOQRWUHOLHYHWKH&RQWUDFWRURIDQ\JXDUDQWHHVRU RWKHUUHTXLUHPHQWVRIWKH&RQWUDFW'RFXPHQWVZKLFKVSHFLILFDOO\FRQWLQXHWKHUHDIWHU $57,&/(±6863(16,212):25. City May Suspend Work $ $WDQ\WLPHDQGZLWKRXWFDXVH&LW\PD\VXVSHQGWKH:RUNRUDQ\SRUWLRQWKHUHRIE\ZULWWHQ QRWLFHWR&RQWUDFWRUDQGZKLFKPD\IL[WKHGDWHRQZKLFK:RUNZLOOEHUHVXPHG&RQWUDFWRU VKDOOUHVXPHWKH:RUNRQWKHGDWHVRIL[HG'XULQJWHPSRUDU\VXVSHQVLRQRIWKH:RUNFRYHUHG E\ WKHVH &RQWUDFW 'RFXPHQWV IRU DQ\ UHDVRQ WKH &LW\ ZLOO VWRS FRQWUDFW WLPH RQ &LW\ SDUWLFLSDWLRQSURMHFWV % 6KRXOGWKH&RQWUDFWRUQRWEHDEOHWRFRPSOHWHDSRUWLRQRIWKH3URMHFWGXHWRFDXVHVEH\RQGWKH FRQWURORIDQGZLWKRXWWKHIDXOWRUQHJOLJHQFHRIWKH&RQWUDFWRUDQGVKRXOGLWEHGHWHUPLQHGE\ PXWXDOFRQVHQWRIWKH&RQWUDFWRUDQG&LW\WKDWDVROXWLRQWRDOORZFRQVWUXFWLRQWRSURFHHGLVQRW 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ DYDLODEOHZLWKLQDUHDVRQDEOHSHULRGRIWLPH&RQWUDFWRUPD\UHTXHVWDQH[WHQVLRQLQ&RQWUDFW 7LPHGLUHFWO\DWWULEXWDEOHWRDQ\VXFKVXVSHQVLRQ & ,ILWVKRXOGEHFRPHQHFHVVDU\WRVXVSHQGWKH:RUNIRUDQLQGHILQLWHSHULRGWKH&RQWUDFWRUVKDOO VWRUHDOOPDWHULDOVLQVXFKDPDQQHUWKDWWKH\ZLOOQRWREVWUXFWRULPSHGHWKHSXEOLFXQQHFHVVDULO\ QRUEHFRPHGDPDJHGLQDQ\ZD\DQGKHVKDOOWDNHHYHU\SUHFDXWLRQWRSUHYHQWGDPDJHRU GHWHULRUDWLRQRIWKHZRUNSHUIRUPHGKHVKDOOSURYLGHVXLWDEOHGUDLQDJHDERXWWKHZRUNDQGHUHFW WHPSRUDU\VWUXFWXUHVZKHUHQHFHVVDU\ $57,&/(±0,6&(//$1(286 Giving Notice $ :KHQHYHUDQ\SURYLVLRQRIWKH&RQWUDFW'RFXPHQWVUHTXLUHVWKHJLYLQJRIZULWWHQQRWLFHLWZLOO EHGHHPHGWRKDYHEHHQYDOLGO\JLYHQLI GHOLYHUHGLQSHUVRQWRWKHLQGLYLGXDORUWRDPHPEHURIWKHILUPRUWRDQRIILFHURIWKH FRUSRUDWLRQIRUZKRPLWLVLQWHQGHGRU GHOLYHUHGDWRUVHQWE\UHJLVWHUHGRUFHUWLILHGPDLOSRVWDJHSUHSDLGWRWKHODVWEXVLQHVV DGGUHVVNQRZQWRWKHJLYHURIWKHQRWLFH % %XVLQHVVDGGUHVVFKDQJHVPXVWEHSURPSWO\PDGHLQZULWLQJWRWKHRWKHUSDUW\ & :KHQHYHUWKH&RQWUDFW'RFXPHQWVVSHFLILHVJLYLQJQRWLFHE\HOHFWURQLFPHDQVVXFKHOHFWURQLF QRWLFHVKDOOEHGHHPHGVXIILFLHQWXSRQFRQILUPDWLRQRIUHFHLSWE\WKHUHFHLYLQJSDUW\ Computation of Times :KHQDQ\SHULRGRIWLPHLVUHIHUUHGWRLQWKH&RQWUDFW'RFXPHQWVE\GD\VLWZLOOEHFRPSXWHGWR H[FOXGHWKHILUVWDQGLQFOXGHWKHODVWGD\RIVXFKSHULRG,IWKHODVWGD\RIDQ\VXFKSHULRGIDOOVRQD 6DWXUGD\RU6XQGD\RURQDGD\PDGHDOHJDOKROLGD\WKHQH[W:RUNLQJ'D\VKDOOEHFRPHWKHODVW GD\RIWKHSHULRG Cumulative Remedies 7KH GXWLHV DQG REOLJDWLRQV LPSRVHG E\ WKHVH *HQHUDO &RQGLWLRQVDQG WKH ULJKWV DQG UHPHGLHV DYDLODEOHKHUHXQGHUWRWKHSDUWLHVKHUHWRDUHLQDGGLWLRQWRDQGDUHQRWWREHFRQVWUXHGLQDQ\ZD\DV DOLPLWDWLRQRIDQ\ULJKWVDQGUHPHGLHVDYDLODEOHWRDQ\RUDOORIWKHPZKLFKDUHRWKHUZLVHLPSRVHG RUDYDLODEOHE\/DZVRU5HJXODWLRQVE\VSHFLDOZDUUDQW\RUJXDUDQWHHRUE\RWKHUSURYLVLRQVRIWKH &RQWUDFW'RFXPHQWV7KHSURYLVLRQVRIWKLV3DUDJUDSKZLOOEHDVHIIHFWLYHDVLIUHSHDWHGVSHFLILFDOO\ LQWKH&RQWUDFW'RFXPHQWVLQFRQQHFWLRQZLWKHDFKSDUWLFXODUGXW\REOLJDWLRQULJKWDQGUHPHG\WR ZKLFKWKH\DSSO\ 6WDQGDUG&LW\&RQGLWLRQV2I7KH&RQVWUXFWLRQ&RQWUDFW)RU'HYHORSHU$ZDUGHG3URMHFWV 3DJHRI &,7<2))257:257+ 67$1'$5'&,7<&21',7,216±'(9(/23(5$:$5'('352-(&76 5HYLVHG-DQXDU\ Survival of Obligations $OOUHSUHVHQWDWLRQVLQGHPQLILFDWLRQVZDUUDQWLHVDQGJXDUDQWHHVPDGHLQUHTXLUHGE\RUJLYHQLQ DFFRUGDQFH ZLWK WKH &RQWUDFW 'RFXPHQWV DV ZHOODV DOO FRQWLQXLQJ REOLJDWLRQV LQGLFDWHG LQ WKH &RQWUDFW 'RFXPHQWV ZLOO VXUYLYH ILQDO SD\PHQW FRPSOHWLRQ DQG DFFHSWDQFH RI WKH :RUN RU WHUPLQDWLRQRUFRPSOHWLRQRIWKH&RQWUDFWRUWHUPLQDWLRQRIWKHVHUYLFHVRI&RQWUDFWRU Headings $UWLFOHDQGSDUDJUDSKKHDGLQJVDUHLQVHUWHGIRUFRQYHQLHQFHRQO\DQGGRQRWFRQVWLWXWHSDUWVRIWKHVH *HQHUDO&RQGLWLRQV 01 11 00 - 1 DAP SUMMARY OF WORK Page 1 of 3 CITY OF FORT WORTH Lakes of River Trails East Ph 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – Developer Awarded Projects City Project No. - 102275 Revised December 20, 2012 SECTION 01 11 00 1 SUMMARY OF WORK 2 PART 1 - GENERAL 3 1.1 SUMMARY 4 A. Section Includes: 5 1. Summary of Work to be performed in accordance with the Contract Documents 6 B. Deviations from this City of Fort Worth Standard Specification 7 1. None. 8 C. Related Specification Sections include, but are not necessarily limited to: 9 1. Division 0 - Bidding Requirements, Contract Forms, and Conditions of the Contract 10 2. Division 1 - General Requirements 11 1.2 PRICE AND PAYMENT PROCEDURES 12 A. Measurement and Payment 13 1. Work associated with this Item is considered subsidiary to the various items bid. 14 No separate payment will be allowed for this Item. 15 1.3 REFERENCES [NOT USED] 16 1.4 ADMINISTRATIVE REQUIREMENTS 17 A. Work Covered by Contract Documents 18 1. Work is to include furnishing all labor, materials, and equipment, and performing 19 all Work necessary for this construction project as detailed in the Drawings and 20 Specifications. 21 B. Subsidiary Work 22 1. Any and all Work specifically governed by documentary requirements for the 23 project, such as conditions imposed by the Drawings or Contract Documents in 24 which no specific item for bid has been provided for in the Proposal and the item is 25 not a typical unit bid item included on the standard bid item list, then the item shall 26 be considered as a subsidiary item of Work, the cost of which shall be included in 27 the price bid in the Proposal for various bid items. 28 C. Use of Premises 29 1. Coordinate uses of premises under direction of the City. 30 2. Assume full responsibility for protection and safekeeping of materials and 31 equipment stored on the Site. 32 3. Use and occupy only portions of the public streets and alleys, or other public places 33 or other rights-of-way as provided for in the ordinances of the City, as shown in the 34 Contract Documents, or as may be specifically authorized in writing by the City. 35 a. A reasonable amount of tools, materials, and equipment for construction 36 purposes may be stored in such space, but no more than is necessary to avoid 37 delay in the construction operations. 38 01 11 00 - 2 DAP SUMMARY OF WORK Page 2 of 3 CITY OF FORT WORTH Lakes of River Trails East Ph 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – Developer Awarded Projects City Project No. - 102275 Revised December 20, 2012 b. Excavated and waste materials shall be stored in such a way as not to interfere 1 with the use of spaces that may be designated to be left free and unobstructed 2 and so as not to inconvenience occupants of adjacent property. 3 c. If the street is occupied by railroad tracks, the Work shall be carried on in such 4 manner as not to interfere with the operation of the railroad. 5 1) All Work shall be in accordance with railroad requirements set forth in 6 Division 0 as well as the railroad permit. 7 D. Work within Easements 8 1. Do not enter upon private property for any purpose without having previously 9 obtained permission from the owner of such property. 10 2. Do not store equipment or material on private property unless and until the 11 specified approval of the property owner has been secured in writing by the 12 Contractor and a copy furnished to the City. 13 3. Unless specifically provided otherwise, clear all rights-of-way or easements of 14 obstructions which must be removed to make possible proper prosecution of the 15 Work as a part of the project construction operations. 16 4. Preserve and use every precaution to prevent damage to, all trees, shrubbery, plants, 17 lawns, fences, culverts, curbing, and all other types of structures or improvements, 18 to all water, sewer, and gas lines, to all conduits, overhead pole lines, or 19 appurtenances thereof, including the construction of temporary fences and to all 20 other public or private property adjacent to the Work. 21 5. Notify the proper representatives of the owners or occupants of the public or private 22 lands of interest in lands which might be affected by the Work. 23 a. Such notice shall be made at least 48 hours in advance of the beginning of the 24 Work. 25 b. Notices shall be applicable to both public and private utility companies and any 26 corporation, company, individual, or other, either as owners or occupants, 27 whose land or interest in land might be affected by the Work. 28 c. Be responsible for all damage or injury to property of any character resulting 29 from any act, omission, neglect, or misconduct in the manner or method or 30 execution of the Work, or at any time due to defective work, material, or 31 equipment. 32 6. Fence 33 a. Restore all fences encountered and removed during construction of the Project 34 to the original or a better than original condition. 35 b. Erect temporary fencing in place of the fencing removed whenever the Work is 36 not in progress and when the site is vacated overnight, and/or at all times to 37 provide site security. 38 c. The cost for all fence work within easements, including removal, temporary 39 closures and replacement, shall be subsidiary to the various items bid in the 40 project proposal, unless a bid item is specifically provided in the proposal. 41 01 11 00 - 3 DAP SUMMARY OF WORK Page 3 of 3 CITY OF FORT WORTH Lakes of River Trails East Ph 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – Developer Awarded Projects City Project No. - 102275 Revised December 20, 2012 1.5 SUBMITTALS [NOT USED] 1 1.6 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS [NOT USED] 2 1.7 CLOSEOUT SUBMITTALS [NOT USED] 3 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 4 1.9 QUALITY ASSURANCE [NOT USED] 5 1.10 DELIVERY, STORAGE, AND HANDLING [NOT USED] 6 1.11 FIELD [SITE] CONDITIONS [NOT USED] 7 1.12 WARRANTY [NOT USED] 8 PART 2 - PRODUCTS [NOT USED] 9 PART 3 - EXECUTION [NOT USED] 10 END OF SECTION 11 12 Revision Log DATE NAME SUMMARY OF CHANGE 13 01 25 00 - 1 DAP SUBSTITUTION PROCEDURES Page 1 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised August 30, 2013 SECTION 01 25 00 1 SUBSTITUTION PROCEDURES 2 PART 1 - GENERAL 3 1.1 SUMMARY 4 A. Section Includes: 5 1. The procedure for requesting the approval of substitution of a product that is not 6 equivalent to a product which is specified by descriptive or performance criteria or 7 defined by reference to 1 or more of the following: 8 a. Name of manufacturer 9 b. Name of vendor 10 c. Trade name 11 d. Catalog number 12 2. Substitutions are not "or-equals". 13 B. Deviations from this City of Fort Worth Standard Specification 14 1. None. 15 C. Related Specification Sections include, but are not necessarily limited to: 16 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 17 2. Division 1 – General Requirements 18 1.2 PRICE AND PAYMENT PROCEDURES 19 A. Measurement and Payment 20 1. Work associated with this Item is considered subsidiary to the various items bid. No 21 separate payment will be allowed for this Item. 22 1.3 REFERENCES [NOT USED] 23 1.4 ADMINISTRATIVE REQUIREMENTS 24 A. Request for Substitution - General 25 1. Within 30 days after award of Contract (unless noted otherwise), the City will 26 consider formal requests from Contractor for substitution of products in place of 27 those specified. 28 2. Certain types of equipment and kinds of material are described in Specifications by 29 means of references to names of manufacturers and vendors, trade names, or catalog 30 numbers. 31 a. When this method of specifying is used, it is not intended to exclude from 32 consideration other products bearing other manufacturer's or vendor's names, 33 trade names, or catalog numbers, provided said products are "or-equals," as 34 determined by City. 35 3. Other types of equipment and kinds of material may be acceptable substitutions 36 under the following conditions: 37 a. Or-equals are unavailable due to strike, discontinued production of products 38 meeting specified requirements, or other factors beyond control of Contractor; 39 or, 40 01 25 00 - 2 DAP SUBSTITUTION PROCEDURES Page 2 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised August 30, 2013 b. Contractor proposes a cost and/or time reduction incentive to the City. 1 1.5 SUBMITTALS 2 A. See Request for Substitution Form (attached) 3 B. Procedure for Requesting Substitution 4 1. Substitution shall be considered only: 5 a. After award of Contract 6 b. Under the conditions stated herein 7 2. Submit 3 copies of each written request for substitution, including: 8 a. Documentation 9 1) Complete data substantiating compliance of proposed substitution with 10 Contract Documents 11 2) Data relating to changes in construction schedule, when a reduction is 12 proposed 13 3) Data relating to changes in cost 14 b. For products 15 1) Product identification 16 a) Manufacturer's name 17 b) Telephone number and representative contact name 18 c) Specification Section or Drawing reference of originally specified 19 product, including discrete name or tag number assigned to original 20 product in the Contract Documents 21 2) Manufacturer's literature clearly marked to show compliance of proposed 22 product with Contract Documents 23 3) Itemized comparison of original and proposed product addressing product 24 characteristics including, but not necessarily limited to: 25 a) Size 26 b) Composition or materials of construction 27 c) Weight 28 d) Electrical or mechanical requirements 29 4) Product experience 30 a) Location of past projects utilizing product 31 b) Name and telephone number of persons associated with referenced 32 projects knowledgeable concerning proposed product 33 c) Available field data and reports associated with proposed product 34 5) Samples 35 a) Provide at request of City. 36 b) Samples become the property of the City. 37 c. For construction methods: 38 1) Detailed description of proposed method 39 2) Illustration drawings 40 C. Approval or Rejection 41 1. Written approval or rejection of substitution given by the City 42 2. City reserves the right to require proposed product to comply with color and pattern 43 of specified product if necessary to secure design intent. 44 3. In the event the substitution is approved, if a reduction in cost or time results, it will 45 be documented by Change Order. 46 01 25 00 - 3 DAP SUBSTITUTION PROCEDURES Page 3 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised August 30, 2013 4. Substitution will be rejected if: 1 a. Submittal is not through the Contractor with his stamp of approval 2 b. Request is not made in accordance with this Specification Section 3 c. In the Developer’s opinion, acceptance will require substantial revision of the 4 original design 5 d. In the City’s or Developer’s opinion, substitution will not perform adequately 6 the function consistent with the design intent 7 1.6 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS [NOT USED] 8 1.7 CLOSEOUT SUBMITTALS [NOT USED] 9 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 10 1.9 QUALITY ASSURANCE 11 A. In making request for substitution or in using an approved product, the Contractor 12 represents that the Contractor: 13 1. Has investigated proposed product, and has determined that it is adequate or 14 superior in all respects to that specified, and that it will perform function for which it 15 is intended 16 2. Will provide same guarantee for substitute item as for product specified 17 3. Will coordinate installation of accepted substitution into Work, to include building 18 modifications if necessary, making such changes as may be required for Work to be 19 complete in all respects 20 4. Waives all claims for additional costs related to substitution which subsequently 21 arise 22 1.10 DELIVERY, STORAGE, AND HANDLING [NOT USED] 23 1.11 FIELD [SITE] CONDITIONS [NOT USED] 24 1.12 WARRANTY [NOT USED] 25 PART 2 - PRODUCTS [NOT USED] 26 PART 3 - EXECUTION [NOT USED] 27 END OF SECTION 28 29 Revision Log DATE NAME SUMMARY OF CHANGE 30 01 25 00 - 4 DAP SUBSTITUTION PROCEDURES Page 4 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised August 30, 2013 EXHIBIT A 1 REQUEST FOR SUBSTITUTION FORM: 2 3 TO: 4 PROJECT: DATE: 5 We hereby submit for your consideration the following product instead of the specified item for 6 the above project: 7 SECTION PARAGRAPH SPECIFIED ITEM 8 9 10 Proposed Substitution: 11 Reason for Substitution: 12 Include complete information on changes to Drawings and/or Specifications which proposed 13 substitution will require for its proper installation. 14 15 Fill in Blanks Below: 16 A. Will the undersigned contractor pay for changes to the building design, including engineering 17 and detailing costs caused by the requested substitution? 18 19 20 B. What effect does substitution have on other trades? 21 22 23 C. Differences between proposed substitution and specified item? 24 25 26 D. Differences in product cost or product delivery time? 27 28 29 E. Manufacturer's guarantees of the proposed and specified items are: 30 31 Equal Better (explain on attachment) 32 The undersigned states that the function, appearance and quality are equivalent or superior to the 33 specified item. 34 Submitted By: For Use by City 35 36 Signature Recommended Recommended 37 as noted 38 39 Firm Not recommended Received late 40 Address By 41 Date 42 Date Remarks 43 Telephone 44 45 For Use by City: 46 47 Approved Rejected 48 City Date 49 01 31 19 - 1 DAP PRECONSTRUCTION MEETING Page 1 of 3 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised August 30, 2013 SECTION 01 31 19 1 PRECONSTRUCTION MEETING 2 PART 1 - GENERAL 3 1.1 SUMMARY 4 A. Section Includes: 5 1. Provisions for the preconstruction meeting to be held prior to the start of Work to 6 clarify construction contract administration procedures 7 B. Deviations from this City of Fort Worth Standard Specification 8 1. No construction schedule required unless requested by the City. 9 C. Related Specification Sections include, but are not necessarily limited to: 10 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 11 2. Division 1 – General Requirements 12 1.2 PRICE AND PAYMENT PROCEDURES 13 A. Measurement and Payment 14 1. Work associated with this Item is considered subsidiary to the various items bid. 15 No separate payment will be allowed for this Item. 16 1.3 REFERENCES [NOT USED] 17 1.4 ADMINISTRATIVE REQUIREMENTS 18 A. Coordination 19 1. Attend preconstruction meeting. 20 2. Representatives of Contractor, subcontractors and suppliers attending meetings 21 shall be qualified and authorized to act on behalf of the entity each represents. 22 3. Meeting administered by City may be tape recorded. 23 a. If recorded, tapes will be used to prepare minutes and retained by City for 24 future reference. 25 B. Preconstruction Meeting 26 1. A preconstruction meeting will be held within 14 days after the delivery of the 27 distribution package to the City. 28 a. The meeting will be scheduled and administered by the City. 29 2. The Project Representative will preside at the meeting, prepare the notes of the 30 meeting and distribute copies of same to all participants who so request by fully 31 completing the attendance form to be circulated at the beginning of the meeting. 32 3. Attendance shall include: 33 a. Developer and Consultant 34 b. Contractor's project manager 35 c. Contractor's superintendent 36 d. Any subcontractor or supplier representatives whom the Contractor may desire 37 to invite or the City may request 38 01 31 19 - 2 DAP PRECONSTRUCTION MEETING Page 2 of 3 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised August 30, 2013 e. Other City representatives 1 f. Others as appropriate 2 4. Preliminary Agenda may include: 3 a. Introduction of Project Personnel 4 b. General Description of Project 5 c. Status of right-of-way, utility clearances, easements or other pertinent permits 6 d. Contractor’s work plan and schedule 7 e. Contract Time 8 f. Notice to Proceed 9 g. Construction Staking 10 h. Progress Payments 11 i. Extra Work and Change Order Procedures 12 j. Field Orders 13 k. Disposal Site Letter for Waste Material 14 l. Insurance Renewals 15 m. Payroll Certification 16 n. Material Certifications and Quality Control Testing 17 o. Public Safety and Convenience 18 p. Documentation of Pre-Construction Conditions 19 q. Weekend Work Notification 20 r. Legal Holidays 21 s. Trench Safety Plans 22 t. Confined Space Entry Standards 23 u. Coordination with the City’s representative for operations of existing water 24 systems 25 v. Storm Water Pollution Prevention Plan 26 w. Coordination with other Contractors 27 x. Early Warning System 28 y. Contractor Evaluation 29 z. Special Conditions applicable to the project 30 aa. Damages Claims 31 bb. Submittal Procedures 32 cc. Substitution Procedures 33 dd. Correspondence Routing 34 ee. Record Drawings 35 ff. Temporary construction facilities 36 gg. MBE/SBE procedures 37 hh. Final Acceptance 38 ii. Final Payment 39 jj. Questions or Comments 40 01 31 19 - 3 DAP PRECONSTRUCTION MEETING Page 3 of 3 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised August 30, 2013 1.5 SUBMITTALS [NOT USED] 1 1.6 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS [NOT USED] 2 1.7 CLOSEOUT SUBMITTALS [NOT USED] 3 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 4 1.9 QUALITY ASSURANCE [NOT USED] 5 1.10 DELIVERY, STORAGE, AND HANDLING [NOT USED] 6 1.11 FIELD [SITE] CONDITIONS [NOT USED] 7 1.12 WARRANTY [NOT USED] 8 PART 2 - PRODUCTS [NOT USED] 9 PART 3 - EXECUTION [NOT USED] 10 END OF SECTION 11 12 Revision Log DATE NAME SUMMARY OF CHANGE 13 01 32 33 - 1 DAP PRECONSTRUCTION VIDEO Page 1 of 2 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised August 30, 2013 SECTION 01 32 33 1 PRECONSTRUCTION VIDEO 2 PART 1 - GENERAL 3 1.1 SUMMARY 4 A. Section Includes: 5 1. Administrative and procedural requirements for: 6 a. Preconstruction Videos 7 B. Deviations from this City of Fort Worth Standard Specification 8 1. Though not mandatory, it is highly recommended on infill developer projects. 9 C. Related Specification Sections include, but are not necessarily limited to: 10 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 11 2. Division 1 – General Requirements 12 1.2 PRICE AND PAYMENT PROCEDURES 13 A. Measurement and Payment 14 1. Work associated with this Item is considered subsidiary to the various items bid. 15 No separate payment will be allowed for this Item. 16 1.3 REFERENCES [NOT USED] 17 1.4 ADMINISTRATIVE REQUIREMENTS 18 A. Preconstruction Video 19 1. Produce a preconstruction video of the site/alignment, including all areas in the 20 vicinity of and to be affected by construction. 21 a. Provide digital copy of video upon request by the City. 22 2. Retain a copy of the preconstruction video until the end of the maintenance surety 23 period. 24 1.5 SUBMITTALS [NOT USED] 25 1.6 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS [NOT USED] 26 1.7 CLOSEOUT SUBMITTALS [NOT USED] 27 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 28 1.9 QUALITY ASSURANCE [NOT USED] 29 1.10 DELIVERY, STORAGE, AND HANDLING [NOT USED] 30 1.11 FIELD [SITE] CONDITIONS [NOT USED] 31 1.12 WARRANTY [NOT USED] 32 PART 2 - PRODUCTS [NOT USED] 33 01 32 33 - 2 DAP PRECONSTRUCTION VIDEO Page 2 of 2 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised August 30, 2013 PART 3 - EXECUTION [NOT USED] 1 END OF SECTION 2 3 Revision Log DATE NAME SUMMARY OF CHANGE 4 01 33 00 - 1 DAP SUBMITTALS Page 1 of 8 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised August 30, 2013 SECTION 01 33 00 1 DAP SUBMITTALS 2 PART 1 - GENERAL 3 1.1 SUMMARY 4 A. Section Includes: 5 1. General methods and requirements of submissions applicable to the following 6 Work-related submittals: 7 a. Shop Drawings 8 b. Product Data (including Standard Product List submittals) 9 c. Samples 10 d. Mock Ups 11 B. Deviations from this City of Fort Worth Standard Specification 12 1. None. 13 C. Related Specification Sections include, but are not necessarily limited to: 14 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 15 2. Division 1 – General Requirements 16 1.2 PRICE AND PAYMENT PROCEDURES 17 A. Measurement and Payment 18 1. Work associated with this Item is considered subsidiary to the various items bid. 19 No separate payment will be allowed for this Item. 20 1.3 REFERENCES [NOT USED] 21 1.4 ADMINISTRATIVE REQUIREMENTS 22 A. Coordination 23 1. Notify the City in writing, at the time of submittal, of any deviations in the 24 submittals from the requirements of the Contract Documents. 25 2. Coordination of Submittal Times 26 a. Prepare, prioritize and transmit each submittal sufficiently in advance of 27 performing the related Work or other applicable activities, or within the time 28 specified in the individual Work Sections, of the Specifications. 29 b. Contractor is responsible such that the installation will not be delayed by 30 processing times including, but not limited to: 31 a) Disapproval and resubmittal (if required) 32 b) Coordination with other submittals 33 c) Testing 34 d) Purchasing 35 e) Fabrication 36 f) Delivery 37 g) Similar sequenced activities 38 c. No extension of time will be authorized because of the Contractor's failure to 39 transmit submittals sufficiently in advance of the Work. 40 01 33 00 - 2 DAP SUBMITTALS Page 2 of 8 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised August 30, 2013 d. Make submittals promptly in accordance with approved schedule, and in such 1 sequence as to cause no delay in the Work or in the work of any other 2 contractor. 3 B. Submittal Numbering 4 1. When submitting shop drawings or samples, utilize a 9-character submittal cross-5 reference identification numbering system in the following manner: 6 a. Use the first 6 digits of the applicable Specification Section Number. 7 b. For the next 2 digits number use numbers 01-99 to sequentially number each 8 initial separate item or drawing submitted under each specific Section number. 9 c. Last use a letter, A-Z, indicating the resubmission of the same drawing (i.e. 10 A=2nd submission, B=3rd submission, C=4th submission, etc.). A typical 11 submittal number would be as follows: 12 13 03 30 00-08-B 14 15 1) 03 30 00 is the Specification Section for Concrete 16 2) 08 is the eighth initial submittal under this Specification Section 17 3) B is the third submission (second resubmission) of that particular shop 18 drawing 19 C. Contractor Certification 20 1. Review shop drawings, product data and samples, including those by 21 subcontractors, prior to submission to determine and verify the following: 22 a. Field measurements 23 b. Field construction criteria 24 c. Catalog numbers and similar data 25 d. Conformance with the Contract Documents 26 2. Provide each shop drawing, sample and product data submitted by the Contractor 27 with a Certification Statement affixed including: 28 a. The Contractor's Company name 29 b. Signature of submittal reviewer 30 c. Certification Statement 31 1) “By this submittal, I hereby represent that I have determined and verified 32 field measurements, field construction criteria, materials, dimensions, 33 catalog numbers and similar data and I have checked and coordinated each 34 item with other applicable approved shop drawings." 35 D. Submittal Format 36 1. Fold shop drawings larger than 8 ½ inches x 11 inches to 8 ½ inches x 11inches. 37 2. Bind shop drawings and product data sheets together. 38 3. Order 39 a. Cover Sheet 40 1) Description of Packet 41 2) Contractor Certification 42 b. List of items / Table of Contents 43 c. Product Data /Shop Drawings/Samples /Calculations 44 E. Submittal Content 45 1. The date of submission and the dates of any previous submissions 46 01 33 00 - 3 DAP SUBMITTALS Page 3 of 8 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised August 30, 2013 2. The Project title and number 1 3. Contractor identification 2 4. The names of: 3 a. Contractor 4 b. Supplier 5 c. Manufacturer 6 5. Identification of the product, with the Specification Section number, page and 7 paragraph(s) 8 6. Field dimensions, clearly identified as such 9 7. Relation to adjacent or critical features of the Work or materials 10 8. Applicable standards, such as ASTM or Federal Specification numbers 11 9. Identification by highlighting of deviations from Contract Documents 12 10. Identification by highlighting of revisions on resubmittals 13 11. An 8-inch x 3-inch blank space for Contractor and City stamps 14 F. Shop Drawings 15 1. As specified in individual Work Sections includes, but is not necessarily limited to: 16 a. Custom-prepared data such as fabrication and erection/installation (working) 17 drawings 18 b. Scheduled information 19 c. Setting diagrams 20 d. Actual shopwork manufacturing instructions 21 e. Custom templates 22 f. Special wiring diagrams 23 g. Coordination drawings 24 h. Individual system or equipment inspection and test reports including: 25 1) Performance curves and certifications 26 i. As applicable to the Work 27 2. Details 28 a. Relation of the various parts to the main members and lines of the structure 29 b. Where correct fabrication of the Work depends upon field measurements 30 1) Provide such measurements and note on the drawings prior to submitting 31 for approval. 32 G. Product Data 33 1. For submittals of product data for products included on the City’s Standard Product 34 List, clearly identify each item selected for use on the Project. 35 2. For submittals of product data for products not included on the City’s Standard 36 Product List, submittal data may include, but is not necessarily limited to: 37 a. Standard prepared data for manufactured products (sometimes referred to as 38 catalog data) 39 1) Such as the manufacturer's product specification and installation 40 instructions 41 2) Availability of colors and patterns 42 3) Manufacturer's printed statements of compliances and applicability 43 4) Roughing-in diagrams and templates 44 5) Catalog cuts 45 6) Product photographs 46 01 33 00 - 4 DAP SUBMITTALS Page 4 of 8 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised August 30, 2013 7) Standard wiring diagrams 1 8) Printed performance curves and operational-range diagrams 2 9) Production or quality control inspection and test reports and certifications 3 10) Mill reports 4 11) Product operating and maintenance instructions and recommended 5 spare-parts listing and printed product warranties 6 12) As applicable to the Work 7 H. Samples 8 1. As specified in individual Sections, include, but are not necessarily limited to: 9 a. Physical examples of the Work such as: 10 1) Sections of manufactured or fabricated Work 11 2) Small cuts or containers of materials 12 3) Complete units of repetitively used products color/texture/pattern swatches 13 and range sets 14 4) Specimens for coordination of visual effect 15 5) Graphic symbols and units of Work to be used by the City for independent 16 inspection and testing, as applicable to the Work 17 I. Do not start Work requiring a shop drawing, sample or product data nor any material to 18 be fabricated or installed prior to the approval or qualified approval of such item. 19 1. Fabrication performed, materials purchased or on-site construction accomplished 20 which does not conform to approved shop drawings and data is at the Contractor's 21 risk. 22 2. The City will not be liable for any expense or delay due to corrections or remedies 23 required to accomplish conformity. 24 3. Complete project Work, materials, fabrication, and installations in conformance 25 with approved shop drawings, applicable samples, and product data. 26 J. Submittal Distribution 27 1. Electronic Distribution 28 a. Confirm development of Project directory for electronic submittals to be 29 uploaded to City’s Buzzsaw site, or another external FTP site approved by the 30 City. 31 b. Shop Drawings 32 1) Upload submittal to designated project directory and notify appropriate 33 City representatives via email of submittal posting. 34 2) Hard Copies 35 a) 3 copies for all submittals 36 b) If Contractor requires more than 1 hard copy of Shop Drawings 37 returned, Contractor shall submit more than the number of copies listed 38 above. 39 c. Product Data 40 1) Upload submittal to designated project directory and notify appropriate 41 City representatives via email of submittal posting. 42 2) Hard Copies 43 a) 3 copies for all submittals 44 d. Samples 45 1) Distributed to the Project Representative 46 2. Hard Copy Distribution (if required in lieu of electronic distribution) 47 01 33 00 - 5 DAP SUBMITTALS Page 5 of 8 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised August 30, 2013 a. Shop Drawings 1 1) Distributed to the City 2 2) Copies 3 a) 8 copies for mechanical submittals 4 b) 7 copies for all other submittals 5 c) If Contractor requires more than 3 copies of Shop Drawings returned, 6 Contractor shall submit more than the number of copies listed above. 7 b. Product Data 8 1) Distributed to the City 9 2) Copies 10 a) 4 copies 11 c. Samples 12 1) Distributed to the Project Representative 13 2) Copies 14 a) Submit the number stated in the respective Specification Sections. 15 3. Distribute reproductions of approved shop drawings and copies of approved 16 product data and samples, where required, to the job site file and elsewhere as 17 directed by the City. 18 a. Provide number of copies as directed by the City but not exceeding the number 19 previously specified. 20 K. Submittal Review 21 1. The review of shop drawings, data and samples will be for general conformance 22 with the design concept and Contract Documents. This is not to be construed as: 23 a. Permitting any departure from the Contract requirements 24 b. Relieving the Contractor of responsibility for any errors, including details, 25 dimensions, and materials 26 c. Approving departures from details furnished by the City, except as otherwise 27 provided herein 28 2. The review and approval of shop drawings, samples or product data by the City 29 does not relieve the Contractor from his/her responsibility with regard to the 30 fulfillment of the terms of the Contract. 31 a. All risks of error and omission are assumed by the Contractor, and the City will 32 have no responsibility therefore. 33 3. The Contractor remains responsible for details and accuracy, for coordinating the 34 Work with all other associated work and trades, for selecting fabrication processes, 35 for techniques of assembly and for performing Work in a safe manner. 36 4. If the shop drawings, data or samples as submitted describe variations and show a 37 departure from the Contract requirements which City finds to be in the interest of 38 the City and to be so minor as not to involve a change in Contract Price or time for 39 performance, the City may return the reviewed drawings without noting an 40 exception. 41 5. Submittals will be returned to the Contractor under 1 of the following codes: 42 a. Code 1 43 1) "NO EXCEPTIONS TAKEN" is assigned when there are no notations or 44 comments on the submittal. 45 a) When returned under this code the Contractor may release the 46 equipment and/or material for manufacture. 47 b. Code 2 48 01 33 00 - 6 DAP SUBMITTALS Page 6 of 8 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised August 30, 2013 1) "EXCEPTIONS NOTED". This code is assigned when a confirmation of 1 the notations and comments IS NOT required by the Contractor. 2 a) The Contractor may release the equipment or material for manufacture; 3 however, all notations and comments must be incorporated into the 4 final product. 5 c. Code 3 6 1) "EXCEPTIONS NOTED/RESUBMIT". This combination of codes is 7 assigned when notations and comments are extensive enough to require a 8 resubmittal of the package. 9 a) The Contractor may release the equipment or material for manufacture; 10 however, all notations and comments must be incorporated into the 11 final product. 12 b) This resubmittal is to address all comments, omissions and 13 non-conforming items that were noted. 14 c) Resubmittal is to be received by the City within 15 Calendar Days of 15 the date of the City's transmittal requiring the resubmittal. 16 d. Code 4 17 1) "NOT APPROVED" is assigned when the submittal does not meet the 18 intent of the Contract Documents. 19 a) The Contractor must resubmit the entire package revised to bring the 20 submittal into conformance. 21 b) It may be necessary to resubmit using a different manufacturer/vendor 22 to meet the Contract Documents. 23 6. Resubmittals 24 a. Handled in the same manner as first submittals 25 1) Corrections other than requested by the City 26 2) Marked with revision triangle or other similar method 27 a) At Contractor’s risk if not marked 28 b. Submittals for each item will be reviewed no more than twice at the City’s 29 expense. 30 1) All subsequent reviews will be performed at times convenient to the City 31 and at the Contractor's expense, based on the City's or City 32 Representative’s then prevailing rates. 33 2) Provide Contractor reimbursement to the City within 30 Calendar Days for 34 all such fees invoiced by the City. 35 c. The need for more than 1 resubmission or any other delay in obtaining City's 36 review of submittals, will not entitle the Contractor to an extension of Contract 37 Time. 38 7. Partial Submittals 39 a. City reserves the right to not review submittals deemed partial, at the City’s 40 discretion. 41 b. Submittals deemed by the City to be not complete will be returned to the 42 Contractor, and will be considered "Not Approved" until resubmitted. 43 c. The City may at its option provide a list or mark the submittal directing the 44 Contractor to the areas that are incomplete. 45 8. If the Contractor considers any correction indicated on the shop drawings to 46 constitute a change to the Contract Documents, then written notice must be 47 provided thereof to the Developer at least 7 Calendar Days prior to release for 48 manufacture. 49 01 33 00 - 7 DAP SUBMITTALS Page 7 of 8 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised August 30, 2013 9. When the shop drawings have been completed to the satisfaction of the City, the 1 Contractor may carry out the construction in accordance therewith and no further 2 changes therein except upon written instructions from the City. 3 10. Each submittal, appropriately coded, will be returned within 30 Calendar Days 4 following receipt of submittal by the City. 5 L. Mock ups 6 1. Mock Up units as specified in individual Sections, include, but are not necessarily 7 limited to, complete units of the standard of acceptance for that type of Work to be 8 used on the Project. Remove at the completion of the Work or when directed. 9 M. Qualifications 10 1. If specifically required in other Sections of these Specifications, submit a P.E. 11 Certification for each item required. 12 N. Request for Information (RFI) 13 1. Contractor Request for additional information 14 a. Clarification or interpretation of the contract documents 15 b. When the Contractor believes there is a conflict between Contract Documents 16 c. When the Contractor believes there is a conflict between the Drawings and 17 Specifications 18 1) Identify the conflict and request clarification 19 2. Sufficient information shall be attached to permit a written response without further 20 information. 21 22 23 24 25 1.5 SUBMITTALS [NOT USED] 26 1.6 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS [NOT USED] 27 1.7 CLOSEOUT SUBMITTALS [NOT USED] 28 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 29 1.9 QUALITY ASSURANCE [NOT USED] 30 1.10 DELIVERY, STORAGE, AND HANDLING [NOT USED] 31 1.11 FIELD [SITE] CONDITIONS [NOT USED] 32 1.12 WARRANTY [NOT USED] 33 01 33 00 - 8 DAP SUBMITTALS Page 8 of 8 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised August 30, 2013 PART 2 - PRODUCTS [NOT USED] 1 PART 3 - EXECUTION [NOT USED] 2 END OF SECTION 3 4 Revision Log DATE NAME SUMMARY OF CHANGE 12/20/2012 D. Johnson 1.4.K.8. Working Days modified to Calendar Days 5 01 35 13 - 1 DAP SPECIAL PROJECT PROCEDURES Page 1 of 7 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised August, 30, 2013 SECTION 01 35 13 1 SPECIAL PROJECT PROCEDURES 2 PART 1 - GENERAL 3 1.1 SUMMARY 4 A. Section Includes: 5 1. The procedures for special project circumstances that includes, but is not limited to: 6 a. Coordination with the Texas Department of Transportation 7 b. Work near High Voltage Lines 8 c. Confined Space Entry Program 9 d. Air Pollution Watch Days 10 e. Use of Explosives, Drop Weight, Etc. 11 f. Water Department Notification 12 g. Public Notification Prior to Beginning Construction 13 h. Coordination with United States Army Corps of Engineers 14 i. Coordination within Railroad permits areas 15 j. Dust Control 16 k. Employee Parking 17 B. Deviations from this City of Fort Worth Standard Specification 18 1. None. 19 C. Related Specification Sections include, but are not necessarily limited to: 20 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 21 2. Division 1 – General Requirements 22 3. Section 33 12 25 – Connection to Existing Water Mains 23 24 1.2 REFERENCES 25 A. Reference Standards 26 1. Reference standards cited in this Specification refer to the current reference 27 standard published at the time of the latest revision date logged at the end of this 28 Specification, unless a date is specifically cited. 29 2. Health and Safety Code, Title 9. Safety, Subtitle A. Public Safety, Chapter 752. 30 High Voltage Overhead Lines. 31 3. North Central Texas Council of Governments (NCTCOG) – Clean Construction 32 Specification 33 1.3 ADMINISTRATIVE REQUIREMENTS 34 A. Coordination with the Texas Department of Transportation 35 1. When work in the right-of-way which is under the jurisdiction of the Texas 36 Department of Transportation (TxDOT): 37 a. Notify the Texas Department of Transportation prior to commencing any work 38 therein in accordance with the provisions of the permit 39 01 35 13 - 2 DAP SPECIAL PROJECT PROCEDURES Page 2 of 7 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised August, 30, 2013 b. All work performed in the TxDOT right-of-way shall be performed in 1 compliance with and subject to approval from the Texas Department of 2 Transportation 3 B. Work near High Voltage Lines 4 1. Regulatory Requirements 5 a. All Work near High Voltage Lines (more than 600 volts measured between 6 conductors or between a conductor and the ground) shall be in accordance with 7 Health and Safety Code, Title 9, Subtitle A, Chapter 752. 8 2. Warning sign 9 a. Provide sign of sufficient size meeting all OSHA requirements. 10 3. Equipment operating within 10 feet of high voltage lines will require the following 11 safety features 12 a. Insulating cage-type of guard about the boom or arm 13 b. Insulator links on the lift hook connections for back hoes or dippers 14 c. Equipment must meet the safety requirements as set forth by OSHA and the 15 safety requirements of the owner of the high voltage lines 16 4. Work within 6 feet of high voltage electric lines 17 a. Notification shall be given to: 18 1) The power company (example: ONCOR) 19 a) Maintain an accurate log of all such calls to power company and record 20 action taken in each case. 21 b. Coordination with power company 22 1) After notification coordinate with the power company to: 23 a) Erect temporary mechanical barriers, de-energize the lines, or raise or 24 lower the lines 25 c. No personnel may work within 6 feet of a high voltage line before the above 26 requirements have been met. 27 C. Confined Space Entry Program 28 1. Provide and follow approved Confined Space Entry Program in accordance with 29 OSHA requirements. 30 2. Confined Spaces include: 31 a. Manholes 32 b. All other confined spaces in accordance with OSHA’s Permit Required for 33 Confined Spaces 34 D. Use of Explosives, Drop Weight, Etc. 35 1. When Contract Documents permit on the project the following will apply: 36 a. Public Notification 37 1) Submit notice to City and proof of adequate insurance coverage, 24 hours 38 prior to commencing. 39 2) Minimum 24 hour public notification in accordance with Section 01 31 13 40 E. Water Department Coordination 41 1. During the construction of this project, it will be necessary to deactivate, for a 42 period of time, existing lines. The Contractor shall be required to coordinate with 43 the Water Department to determine the best times for deactivating and activating 44 those lines. 45 01 35 13 - 3 DAP SPECIAL PROJECT PROCEDURES Page 3 of 7 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised August, 30, 2013 2. Coordinate any event that will require connecting to or the operation of an existing 1 City water line system with the City’s representative. 2 a. Coordination shall be in accordance with Section 33 12 25. 3 b. If needed, obtain a hydrant water meter from the Water Department for use 4 during the life of named project. 5 c. In the event that a water valve on an existing live system be turned off and on 6 to accommodate the construction of the project is required, coordinate this 7 activity through the appropriate City representative. 8 1) Do not operate water line valves of existing water system. 9 a) Failure to comply will render the Contractor in violation of Texas Penal 10 Code Title 7, Chapter 28.03 (Criminal Mischief) and the Contractor 11 will be prosecuted to the full extent of the law. 12 b) In addition, the Contractor will assume all liabilities and 13 responsibilities as a result of these actions. 14 F. Public Notification Prior to Beginning Construction 15 1. Prior to beginning construction on any block in the project, on a block by block 16 basis, prepare and deliver a notice or flyer of the pending construction to the front 17 door of each residence or business that will be impacted by construction. The notice 18 shall be prepared as follows: 19 a. Post notice or flyer 7 days prior to beginning any construction activity on each 20 block in the project area. 21 1) Prepare flyer on the Contractor’s letterhead and include the following 22 information: 23 a) Name of Project 24 b) City Project No (CPN) 25 c) Scope of Project (i.e. type of construction activity) 26 d) Actual construction duration within the block 27 e) Name of the contractor’s foreman and phone number 28 f) Name of the City’s inspector and phone number 29 g) City’s after-hours phone number 30 2) A sample of the ‘pre-construction notification’ flyer is attached as Exhibit 31 A. 32 3) Submit schedule showing the construction start and finish time for each 33 block of the project to the inspector. 34 4) Deliver flyer to the City Inspector for review prior to distribution. 35 b. No construction will be allowed to begin on any block until the flyer is 36 delivered to all residents of the block. 37 G. Public Notification of Temporary Water Service Interruption during Construction 38 1. In the event it becomes necessary to temporarily shut down water service to 39 residents or businesses during construction, prepare and deliver a notice or flyer of 40 the pending interruption to the front door of each affected resident. 41 2. Prepared notice as follows: 42 a. The notification or flyer shall be posted 24 hours prior to the temporary 43 interruption. 44 b. Prepare flyer on the contractor’s letterhead and include the following 45 information: 46 1) Name of the project 47 2) City Project Number 48 01 35 13 - 4 DAP SPECIAL PROJECT PROCEDURES Page 4 of 7 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised August, 30, 2013 3) Date of the interruption of service 1 4) Period the interruption will take place 2 5) Name of the contractor’s foreman and phone number 3 6) Name of the City’s inspector and phone number 4 c. A sample of the temporary water service interruption notification is attached as 5 Exhibit B. 6 d. Deliver a copy of the temporary interruption notification to the City inspector 7 for review prior to being distributed. 8 e. No interruption of water service can occur until the flyer has been delivered to 9 all affected residents and businesses. 10 f. Electronic versions of the sample flyers can be obtained from the Project 11 Construction Inspector. 12 H. Coordination with United States Army Corps of Engineers (USACE) 13 1. At locations in the Project where construction activities occur in areas where 14 USACE permits are required, meet all requirements set forth in each designated 15 permit. 16 I. Coordination within Railroad Permit Areas 17 1. At locations in the project where construction activities occur in areas where 18 railroad permits are required, meet all requirements set forth in each designated 19 railroad permit. This includes, but is not limited to, provisions for: 20 a. Flagmen 21 b. Inspectors 22 c. Safety training 23 d. Additional insurance 24 e. Insurance certificates 25 f. Other employees required to protect the right-of-way and property of the 26 Railroad Company from damage arising out of and/or from the construction of 27 the project. Proper utility clearance procedures shall be used in accordance 28 with the permit guidelines. 29 2. Obtain any supplemental information needed to comply with the railroad’s 30 requirements. 31 J. Dust Control 32 1. Use acceptable measures to control dust at the Site. 33 a. If water is used to control dust, capture and properly dispose of waste water. 34 b. If wet saw cutting is performed, capture and properly dispose of slurry. 35 K. Employee Parking 36 1. Provide parking for employees at locations approved by the City. 37 01 35 13 - 5 DAP SPECIAL PROJECT PROCEDURES Page 5 of 7 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised August, 30, 2013 1.4 SUBMITTALS [NOT USED] 1 1.5 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS [NOT USED] 2 1.6 CLOSEOUT SUBMITTALS [NOT USED] 3 1.7 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 4 1.8 QUALITY ASSURANCE [NOT USED] 5 1.9 DELIVERY, STORAGE, AND HANDLING [NOT USED] 6 1.10 FIELD [SITE] CONDITIONS [NOT USED] 7 1.11 WARRANTY [NOT USED] 8 PART 2 - PRODUCTS [NOT USED] 9 PART 3 - EXECUTION [NOT USED] 10 END OF SECTION 11 12 Revision Log DATE NAME SUMMARY OF CHANGE 8/31/2012 D. Johnson 1.3.B – Added requirement of compliance with Health and Safety Code, Title 9. Safety, Subtitle A. Public Safety, Chapter 752. High Voltage Overhead Lines. 13 01 35 13 - 6 DAP SPECIAL PROJECT PROCEDURES Page 6 of 7 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised August, 30, 2013 EXHIBIT A 1 (To be printed on Contractor’s Letterhead) 2 3 4 5 Date: 6 7 CPN No.: 8 Project Name: 9 Mapsco Location: 10 Limits of Construction: 11 12 13 14 15 16 THIS IS TO INFORM YOU THAT UNDER A CONTRACT WITH THE CITY OF FORT 17 WORTH, OUR COMPANY WILL WORK ON UTILITY LINES ON OR AROUND YOUR 18 PROPERTY. 19 20 CONSTRUCTION WILL BEGIN APPROXIMATELY SEVEN DAYS FROM THE DATE 21 OF THIS NOTICE. 22 23 IF YOU HAVE QUESTIONS ABOUT ACCESS, SECURITY, SAFETY OR ANY OTHER 24 ISSUE, PLEASE CALL: 25 26 27 Mr. <CONTRACTOR’S SUPERINTENDENT> AT <TELEPHONE NO.> 28 29 OR 30 31 Mr. <CITY INSPECTOR> AT < TELEPHONE NO.> 32 33 AFTER 4:30 PM OR ON WEEKENDS, PLEASE CALL (817) 392 8306 34 35 PLEASE KEEP THIS FLYER HANDY WHEN YOU CALL 36 37 01 35 13 - 7 DAP SPECIAL PROJECT PROCEDURES Page 7 of 7 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised August, 30, 2013 EXHIBIT B 1 2 3 4 01 45 23 - 1 DAP TESTING AND INSPECTION SERVICES Page 1 of 2 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised August 30, 2013 SECTION 01 45 23 1 TESTING AND INSPECTION SERVICES 2 PART 1 - GENERAL 3 1.1 SUMMARY 4 A. Section Includes: 5 1. Testing and inspection services procedures and coordination 6 B. Deviations from this City of Fort Worth Standard Specification 7 1. None. 8 C. Related Specification Sections include, but are not necessarily limited to: 9 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 10 2. Division 1 – General Requirements 11 1.2 PRICE AND PAYMENT PROCEDURES 12 A. Measurement and Payment 13 1. Work associated with this Item is considered subsidiary to the various Items bid. 14 No separate payment will be allowed for this Item. 15 a. Contractor is responsible for performing, coordinating, and payment of all 16 Quality Control testing. 17 b. City is responsible for performing and payment for first set of Quality 18 Assurance testing. 19 1) If the first Quality Assurance test performed by the City fails, the 20 Contractor is responsible for payment of subsequent Quality Assurance 21 testing until a passing test occurs. 22 a) Final acceptance will not be issued by City until all required payments 23 for testing by Contractor have been paid in full. 24 1.3 REFERENCES [NOT USED] 25 1.4 ADMINISTRATIVE REQUIREMENTS 26 A. Testing 27 1. Complete testing in accordance with the Contract Documents. 28 2. Coordination 29 a. When testing is required to be performed by the City, notify City, sufficiently 30 in advance, when testing is needed. 31 b. When testing is required to be completed by the Contractor, notify City, 32 sufficiently in advance, that testing will be performed. 33 3. Distribution of Testing Reports 34 a. Electronic Distribution 35 1) Confirm development of Project directory for electronic submittals to be 36 uploaded to City’s Buzzsaw site, or another form of distribution approved 37 by the City. 38 01 45 23 - 2 DAP TESTING AND INSPECTION SERVICES Page 2 of 2 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised August 30, 2013 2) Upload test reports to designated project directory and notify appropriate 1 City representatives via email of submittal posting. 2 3) Hard Copies 3 a) 1 copy for all submittals submitted to the Project Representative 4 b. Hard Copy Distribution (if required in lieu of electronic distribution) 5 1) Tests performed by City 6 a) Distribute 1 hard copy to the Contractor 7 2) Tests performed by the Contractor 8 a) Distribute 3 hard copies to City’s Project Representative 9 4. Provide City’s Project Representative with trip tickets for each delivered load of 10 Concrete or Lime material including the following information: 11 a. Name of pit 12 b. Date of delivery 13 c. Material delivered 14 B. Inspection 15 1. Inspection or lack of inspection does not relieve the Contractor from obligation to 16 perform work in accordance with the Contract Documents. 17 1.5 SUBMITTALS [NOT USED] 18 1.6 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS [NOT USED] 19 1.7 CLOSEOUT SUBMITTALS [NOT USED] 20 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 21 1.9 QUALITY ASSURANCE [NOT USED] 22 1.10 DELIVERY, STORAGE, AND HANDLING [NOT USED] 23 1.11 FIELD [SITE] CONDITIONS [NOT USED] 24 1.12 WARRANTY [NOT USED] 25 PART 2 - PRODUCTS [NOT USED] 26 PART 3 - EXECUTION [NOT USED] 27 END OF SECTION 28 29 Revision Log DATE NAME SUMMARY OF CHANGE 30 01 50 00 - 1 DAP TEMPORARY FACILITIES AND CONTROLS Page 1 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised JULY 1, 2011 SECTION 01 50 00 1 TEMPORARY FACILITIES AND CONTROLS 2 PART 1 - GENERAL 3 1.1 SUMMARY 4 A. Section Includes: 5 1. Provide temporary facilities and controls needed for the Work including, but not 6 necessarily limited to: 7 a. Temporary utilities 8 b. Sanitary facilities 9 c. Storage Sheds and Buildings 10 d. Dust control 11 e. Temporary fencing of the construction site 12 B. Deviations from this City of Fort Worth Standard Specification 13 1. None. 14 C. Related Specification Sections include, but are not necessarily limited to: 15 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 16 2. Division 1 – General Requirements 17 1.2 PRICE AND PAYMENT PROCEDURES 18 A. Measurement and Payment 19 1. Work associated with this Item is considered subsidiary to the various Items bid. 20 No separate payment will be allowed for this Item. 21 1.3 REFERENCES [NOT USED] 22 1.4 ADMINISTRATIVE REQUIREMENTS 23 A. Temporary Utilities 24 1. Obtaining Temporary Service 25 a. Make arrangements with utility service companies for temporary services. 26 b. Abide by rules and regulations of utility service companies or authorities 27 having jurisdiction. 28 c. Be responsible for utility service costs until Work is approved for Final 29 Acceptance. 30 1) Included are fuel, power, light, heat and other utility services necessary for 31 execution, completion, testing and initial operation of Work. 32 2. Water 33 a. Contractor to provide water required for and in connection with Work to be 34 performed and for specified tests of piping, equipment, devices or other use as 35 required for the completion of the Work. 36 b. Provide and maintain adequate supply of potable water for domestic 37 consumption by Contractor personnel and City’s Project Representatives. 38 c. Coordination 39 1) Contact City 1 week before water for construction is desired 40 01 50 00 - 2 DAP TEMPORARY FACILITIES AND CONTROLS Page 2 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised JULY 1, 2011 d. Contractor Payment for Construction Water 1 1) Obtain construction water meter from City for payment as billed by City’s 2 established rates. 3 3. Electricity and Lighting 4 a. Provide and pay for electric powered service as required for Work, including 5 testing of Work. 6 1) Provide power for lighting, operation of equipment, or other use. 7 b. Electric power service includes temporary power service or generator to 8 maintain operations during scheduled shutdown. 9 4. Telephone 10 a. Provide emergency telephone service at Site for use by Contractor personnel 11 and others performing work or furnishing services at Site. 12 5. Temporary Heat and Ventilation 13 a. Provide temporary heat as necessary for protection or completion of Work. 14 b. Provide temporary heat and ventilation to assure safe working conditions. 15 B. Sanitary Facilities 16 1. Provide and maintain sanitary facilities for persons on Site. 17 a. Comply with regulations of State and local departments of health. 18 2. Enforce use of sanitary facilities by construction personnel at job site. 19 a. Enclose and anchor sanitary facilities. 20 b. No discharge will be allowed from these facilities. 21 c. Collect and store sewage and waste so as not to cause nuisance or health 22 problem. 23 d. Haul sewage and waste off-site at no less than weekly intervals and properly 24 dispose in accordance with applicable regulation. 25 3. Locate facilities near Work Site and keep clean and maintained throughout Project. 26 4. Remove facilities at completion of Project 27 C. Storage Sheds and Buildings 28 1. Provide adequately ventilated, watertight, weatherproof storage facilities with floor 29 above ground level for materials and equipment susceptible to weather damage. 30 2. Storage of materials not susceptible to weather damage may be on blocks off 31 ground. 32 3. Store materials in a neat and orderly manner. 33 a. Place materials and equipment to permit easy access for identification, 34 inspection and inventory. 35 4. Equip building with lockable doors and lighting, and provide electrical service for 36 equipment space heaters and heating or ventilation as necessary to provide storage 37 environments acceptable to specified manufacturers. 38 5. Fill and grade site for temporary structures to provide drainage away from 39 temporary and existing buildings. 40 6. Remove building from site prior to Final Acceptance. 41 D. Temporary Fencing 42 1. Provide and maintain for the duration or construction when required in contract 43 documents 44 E. Dust Control 45 01 50 00 - 3 DAP TEMPORARY FACILITIES AND CONTROLS Page 3 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised JULY 1, 2011 1. Contractor is responsible for maintaining dust control through the duration of the 1 project. 2 a. Contractor remains on-call at all times 3 b. Must respond in a timely manner 4 F. Temporary Protection of Construction 5 1. Contractor or subcontractors are responsible for protecting Work from damage due 6 to weather. 7 1.5 SUBMITTALS [NOT USED] 8 1.6 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS [NOT USED] 9 1.7 CLOSEOUT SUBMITTALS [NOT USED] 10 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 11 1.9 QUALITY ASSURANCE [NOT USED] 12 1.10 DELIVERY, STORAGE, AND HANDLING [NOT USED] 13 1.11 FIELD [SITE] CONDITIONS [NOT USED] 14 1.12 WARRANTY [NOT USED] 15 PART 2 - PRODUCTS [NOT USED] 16 PART 3 - EXECUTION [NOT USED] 17 3.1 INSTALLERS [NOT USED] 18 3.2 EXAMINATION [NOT USED] 19 3.3 PREPARATION [NOT USED] 20 3.4 INSTALLATION 21 A. Temporary Facilities 22 1. Maintain all temporary facilities for duration of construction activities as needed. 23 3.5 [REPAIR] / [RESTORATION] 24 3.6 RE-INSTALLATION 25 3.7 FIELD [OR] SITE QUALITY CONTROL [NOT USED] 26 3.8 SYSTEM STARTUP [NOT USED] 27 3.9 ADJUSTING [NOT USED] 28 3.10 CLEANING [NOT USED] 29 3.11 CLOSEOUT ACTIVITIES 30 A. Temporary Facilities 31 01 50 00 - 4 DAP TEMPORARY FACILITIES AND CONTROLS Page 4 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised JULY 1, 2011 1. Remove all temporary facilities and restore area after completion of the Work, to a 1 condition equal to or better than prior to start of Work. 2 3.12 PROTECTION [NOT USED] 3 3.13 MAINTENANCE [NOT USED] 4 3.14 ATTACHMENTS [NOT USED] 5 END OF SECTION 6 7 Revision Log DATE NAME SUMMARY OF CHANGE 8 01 55 26 - 1 DAP STREET USE PERMIT AND MODIFICATIONS TO TRAFFIC CONTROL Page 1 of 3 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised July 1, 2011 SECTION 01 55 26 1 STREET USE PERMIT AND MODIFICATIONS TO TRAFFIC CONTROL 2 PART 1 - GENERAL 3 1.1 SUMMARY 4 A. Section Includes: 5 1. Administrative procedures for: 6 a. Street Use Permit 7 b. Modification of approved traffic control 8 c. Removal of Street Signs 9 B. Deviations from this City of Fort Worth Standard Specification 10 1. None. 11 C. Related Specification Sections include, but are not necessarily limited to: 12 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 13 2. Division 1 – General Requirements 14 3. Section 34 71 13 – Traffic Control 15 1.2 PRICE AND PAYMENT PROCEDURES 16 A. Measurement and Payment 17 1. Work associated with this Item is considered subsidiary to the various Items bid. 18 No separate payment will be allowed for this Item. 19 1.3 REFERENCES 20 A. Reference Standards 21 1. Reference standards cited in this specification refer to the current reference standard 22 published at the time of the latest revision date logged at the end of this 23 specification, unless a date is specifically cited. 24 2. Texas Manual on Uniform Traffic Control Devices (TMUTCD). 25 1.4 ADMINISTRATIVE REQUIREMENTS 26 A. Traffic Control 27 1. General 28 a. When traffic control plans are included in the Drawings, provide Traffic 29 Control in accordance with Drawings and Section 34 71 13. 30 b. When traffic control plans are not included in the Drawings, prepare traffic 31 control plans in accordance with Section 34 71 13 and submit to City for 32 review. 33 1) Allow minimum 10 working days for review of proposed Traffic Control. 34 B. Street Use Permit 35 1. Prior to installation of Traffic Control, a City Street Use Permit is required. 36 a. To obtain Street Use Permit, submit Traffic Control Plans to City 37 Transportation and Public Works Department. 38 01 55 26 - 2 DAP STREET USE PERMIT AND MODIFICATIONS TO TRAFFIC CONTROL Page 2 of 3 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised July 1, 2011 1) Allow a minimum of 5 working days for permit review. 1 2) Contractor’s responsibility to coordinate review of Traffic Control plans for 2 Street Use Permit, such that construction is not delayed. 3 C. Modification to Approved Traffic Control 4 1. Prior to installation traffic control: 5 a. Submit revised traffic control plans to City Department Transportation and 6 Public Works Department. 7 1) Revise Traffic Control plans in accordance with Section 34 71 13. 8 2) Allow minimum 5 working days for review of revised Traffic Control. 9 3) It is the Contractor’s responsibility to coordinate review of Traffic Control 10 plans for Street Use Permit, such that construction is not delayed. 11 D. Removal of Street Sign 12 1. If it is determined that a street sign must be removed for construction, then contact 13 City Transportation and Public Works Department, Signs and Markings Division to 14 remove the sign. 15 E. Temporary Signage 16 1. In the case of regulatory signs, replace permanent sign with temporary sign meeting 17 requirements of the latest edition of the Texas Manual on Uniform Traffic Control 18 Devices (MUTCD). 19 2. Install temporary sign before the removal of permanent sign. 20 3. When construction is complete, to the extent that the permanent sign can be 21 reinstalled, contact the City Transportation and Public Works Department, Signs 22 and Markings Division, to reinstall the permanent sign. 23 F. Traffic Control Standards 24 1. Traffic Control Standards can be found on the City’s Buzzsaw website. 25 1.5 SUBMITTALS [NOT USED] 26 1.6 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS [NOT USED] 27 1.7 CLOSEOUT SUBMITTALS [NOT USED] 28 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 29 1.9 QUALITY ASSURANCE [NOT USED] 30 1.10 DELIVERY, STORAGE, AND HANDLING [NOT USED] 31 1.11 FIELD [SITE] CONDITIONS [NOT USED] 32 1.12 WARRANTY [NOT USED] 33 PART 2 - PRODUCTS [NOT USED] 34 PART 3 - EXECUTION [NOT USED] 35 END OF SECTION 36 01 55 26 - 3 DAP STREET USE PERMIT AND MODIFICATIONS TO TRAFFIC CONTROL Page 3 of 3 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised July 1, 2011 1 Revision Log DATE NAME SUMMARY OF CHANGE 2 01 57 13 - 1 DAP STORM WATER POLLUTION PREVENTION Page 1 of 3 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised July 1, 2011 SECTION 01 57 13 1 STORM WATER POLLUTION PREVENTION 2 PART 1 - GENERAL 3 1.1 SUMMARY 4 A. Section Includes: 5 1. Procedures for Storm Water Pollution Prevention Plans 6 B. Deviations from this City of Fort Worth Standard Specification 7 1. None. 8 C. Related Specification Sections include, but are not necessarily limited to: 9 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the 10 Contract 11 2. Division 1 – General Requirements 12 3. Section 31 25 00 – Erosion and Sediment Control 13 1.2 PRICE AND PAYMENT PROCEDURES 14 A. Measurement and Payment 15 1. Construction Activities resulting in less than 1 acre of disturbance 16 a. Work associated with this Item is considered subsidiary to the various Items 17 bid. No separate payment will be allowed for this Item. 18 2. Construction Activities resulting in greater than 1 acre of disturbance 19 a. Measurement and Payment shall be in accordance with Section 31 25 00. 20 1.3 REFERENCES 21 A. Abbreviations and Acronyms 22 1. Notice of Intent: NOI 23 2. Notice of Termination: NOT 24 3. Storm Water Pollution Prevention Plan: SWPPP 25 4. Texas Commission on Environmental Quality: TCEQ 26 5. Notice of Change: NOC 27 A. Reference Standards 28 1. Reference standards cited in this Specification refer to the current reference 29 standard published at the time of the latest revision date logged at the end of this 30 Specification, unless a date is specifically cited. 31 2. Integrated Storm Management (iSWM) Technical Manual for Construction 32 Controls 33 1.4 ADMINISTRATIVE REQUIREMENTS 34 A. General 35 1. Contractor is responsible for resolution and payment of any fines issued associated 36 with compliance to Stormwater Pollution Prevention Plan. 37 01 57 13 - 2 DAP STORM WATER POLLUTION PREVENTION Page 2 of 3 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised July 1, 2011 B. Construction Activities resulting in: 1 1. Less than 1 acre of disturbance 2 a. Provide erosion and sediment control in accordance with Section 31 25 00 and 3 Drawings. 4 2. 1 to less than 5 acres of disturbance 5 a. Texas Pollutant Discharge Elimination System (TPDES) General Construction 6 Permit is required 7 b. Complete SWPPP in accordance with TCEQ requirements 8 1) TCEQ Small Construction Site Notice Required under general permit 9 TXR150000 10 a) Sign and post at job site 11 b) Prior to Preconstruction Meeting, send 1 copy to City Department of 12 Transportation and Public Works, Environmental Division, (817) 392-13 6088. 14 2) Provide erosion and sediment control in accordance with: 15 a) Section 31 25 00 16 b) The Drawings 17 c) TXR150000 General Permit 18 d) SWPPP 19 e) TCEQ requirements 20 3. 5 acres or more of Disturbance 21 a. Texas Pollutant Discharge Elimination System (TPDES) General Construction 22 Permit is required 23 b. Complete SWPPP in accordance with TCEQ requirements 24 1) Prepare a TCEQ NOI form and submit to TCEQ along with required fee 25 a) Sign and post at job site 26 b) Send copy to City Department of Transportation and Public Works, 27 Environmental Division, (817) 392-6088. 28 2) TCEQ Notice of Change required if making changes or updates to NOI 29 3) Provide erosion and sediment control in accordance with: 30 a) Section 31 25 00 31 b) The Drawings 32 c) TXR150000 General Permit 33 d) SWPPP 34 e) TCEQ requirements 35 4) Once the project has been completed and all the closeout requirements of 36 TCEQ have been met a TCEQ Notice of Termination can be submitted. 37 a) Send copy to City Department of Transportation and Public Works, 38 Environmental Division, (817) 392-6088. 39 1.5 SUBMITTALS 40 A. SWPPP 41 1. Submit in accordance with Section 01 33 00, except as stated herein. 42 a. Prior to the Preconstruction Meeting, submit a draft copy of SWPPP to the City 43 as follows: 44 1) 1 copy to the City Project Manager 45 a) City Project Manager will forward to the City Department of 46 Transportation and Public Works, Environmental Division for review 47 01 57 13 - 3 DAP STORM WATER POLLUTION PREVENTION Page 3 of 3 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised July 1, 2011 B. Modified SWPPP 1 1. If the SWPPP is revised during construction, resubmit modified SWPPP to the City 2 in accordance with Section 01 33 00. 3 1.6 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS [NOT USED] 4 1.7 CLOSEOUT SUBMITTALS [NOT USED] 5 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 6 1.9 QUALITY ASSURANCE [NOT USED] 7 1.10 DELIVERY, STORAGE, AND HANDLING [NOT USED] 8 1.11 FIELD [SITE] CONDITIONS [NOT USED] 9 1.12 WARRANTY [NOT USED] 10 PART 2 - PRODUCTS [NOT USED] 11 PART 3 - EXECUTION [NOT USED] 12 END OF SECTION 13 14 Revision Log DATE NAME SUMMARY OF CHANGE 15 01 58 13 - 1 DAP TEMPORARY PROJECT SIGNAGE Page 1 of 3 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 SECTION 01 58 13 1 TEMPORARY PROJECT SIGNAGE 2 PART 1 - GENERAL 3 1.1 SUMMARY 4 A. Section Includes: 5 1. Temporary Project Signage Requirements 6 B. Deviations from this City of Fort Worth Standard Specification 7 1. None. 8 C. Related Specification Sections include, but are not necessarily limited to: 9 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 10 2. Division 1 – General Requirements 11 1.2 PRICE AND PAYMENT PROCEDURES 12 A. Measurement and Payment 13 1. Work associated with this Item is considered subsidiary to the various Items bid. 14 No separate payment will be allowed for this Item. 15 1.3 REFERENCES [NOT USED] 16 1.4 ADMINISTRATIVE REQUIREMENTS [NOT USED] 17 1.5 SUBMITTALS [NOT USED] 18 1.6 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS [NOT USED] 19 1.7 CLOSEOUT SUBMITTALS [NOT USED] 20 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 21 1.9 QUALITY ASSURANCE [NOT USED] 22 1.10 DELIVERY, STORAGE, AND HANDLING [NOT USED] 23 1.11 FIELD [SITE] CONDITIONS [NOT USED] 24 1.12 WARRANTY [NOT USED] 25 PART 2 - PRODUCTS 26 2.1 OWNER-FURNISHED [OR] OWNER-SUPPLIEDPRODUCTS [NOT USED] 27 2.2 EQUIPMENT, PRODUCT TYPES, AND MATERIALS 28 A. Design Criteria 29 1. Provide free standing Project Designation Sign in accordance with City’s Standard 30 Details for project signs. 31 01 58 13 - 2 DAP TEMPORARY PROJECT SIGNAGE Page 2 of 3 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 B. Materials 1 1. Sign 2 a. Constructed of ¾-inch fir plywood, grade A-C (exterior) or better 3 2.3 ACCESSORIES [NOT USED] 4 2.4 SOURCE QUALITY CONTROL [NOT USED] 5 PART 3 - EXECUTION 6 3.1 INSTALLERS [NOT USED] 7 3.2 EXAMINATION [NOT USED] 8 3.3 PREPARATION [NOT USED] 9 3.4 INSTALLATION 10 A. General 11 1. Provide vertical installation at extents of project. 12 2. Relocate sign as needed, upon request of the City. 13 B. Mounting options 14 a. Skids 15 b. Posts 16 c. Barricade 17 3.5 REPAIR / RESTORATION [NOT USED] 18 3.6 RE-INSTALLATION [NOT USED] 19 3.7 FIELD [OR] SITE QUALITY CONTROL [NOT USED] 20 3.8 SYSTEM STARTUP [NOT USED] 21 3.9 ADJUSTING [NOT USED] 22 3.10 CLEANING [NOT USED] 23 3.11 CLOSEOUT ACTIVITIES [NOT USED] 24 3.12 PROTECTION [NOT USED] 25 3.13 MAINTENANCE 26 A. General 27 1. Maintenance will include painting and repairs as needed or directed by the City. 28 3.14 ATTACHMENTS [NOT USED] 29 END OF SECTION 30 31 01 58 13 - 3 DAP TEMPORARY PROJECT SIGNAGE Page 3 of 3 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 1 Revision Log DATE NAME SUMMARY OF CHANGE 4/7/2014 M. Domenech Revised for DAP application 2 3 01 60 00 - 1 DAP PRODUCT REQUIREMENTS Page 1 of 2 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. – 102275 Revised April 7, 2014 SECTION 01 60 00 1 PRODUCT REQUIREMENTS 2 PART 1 - GENERAL 3 1.1 SUMMARY 4 A. Section Includes: 5 1. References for Product Requirements and City Standard Products List 6 B. Deviations from this City of Fort Worth Standard Specification 7 1. None. 8 C. Related Specification Sections include, but are not necessarily limited to: 9 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 10 2. Division 1 – General Requirements 11 1.2 PRICE AND PAYMENT PROCEDURES [NOT USED] 12 1.3 REFERENCES [NOT USED] 13 1.4 ADMINISTRATIVE REQUIREMENTS 14 A. A list of City approved products for use is located on Buzzsaw as follows: 15 1. Resources\02 - Construction Documents\Standard Products List 16 B. Only products specifically included on City’s Standard Product List in these Contract 17 Documents shall be allowed for use on the Project. 18 1. Any subsequently approved products will only be allowed for use upon specific 19 approval by the City. 20 C. Any specific product requirements in the Contract Documents supersede similar 21 products included on the City’s Standard Product List. 22 1. The City reserves the right to not allow products to be used for certain projects even 23 though the product is listed on the City’s Standard Product List. 24 D. Although a specific product is included on City’s Standard Product List, not all 25 products from that manufacturer are approved for use, including but not limited to, that 26 manufacturer’s standard product. 27 E. See Section 01 33 00 for submittal requirements of Product Data included on City’s 28 Standard Product List. 29 1.5 SUBMITTALS [NOT USED] 30 1.6 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS [NOT USED] 31 1.7 CLOSEOUT SUBMITTALS [NOT USED] 32 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 33 1.9 QUALITY ASSURANCE [NOT USED] 34 01 60 00 - 2 DAP PRODUCT REQUIREMENTS Page 2 of 2 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. – 102275 Revised April 7, 2014 1.10 DELIVERY, STORAGE, AND HANDLING [NOT USED] 1 1.11 FIELD [SITE] CONDITIONS [NOT USED] 2 1.12 WARRANTY [NOT USED] 3 PART 2 - PRODUCTS [NOT USED] 4 PART 3 - EXECUTION [NOT USED] 5 END OF SECTION 6 7 Revision Log DATE NAME SUMMARY OF CHANGE 10/12/12 D. Johnson Modified Location of City’s Standard Product List 4/7/2014 M.Domenech Revised for DAP application 8 01 66 00 - 1 DAP PRODUCT STORAGE AND HANDLING REQUIREMENTS Page 1 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 SECTION 01 66 00 1 PRODUCT STORAGE AND HANDLING REQUIREMENTS 2 PART 1 - GENERAL 3 1.1 SUMMARY 4 A. Section Includes: 5 1. Scheduling of product delivery 6 2. Packaging of products for delivery 7 3. Protection of products against damage from: 8 a. Handling 9 b. Exposure to elements or harsh environments 10 B. Deviations from this City of Fort Worth Standard Specification 11 1. None. 12 C. Related Specification Sections include, but are not necessarily limited to: 13 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 14 2. Division 1 – General Requirements 15 1.2 PRICE AND PAYMENT PROCEDURES 16 A. Measurement and Payment 17 1. Work associated with this Item is considered subsidiary to the various Items bid. 18 No separate payment will be allowed for this Item. 19 1.3 REFERENCES [NOT USED] 20 1.4 ADMINISTRATIVE REQUIREMENTS [NOT USED] 21 1.5 SUBMITTALS [NOT USED] 22 1.6 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS [NOT USED] 23 1.7 CLOSEOUT SUBMITTALS [NOT USED] 24 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 25 1.9 QUALITY ASSURANCE [NOT USED] 26 1.10 DELIVERY AND HANDLING 27 A. Delivery Requirements 28 1. Schedule delivery of products or equipment as required to allow timely installation 29 and to avoid prolonged storage. 30 2. Provide appropriate personnel and equipment to receive deliveries. 31 3. Delivery trucks will not be permitted to wait extended periods of time on the Site 32 for personnel or equipment to receive the delivery. 33 01 66 00 - 2 DAP PRODUCT STORAGE AND HANDLING REQUIREMENTS Page 2 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 4. Deliver products or equipment in manufacturer's original unbroken cartons or other 1 containers designed and constructed to protect the contents from physical or 2 environmental damage. 3 5. Clearly and fully mark and identify as to manufacturer, item and installation 4 location. 5 6. Provide manufacturer's instructions for storage and handling. 6 B. Handling Requirements 7 1. Handle products or equipment in accordance with these Contract Documents and 8 manufacturer’s recommendations and instructions. 9 C. Storage Requirements 10 1. Store materials in accordance with manufacturer’s recommendations and 11 requirements of these Specifications. 12 2. Make necessary provisions for safe storage of materials and equipment. 13 a. Place loose soil materials and materials to be incorporated into Work to prevent 14 damage to any part of Work or existing facilities and to maintain free access at 15 all times to all parts of Work and to utility service company installations in 16 vicinity of Work. 17 3. Keep materials and equipment neatly and compactly stored in locations that will 18 cause minimum inconvenience to other contractors, public travel, adjoining owners, 19 tenants and occupants. 20 a. Arrange storage to provide easy access for inspection. 21 4. Restrict storage to areas available on construction site for storage of material and 22 equipment as shown on Drawings, or approved by City’s Project Representative. 23 5. Provide off-site storage and protection when on-site storage is not adequate. 24 a. Provide addresses of and access to off-site storage locations for inspection by 25 City’s Project Representative. 26 6. Do not use lawns, grass plots or other private property for storage purposes without 27 written permission of owner or other person in possession or control of premises. 28 7. Store in manufacturers’ unopened containers. 29 8. Neatly, safely and compactly stack materials delivered and stored along line of 30 Work to avoid inconvenience and damage to property owners and general public 31 and maintain at least 3 feet from fire hydrant. 32 9. Keep public and private driveways and street crossings open. 33 10. Repair or replace damaged lawns, sidewalks, streets or other improvements to 34 satisfaction of City’s Project Representative. 35 a. Total length which materials may be distributed along route of construction at 36 one time is 1,000 linear feet, unless otherwise approved in writing by City’s 37 Project Representative. 38 01 66 00 - 3 DAP PRODUCT STORAGE AND HANDLING REQUIREMENTS Page 3 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 1.11 FIELD [SITE] CONDITIONS [NOT USED] 1 1.12 WARRANTY [NOT USED] 2 PART 2 - PRODUCTS [NOT USED] 3 PART 3 - EXECUTION 4 3.1 INSTALLERS [NOT USED] 5 3.2 EXAMINATION [NOT USED] 6 3.3 PREPARATION [NOT USED] 7 3.4 ERECTION [NOT USED] 8 3.5 REPAIR / RESTORATION [NOT USED] 9 3.6 RE-INSTALLATION [NOT USED] 10 3.7 FIELD [OR] SITE QUALITY CONTROL 11 A. Tests and Inspections 12 1. Inspect all products or equipment delivered to the site prior to unloading. 13 B. Non-Conforming Work 14 1. Reject all products or equipment that are damaged, used or in any other way 15 unsatisfactory for use on the project. 16 3.8 SYSTEM STARTUP [NOT USED] 17 3.9 ADJUSTING [NOT USED] 18 3.10 CLEANING [NOT USED] 19 3.11 CLOSEOUT ACTIVITIES [NOT USED] 20 3.12 PROTECTION 21 A. Protect all products or equipment in accordance with manufacturer's written directions. 22 B. Store products or equipment in location to avoid physical damage to items while in 23 storage. 24 C. Protect equipment from exposure to elements and keep thoroughly dry if required by 25 the manufacturer. 26 3.13 MAINTENANCE [NOT USED] 27 3.14 ATTACHMENTS [NOT USED] 28 END OF SECTION 29 30 01 66 00 - 4 DAP PRODUCT STORAGE AND HANDLING REQUIREMENTS Page 4 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 Revision Log DATE NAME SUMMARY OF CHANGE 4/7/2014 M.Domenech Revised for DAP application 1 01 70 00 - 1 DAP MOBILIZATION AND REMOBILIZATION Page 1 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 SECTION 01 70 00 1 MOBILIZATION AND REMOBILIZATION 2 PART 1 - GENERAL 3 1.1 SUMMARY 4 A. Section Includes: 5 1. Mobilization and Demobilization 6 a. Mobilization 7 1) Transportation of Contractor’s personnel, equipment, and operating supplies 8 to the Site 9 2) Establishment of necessary general facilities for the Contractor’s operation 10 at the Site 11 3) Premiums paid for performance and payment bonds 12 4) Transportation of Contractor’s personnel, equipment, and operating supplies 13 to another location within the designated Site 14 5) Relocation of necessary general facilities for the Contractor’s operation 15 from 1 location to another location on the Site. 16 b. Demobilization 17 1) Transportation of Contractor’s personnel, equipment, and operating supplies 18 away from the Site including disassembly 19 2) Site Clean-up 20 3) Removal of all buildings and/or other facilities assembled at the Site for this 21 Contract 22 c. Mobilization and Demobilization do not include activities for specific items of 23 work that are for which payment is provided elsewhere in the contract. 24 2. Remobilization 25 a. Remobilization for Suspension of Work specifically required in the Contract 26 Documents or as required by City includes: 27 1) Demobilization 28 a) Transportation of Contractor’s personnel, equipment, and operating 29 supplies from the Site including disassembly or temporarily securing 30 equipment, supplies, and other facilities as designated by the Contract 31 Documents necessary to suspend the Work. 32 b) Site Clean-up as designated in the Contract Documents 33 2) Remobilization 34 a) Transportation of Contractor’s personnel, equipment, and operating 35 supplies to the Site necessary to resume the Work. 36 b) Establishment of necessary general facilities for the Contractor’s 37 operation at the Site necessary to resume the Work. 38 3) No Payments will be made for: 39 a) Mobilization and Demobilization from one location to another on the 40 Site in the normal progress of performing the Work. 41 b) Stand-by or idle time 42 c) Lost profits 43 3. Mobilizations and Demobilization for Miscellaneous Projects 44 a. Mobilization and Demobilization 45 01 70 00 - 2 DAP MOBILIZATION AND REMOBILIZATION Page 2 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 1) Mobilization shall consist of the activities and cost on a Work Order basis 1 necessary for: 2 a) Transportation of Contractor’s personnel, equipment, and operating 3 supplies to the Site for the issued Work Order. 4 b) Establishment of necessary general facilities for the Contractor’s 5 operation at the Site for the issued Work Order 6 2) Demobilization shall consist of the activities and cost necessary for: 7 a) Transportation of Contractor’s personnel, equipment, and operating 8 supplies from the Site including disassembly for each issued Work 9 Order 10 b) Site Clean-up for each issued Work Order 11 c) Removal of all buildings or other facilities assembled at the Site for 12 each Work Oder 13 b. Mobilization and Demobilization do not include activities for specific items of 14 work for which payment is provided elsewhere in the contract. 15 4. Emergency Mobilizations and Demobilization for Miscellaneous Projects 16 a. A Mobilization for Miscellaneous Projects when directed by the City and the 17 mobilization occurs within 24 hours of the issuance of the Work Order. 18 B. Deviations from this City of Fort Worth Standard Specification 19 1. None. 20 C. Related Specification Sections include, but are not necessarily limited to: 21 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 22 2. Division 1 – General Requirements 23 1.2 PRICE AND PAYMENT PROCEDURES 24 A. Measurement and Payment 25 1. Mobilization and Demobilization 26 a. Measure 27 1) This Item is considered subsidiary to the various Items bid. 28 b. Payment 29 1) The work performed and materials furnished in accordance with this Item 30 are subsidiary to the various Items bid and no other compensation will be 31 allowed. 32 2. Remobilization for suspension of Work as specifically required in the Contract 33 Documents 34 a. Measurement 35 1) Measurement for this Item shall be per each remobilization performed. 36 b. Payment 37 1) The work performed and materials furnished in accordance with this Item 38 and measured as provided under “Measurement” will be paid for at the unit 39 price per each “Specified Remobilization” in accordance with Contract 40 Documents. 41 c. The price shall include: 42 1) Demobilization as described in Section 1.1.A.2.a.1) 43 2) Remobilization as described in Section 1.1.A.2.a.2) 44 d. No payments will be made for standby, idle time, or lost profits associated this 45 Item. 46 01 70 00 - 3 DAP MOBILIZATION AND REMOBILIZATION Page 3 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 3. Remobilization for suspension of Work as required by City 1 a. Measurement and Payment 2 1) This shall be submitted as a Contract Claim in accordance with Article 10 3 of Section 00 72 00. 4 2) No payments will be made for standby, idle time, or lost profits associated 5 with this Item. 6 4. Mobilizations and Demobilizations for Miscellaneous Projects 7 a. Measurement 8 1) Measurement for this Item shall be for each Mobilization and 9 Demobilization required by the Contract Documents 10 b. Payment 11 1) The Work performed and materials furnished in accordance with this Item 12 and measured as provided under “Measurement” will be paid for at the unit 13 price per each “Work Order Mobilization” in accordance with Contract 14 Documents. Demobilization shall be considered subsidiary to mobilization 15 and shall not be paid for separately. 16 c. The price shall include: 17 1) Mobilization as described in Section 1.1.A.3.a.1) 18 2) Demobilization as described in Section 1.1.A.3.a.2) 19 d. No payments will be made for standby, idle time, or lost profits associated this 20 Item. 21 5. Emergency Mobilizations and Demobilizations for Miscellaneous Projects 22 a. Measurement 23 1) Measurement for this Item shall be for each Mobilization and 24 Demobilization required by the Contract Documents 25 b. Payment 26 1) The Work performed and materials furnished in accordance with this Item 27 and measured as provided under “Measurement” will be paid for at the unit 28 price per each “Work Order Emergency Mobilization” in accordance with 29 Contract Documents. Demobilization shall be considered subsidiary to 30 mobilization and shall not be paid for separately. 31 c. The price shall include 32 1) Mobilization as described in Section 1.1.A.4.a) 33 2) Demobilization as described in Section 1.1.A.3.a.2) 34 d. No payments will be made for standby, idle time, or lost profits associated this 35 Item. 36 1.3 REFERENCES [NOT USED] 37 1.4 ADMINISTRATIVE REQUIREMENTS [NOT USED] 38 1.5 SUBMITTALS [NOT USED] 39 1.6 INFORMATIONAL SUBMITTALS [NOT USED] 40 1.7 CLOSEOUT SUBMITTALS [NOT USED] 41 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 42 1.9 QUALITY ASSURANCE [NOT USED] 43 1.10 DELIVERY, STORAGE, AND HANDLING [NOT USED] 44 01 70 00 - 4 DAP MOBILIZATION AND REMOBILIZATION Page 4 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 1.11 FIELD [SITE] CONDITIONS [NOT USED] 1 1.12 WARRANTY [NOT USED] 2 PART 2 - PRODUCTS [NOT USED] 3 PART 3 - EXECUTION [NOT USED] 4 END OF SECTION 5 6 Revision Log DATE NAME SUMMARY OF CHANGE 4/7/2014 M.Domenech Revised for DAP application 7 01 71 23 - 1 DAP CONSTRUCTION STAKING AND SURVEY Page 1 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 SECTION 01 71 23 1 CONSTRUCTION STAKING AND SURVEY 2 PART 1 - GENERAL 3 1.1 SUMMARY 4 A. Section Includes: 5 1. Requirements for construction staking and construction survey 6 B. Deviations from this City of Fort Worth Standard Specification 7 1. None. 8 C. Related Specification Sections include, but are not necessarily limited to: 9 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 10 2. Division 1 – General Requirements 11 1.2 PRICE AND PAYMENT PROCEDURES 12 A. Measurement and Payment 13 1. Construction Staking 14 a. Measurement 15 1) This Item is considered subsidiary to the various Items bid. 16 b. Payment 17 1) The work performed and the materials furnished in accordance with this 18 Item are subsidiary to the various Items bid and no other compensation will 19 be allowed. 20 2. Construction Survey 21 a. Measurement 22 1) This Item is considered subsidiary to the various Items bid. 23 b. Payment 24 1) The work performed and the materials furnished in accordance with this 25 Item are subsidiary to the various Items bid and no other compensation will 26 be allowed. 27 1.3 REFERENCES [NOT USED] 28 1.4 ADMINISTRATIVE REQUIREMENTS [NOT USED] 29 1.5 SUBMITTALS 30 A. Submittals, if required, shall be in accordance with Section 01 33 00. 31 B. All submittals shall be approved by the City prior to delivery. 32 1.6 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS 33 A. Certificates 34 1. Provide certificate certifying that elevations and locations of improvements are in 35 conformance or non-conformance with requirements of the Contract Documents. 36 a. Certificate must be sealed by a registered professional land surveyor in the 37 State of Texas. 38 01 71 23 - 2 DAP CONSTRUCTION STAKING AND SURVEY Page 2 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 B. Field Quality Control Submittals 1 1. Documentation verifying accuracy of field engineering work. 2 1.7 CLOSEOUT SUBMITTALS [NOT USED] 3 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 4 1.9 QUALITY ASSURANCE 5 A. Construction Staking 6 1. Construction staking will be performed by the City. 7 2. Coordination 8 a. Contact City’s Project Representative at least 2 weeks in advance for 9 scheduling of Construction Staking. 10 b. It is the Contractor’s responsibility to coordinate staking such that construction 11 activities are not delayed or negatively impacted. 12 3. General 13 a. Contractor is responsible for preserving and maintaining stakes furnished by 14 City. 15 b. If in the opinion of the City, a sufficient number of stakes or markings have 16 been lost, destroyed or disturbed, by Contractor’s neglect, such that the 17 contracted Work cannot take place, then the Contractor will be required to pay 18 the City for new staking with a 25 percent markup. The cost for staking will be 19 deducted from the payment due to the Contractor for the Project. 20 B. Construction Survey 21 1. Construction Survey will be performed by the City. 22 2. Coordination 23 a. Contractor to verify that control data established in the design survey remains 24 intact. 25 b. Coordinate with the City prior to field investigation to determine which 26 horizontal and vertical control data will be required for construction survey. 27 c. It is the Contractor’s responsibility to coordinate Construction Survey such that 28 construction activities are not delayed or negatively impacted. 29 d. Notify City if any control data needs to be restored or replaced due to damage 30 caused during construction operations. 31 1) City shall perform replacements and/or restorations. 32 3. General 33 a. Construction survey will be performed in order to maintain complete and 34 accurate logs of control and survey work as it progresses for Project Records. 35 b. The Contractor will need to ensure coordination is maintained with the City to 36 perform construction survey to obtain construction features, including but not 37 limited to the following: 38 1) All Utility Lines 39 a) Rim and flowline elevations and coordinates for each manhole or 40 junction structure 41 2) Water Lines 42 a) Top of pipe elevations and coordinates for waterlines at the following 43 locations: 44 (1) Every 250 linear feet 45 01 71 23 - 3 DAP CONSTRUCTION STAKING AND SURVEY Page 3 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 (2) Horizontal and vertical points of inflection, curvature, etc. (All 1 Fittings) 2 (3) Cathodic protection test stations 3 (4) Sampling stations 4 (5) Meter boxes/vaults (All sizes) 5 (6) Fire lines 6 (7) Fire hydrants 7 (8) Gate valves 8 (9) Plugs, stubouts, dead-end lines 9 (10) Air Release valves (Manhole rim and vent pipe) 10 (11) Blow off valves (Manhole rim and valve lid) 11 (12) Pressure plane valves 12 (13) Cleaning wyes 13 (14) Casing pipe (each end) 14 b) Storm Sewer 15 (1) Top of pipe elevations and coordinates at the following locations: 16 (a) Every 250 linear feet 17 (b) Horizontal and vertical points of inflection, curvature, etc. 18 c) Sanitary Sewer 19 (1) Top of pipe elevations and coordinates for sanitary sewer lines at 20 the following locations: 21 (a) Every 250 linear feet 22 (b) Horizontal and vertical points of inflection, curvature, etc. 23 (c) Cleanouts 24 c. Construction survey will be performed in order to maintain complete and 25 accurate logs of control and survey work associated with meeting or exceeding 26 the line and grade required by these Specifications. 27 d. The Contractor will need to ensure coordination is maintained with the City to 28 perform construction survey and to verify control data, including but not 29 limited to the following: 30 1) Established benchmarks and control points provided for the Contractor’s 31 use are accurate 32 2) Benchmarks were used to furnish and maintain all reference lines and 33 grades for tunneling 34 3) Lines and grades were used to establish the location of the pipe 35 4) Submit to the City copies of field notes used to establish all lines and 36 grades and allow the City to check guidance system setup prior to 37 beginning each tunneling drive. 38 5) Provide access for the City to verify the guidance system and the line and 39 grade of the carrier pipe on a daily basis. 40 6) The Contractor remains fully responsible for the accuracy of the work and 41 the correction of it, as required. 42 7) Monitor line and grade continuously during construction. 43 8) Record deviation with respect to design line and grade once at each pipe 44 joint and submit daily records to City. 45 9) If the installation does not meet the specified tolerances, immediately notify 46 the City and correct the installation in accordance with the Contract 47 Documents. 48 1.10 DELIVERY, STORAGE, AND HANDLING [NOT USED] 49 01 71 23 - 4 DAP CONSTRUCTION STAKING AND SURVEY Page 4 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 1.11 FIELD [SITE] CONDITIONS [NOT USED] 1 1.12 WARRANTY [NOT USED] 2 PART 2 - PRODUCTS [NOT USED] 3 PART 3 - EXECUTION 4 3.1 INSTALLERS [NOT USED] 5 3.2 EXAMINATION [NOT USED] 6 3.3 PREPARATION [NOT USED] 7 3.4 APPLICATION 8 3.5 REPAIR / RESTORATION [NOT USED] 9 3.6 RE-INSTALLATION [NOT USED] 10 3.7 FIELD [OR] SITE QUALITY CONTROL 11 A. It is the Contractor’s responsibility to maintain all stakes and control data placed by the 12 City in accordance with this Specification. 13 B. Do not change or relocate stakes or control data without approval from the City. 14 3.8 SYSTEM STARTUP [NOT USED] 15 3.9 ADJUSTING [NOT USED] 16 3.10 CLEANING [NOT USED] 17 3.11 CLOSEOUT ACTIVITIES [NOT USED] 18 3.12 PROTECTION [NOT USED] 19 3.13 MAINTENANCE [NOT USED] 20 3.14 ATTACHMENTS [NOT USED] 21 END OF SECTION 22 23 Revision Log DATE NAME SUMMARY OF CHANGE 4/7/2014 M.Domenech Revised for DAP application 24 01 74 23 - 1 DAP CLEANING Page 1 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 SECTION 01 74 23 1 CLEANING 2 PART 1 - GENERAL 3 1.1 SUMMARY 4 A. Section Includes: 5 1. Intermediate and final cleaning for Work not including special cleaning of closed 6 systems specified elsewhere 7 B. Deviations from this City of Fort Worth Standard Specification 8 1. None. 9 C. Related Specification Sections include, but are not necessarily limited to: 10 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 11 2. Division 1 – General Requirements 12 3. Section 32 92 13 – Hydro-Mulching, Seeding and Sodding 13 1.2 PRICE AND PAYMENT PROCEDURES 14 A. Measurement and Payment 15 1. Work associated with this Item is considered subsidiary to the various Items bid. 16 No separate payment will be allowed for this Item. 17 1.3 REFERENCES [NOT USED] 18 1.4 ADMINISTRATIVE REQUIREMENTS 19 A. Scheduling 20 1. Schedule cleaning operations so that dust and other contaminants disturbed by 21 cleaning process will not fall on newly painted surfaces. 22 2. Schedule final cleaning upon completion of Work and immediately prior to final 23 inspection. 24 1.5 SUBMITTALS [NOT USED] 25 1.6 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS [NOT USED] 26 1.7 CLOSEOUT SUBMITTALS [NOT USED] 27 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 28 1.9 QUALITY ASSURANCE [NOT USED] 29 1.10 STORAGE, AND HANDLING 30 A. Storage and Handling Requirements 31 1. Store cleaning products and cleaning wastes in containers specifically designed for 32 those materials. 33 01 74 23 - 2 DAP CLEANING Page 2 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 1.11 FIELD [SITE] CONDITIONS [NOT USED] 1 1.12 WARRANTY [NOT USED] 2 PART 2 - PRODUCTS 3 2.1 OWNER-FURNISHED [OR] OWNER-SUPPLIEDPRODUCTS [NOT USED] 4 2.2 MATERIALS 5 A. Cleaning Agents 6 1. Compatible with surface being cleaned 7 2. New and uncontaminated 8 3. For manufactured surfaces 9 a. Material recommended by manufacturer 10 2.3 ACCESSORIES [NOT USED] 11 2.4 SOURCE QUALITY CONTROL [NOT USED] 12 PART 3 - EXECUTION 13 3.1 INSTALLERS [NOT USED] 14 3.2 EXAMINATION [NOT USED] 15 3.3 PREPARATION [NOT USED] 16 3.4 APPLICATION [NOT USED] 17 3.5 REPAIR / RESTORATION [NOT USED] 18 3.6 RE-INSTALLATION [NOT USED] 19 3.7 FIELD [OR] SITE QUALITY CONTROL [NOT USED] 20 3.8 SYSTEM STARTUP [NOT USED] 21 3.9 ADJUSTING [NOT USED] 22 3.10 CLEANING 23 A. General 24 1. Prevent accumulation of wastes that create hazardous conditions. 25 2. Conduct cleaning and disposal operations to comply with laws and safety orders of 26 governing authorities. 27 3. Do not dispose of volatile wastes such as mineral spirits, oil or paint thinner in 28 storm or sanitary drains or sewers. 29 4. Dispose of degradable debris at an approved solid waste disposal site. 30 5. Dispose of nondegradable debris at an approved solid waste disposal site or in an 31 alternate manner approved by City and regulatory agencies. 32 01 74 23 - 3 DAP CLEANING Page 3 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 6. Handle materials in a controlled manner with as few handlings as possible. 1 7. Thoroughly clean, sweep, wash and polish all Work and equipment associated with 2 this project. 3 8. Remove all signs of temporary construction and activities incidental to construction 4 of required permanent Work. 5 9. If project is not cleaned to the satisfaction of the City, the City reserves the right to 6 have the cleaning completed at the expense of the Contractor. 7 10. Do not burn on-site. 8 B. Intermediate Cleaning during Construction 9 1. Keep Work areas clean so as not to hinder health, safety or convenience of 10 personnel in existing facility operations. 11 2. At maximum weekly intervals, dispose of waste materials, debris and rubbish. 12 3. Confine construction debris daily in strategically located container(s): 13 a. Cover to prevent blowing by wind 14 b. Store debris away from construction or operational activities 15 c. Haul from site at a minimum of once per week 16 4. Vacuum clean interior areas when ready to receive finish painting. 17 a. Continue vacuum cleaning on an as-needed basis, until Final Acceptance. 18 5. Prior to storm events, thoroughly clean site of all loose or unsecured items, which 19 may become airborne or transported by flowing water during the storm. 20 C. Exterior (Site or Right of Way) Final Cleaning 21 1. Remove trash and debris containers from site. 22 a. Re-seed areas disturbed by location of trash and debris containers in accordance 23 with Section 32 92 13. 24 2. Sweep roadway to remove all rocks, pieces of asphalt, concrete or any other object 25 that may hinder or disrupt the flow of traffic along the roadway. 26 3. Clean any interior areas including, but not limited to, vaults, manholes, structures, 27 junction boxes and inlets. 28 4. If no longer required for maintenance of erosion facilities, and upon approval by 29 City, remove erosion control from site. 30 5. Clean signs, lights, signals, etc. 31 3.11 CLOSEOUT ACTIVITIES [NOT USED] 32 3.12 PROTECTION [NOT USED] 33 3.13 MAINTENANCE [NOT USED] 34 3.14 ATTACHMENTS [NOT USED] 35 36 37 38 39 40 01 74 23 - 4 DAP CLEANING Page 4 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 END OF SECTION 1 2 Revision Log DATE NAME SUMMARY OF CHANGE 4/7/2014 M.Domenech Revised for DAP application 3 01 77 19 - 1 DAP CLOSEOUT REQUIREMENTS Page 1 of 3 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 SECTION 01 77 19 1 CLOSEOUT REQUIREMENTS 2 PART 1 - GENERAL 3 1.1 SUMMARY 4 A. Section Includes: 5 1. The procedure for closing out a contract 6 B. Deviations from this City of Fort Worth Standard Specification 7 1. None. 8 C. Related Specification Sections include, but are not necessarily limited to: 9 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 10 2. Division 1 – General Requirements 11 1.2 PRICE AND PAYMENT PROCEDURES 12 A. Measurement and Payment 13 1. Work associated with this Item is considered subsidiary to the various Items bid. 14 No separate payment will be allowed for this Item. 15 1.3 REFERENCES [NOT USED] 16 1.4 ADMINISTRATIVE REQUIREMENTS 17 A. Guarantees, Bonds and Affidavits 18 1. No application for final payment will be accepted until all guarantees, bonds, 19 certificates, licenses and affidavits required for Work or equipment as specified are 20 satisfactorily filed with the City. 21 B. Release of Liens or Claims 22 1. No application for final payment will be accepted until satisfactory evidence of 23 release of liens has been submitted to the City. 24 1.5 SUBMITTALS 25 A. Submit all required documentation to City’s Project Representative. 26 01 77 19 - 2 DAP CLOSEOUT REQUIREMENTS Page 2 of 3 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 1.6 INFORMATIONAL SUBMITTALS [NOT USED] 1 1.7 CLOSEOUT SUBMITTALS [NOT USED] 2 PART 2 - PRODUCTS [NOT USED] 3 PART 3 - EXECUTION 4 3.1 INSTALLERS [NOT USED] 5 3.2 EXAMINATION [NOT USED] 6 3.3 PREPARATION [NOT USED] 7 3.4 CLOSEOUT PROCEDURE 8 A. Prior to requesting Final Inspection, submit: 9 1. Project Record Documents in accordance with Section 01 78 39 10 2. Operation and Maintenance Data, if required, in accordance with Section 01 78 23 11 B. Prior to requesting Final Inspection, perform final cleaning in accordance with Section 12 01 74 23. 13 C. Final Inspection 14 1. After final cleaning, provide notice to the City Project Representative that the Work 15 is completed. 16 a. The City will make an initial Final Inspection with the Contractor present. 17 b. Upon completion of this inspection, the City will notify the Contractor, in 18 writing within 10 business days, of any particulars in which this inspection 19 reveals that the Work is defective or incomplete. 20 2. Upon receiving written notice from the City, immediately undertake the Work 21 required to remedy deficiencies and complete the Work to the satisfaction of the 22 City. 23 3. Upon completion of Work associated with the items listed in the City's written 24 notice, inform the City, that the required Work has been completed. Upon receipt 25 of this notice, the City, in the presence of the Contractor, will make a subsequent 26 Final Inspection of the project. 27 4. Provide all special accessories required to place each item of equipment in full 28 operation. These special accessory items include, but are not limited to: 29 a. Specified spare parts 30 b. Adequate oil and grease as required for the first lubrication of the equipment 31 c. Initial fill up of all chemical tanks and fuel tanks 32 d. Light bulbs 33 e. Fuses 34 f. Vault keys 35 g. Handwheels 36 h. Other expendable items as required for initial start-up and operation of all 37 equipment 38 D. Notice of Project Completion 39 01 77 19 - 3 DAP CLOSEOUT REQUIREMENTS Page 3 of 3 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 1. Once the City Project Representative finds the Work subsequent to Final Inspection 1 to be satisfactory, the City will issue a Notice of Project Completion (Green Sheet). 2 E. Supporting Documentation 3 1. Coordinate with the City Project Representative to complete the following 4 additional forms: 5 a. Final Payment Request 6 b. Statement of Contract Time 7 c. Affidavit of Payment and Release of Liens 8 d. Consent of Surety to Final Payment 9 e. Pipe Report (if required) 10 f. Contractor’s Evaluation of City 11 g. Performance Evaluation of Contractor 12 F. Letter of Final Acceptance 13 1. Upon review and acceptance of Notice of Project Completion and Supporting 14 Documentation, in accordance with General Conditions, City will issue Letter of 15 Final Acceptance and release the Final Payment Request for payment. 16 3.5 REPAIR / RESTORATION [NOT USED] 17 3.6 RE-INSTALLATION [NOT USED] 18 3.7 FIELD [OR] SITE QUALITY CONTROL [NOT USED] 19 3.8 SYSTEM STARTUP [NOT USED] 20 3.9 ADJUSTING [NOT USED] 21 3.10 CLEANING [NOT USED] 22 3.11 CLOSEOUT ACTIVITIES [NOT USED] 23 3.12 PROTECTION [NOT USED] 24 3.13 MAINTENANCE [NOT USED] 25 3.14 ATTACHMENTS [NOT USED] 26 END OF SECTION 27 28 Revision Log DATE NAME SUMMARY OF CHANGE 4/7/2014 M.Domenech Revised for DAP application 29 01 78 23 - 1 DAP OPERATION AND MAINTENANCE DATA Page 1 of 5 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 SECTION 01 78 23 1 OPERATION AND MAINTENANCE DATA 2 PART 1 - GENERAL 3 1.1 SUMMARY 4 A. Section Includes: 5 1. Product data and related information appropriate for City's maintenance and 6 operation of products furnished under Contract 7 2. Such products may include, but are not limited to: 8 a. Traffic Controllers 9 b. Irrigation Controllers (to be operated by the City) 10 c. Butterfly Valves 11 B. Deviations from this City of Fort Worth Standard Specification 12 1. None. 13 C. Related Specification Sections include, but are not necessarily limited to: 14 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 15 2. Division 1 – General Requirements 16 1.2 PRICE AND PAYMENT PROCEDURES 17 A. Measurement and Payment 18 1. Work associated with this Item is considered subsidiary to the various Items bid. 19 No separate payment will be allowed for this Item. 20 1.3 REFERENCES [NOT USED] 21 1.4 ADMINISTRATIVE REQUIREMENTS 22 A. Schedule 23 1. Submit manuals in final form to the City within 30 calendar days of product 24 shipment to the project site. 25 1.5 SUBMITTALS 26 A. Submittals shall be in accordance with Section 01 33 00. All submittals shall be 27 approved by the City prior to delivery. 28 1.6 INFORMATIONAL SUBMITTALS 29 A. Submittal Form 30 1. Prepare data in form of an instructional manual for use by City personnel. 31 2. Format 32 a. Size: 8 ½ inches x 11 inches 33 b. Paper 34 1) 40 pound minimum, white, for typed pages 35 2) Holes reinforced with plastic, cloth or metal 36 c. Text: Manufacturer’s printed data, or neatly typewritten 37 01 78 23 - 2 DAP OPERATION AND MAINTENANCE DATA Page 2 of 5 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 d. Drawings 1 1) Provide reinforced punched binder tab, bind in with text 2 2) Reduce larger drawings and fold to size of text pages. 3 e. Provide fly-leaf for each separate product, or each piece of operating 4 equipment. 5 1) Provide typed description of product, and major component parts of 6 equipment. 7 2) Provide indexed tabs. 8 f. Cover 9 1) Identify each volume with typed or printed title "OPERATING AND 10 MAINTENANCE INSTRUCTIONS". 11 2) List: 12 a) Title of Project 13 b) Identity of separate structure as applicable 14 c) Identity of general subject matter covered in the manual 15 3. Binders 16 a. Commercial quality 3-ring binders with durable and cleanable plastic covers 17 b. When multiple binders are used, correlate the data into related consistent 18 groupings. 19 4. If available, provide an electronic form of the O&M Manual. 20 B. Manual Content 21 1. Neatly typewritten table of contents for each volume, arranged in systematic order 22 a. Contractor, name of responsible principal, address and telephone number 23 b. A list of each product required to be included, indexed to content of the volume 24 c. List, with each product: 25 1) The name, address and telephone number of the subcontractor or installer 26 2) A list of each product required to be included, indexed to content of the 27 volume 28 3) Identify area of responsibility of each 29 4) Local source of supply for parts and replacement 30 d. Identify each product by product name and other identifying symbols as set 31 forth in Contract Documents. 32 2. Product Data 33 a. Include only those sheets which are pertinent to the specific product. 34 b. Annotate each sheet to: 35 1) Clearly identify specific product or part installed 36 2) Clearly identify data applicable to installation 37 3) Delete references to inapplicable information 38 3. Drawings 39 a. Supplement product data with drawings as necessary to clearly illustrate: 40 1) Relations of component parts of equipment and systems 41 2) Control and flow diagrams 42 b. Coordinate drawings with information in Project Record Documents to assure 43 correct illustration of completed installation. 44 c. Do not use Project Record Drawings as maintenance drawings. 45 4. Written text, as required to supplement product data for the particular installation: 46 a. Organize in consistent format under separate headings for different procedures. 47 b. Provide logical sequence of instructions of each procedure. 48 01 78 23 - 3 DAP OPERATION AND MAINTENANCE DATA Page 3 of 5 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 5. Copy of each warranty, bond and service contract issued 1 a. Provide information sheet for City personnel giving: 2 1) Proper procedures in event of failure 3 2) Instances which might affect validity of warranties or bonds 4 C. Manual for Materials and Finishes 5 1. Submit 5 copies of complete manual in final form. 6 2. Content, for architectural products, applied materials and finishes: 7 a. Manufacturer's data, giving full information on products 8 1) Catalog number, size, composition 9 2) Color and texture designations 10 3) Information required for reordering special manufactured products 11 b. Instructions for care and maintenance 12 1) Manufacturer's recommendation for types of cleaning agents and methods 13 2) Cautions against cleaning agents and methods which are detrimental to 14 product 15 3) Recommended schedule for cleaning and maintenance 16 3. Content, for moisture protection and weather exposure products: 17 a. Manufacturer's data, giving full information on products 18 1) Applicable standards 19 2) Chemical composition 20 3) Details of installation 21 b. Instructions for inspection, maintenance and repair 22 D. Manual for Equipment and Systems 23 1. Submit 5 copies of complete manual in final form. 24 2. Content, for each unit of equipment and system, as appropriate: 25 a. Description of unit and component parts 26 1) Function, normal operating characteristics and limiting conditions 27 2) Performance curves, engineering data and tests 28 3) Complete nomenclature and commercial number of replaceable parts 29 b. Operating procedures 30 1) Start-up, break-in, routine and normal operating instructions 31 2) Regulation, control, stopping, shut-down and emergency instructions 32 3) Summer and winter operating instructions 33 4) Special operating instructions 34 c. Maintenance procedures 35 1) Routine operations 36 2) Guide to "trouble shooting" 37 3) Disassembly, repair and reassembly 38 4) Alignment, adjusting and checking 39 d. Servicing and lubrication schedule 40 1) List of lubricants required 41 e. Manufacturer's printed operating and maintenance instructions 42 f. Description of sequence of operation by control manufacturer 43 1) Predicted life of parts subject to wear 44 2) Items recommended to be stocked as spare parts 45 g. As installed control diagrams by controls manufacturer 46 h. Each contractor's coordination drawings 47 1) As installed color coded piping diagrams 48 01 78 23 - 4 DAP OPERATION AND MAINTENANCE DATA Page 4 of 5 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 i. Charts of valve tag numbers, with location and function of each valve 1 j. List of original manufacturer's spare parts, manufacturer's current prices, and 2 recommended quantities to be maintained in storage 3 k. Other data as required under pertinent Sections of Specifications 4 3. Content, for each electric and electronic system, as appropriate: 5 a. Description of system and component parts 6 1) Function, normal operating characteristics, and limiting conditions 7 2) Performance curves, engineering data and tests 8 3) Complete nomenclature and commercial number of replaceable parts 9 b. Circuit directories of panelboards 10 1) Electrical service 11 2) Controls 12 3) Communications 13 c. As installed color coded wiring diagrams 14 d. Operating procedures 15 1) Routine and normal operating instructions 16 2) Sequences required 17 3) Special operating instructions 18 e. Maintenance procedures 19 1) Routine operations 20 2) Guide to "trouble shooting" 21 3) Disassembly, repair and reassembly 22 4) Adjustment and checking 23 f. Manufacturer's printed operating and maintenance instructions 24 g. List of original manufacturer's spare parts, manufacturer's current prices, and 25 recommended quantities to be maintained in storage 26 h. Other data as required under pertinent Sections of Specifications 27 4. Prepare and include additional data when the need for such data becomes apparent 28 during instruction of City's personnel. 29 1.7 CLOSEOUT SUBMITTALS [NOT USED] 30 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 31 1.9 QUALITY ASSURANCE 32 A. Provide operation and maintenance data by personnel with the following criteria: 33 1. Trained and experienced in maintenance and operation of described products 34 2. Skilled as technical writer to the extent required to communicate essential data 35 3. Skilled as draftsman competent to prepare required drawings 36 01 78 23 - 5 DAP OPERATION AND MAINTENANCE DATA Page 5 of 5 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 1.10 DELIVERY, STORAGE, AND HANDLING [NOT USED] 1 1.11 FIELD [SITE] CONDITIONS [NOT USED] 2 1.12 WARRANTY [NOT USED] 3 PART 2 - PRODUCTS [NOT USED] 4 PART 3 - EXECUTION [NOT USED] 5 END OF SECTION 6 7 Revision Log DATE NAME SUMMARY OF CHANGE 8/31/2012 D. Johnson 1.5.A.1 – title of section removed 4/7/2014 M.Domenech Revised for DAP Application 8 01 78 39 - 1 DAP PROJECT RECORD DOCUMENTS Page 1 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 SECTION 01 78 39 1 PROJECT RECORD DOCUMENTS 2 PART 1 - GENERAL 3 1.1 SUMMARY 4 A. Section Includes: 5 1. Work associated with the documenting the project and recording changes to project 6 documents, including: 7 a. Record Drawings 8 b. Water Meter Service Reports 9 c. Sanitary Sewer Service Reports 10 d. Large Water Meter Reports 11 B. Deviations from this City of Fort Worth Standard Specification 12 1. None. 13 C. Related Specification Sections include, but are not necessarily limited to: 14 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 15 2. Division 1 – General Requirements 16 1.2 PRICE AND PAYMENT PROCEDURES 17 A. Measurement and Payment 18 1. Work associated with this Item is considered subsidiary to the various Items bid. 19 No separate payment will be allowed for this Item. 20 1.3 REFERENCES [NOT USED] 21 1.4 ADMINISTRATIVE REQUIREMENTS [NOT USED] 22 1.5 SUBMITTALS 23 A. Prior to submitting a request for Final Inspection, deliver Project Record Documents to 24 City’s Project Representative. 25 1.6 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS [NOT USED] 26 1.7 CLOSEOUT SUBMITTALS [NOT USED] 27 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 28 1.9 QUALITY ASSURANCE 29 A. Accuracy of Records 30 1. Thoroughly coordinate changes within the Record Documents, making adequate 31 and proper entries on each page of Specifications and each sheet of Drawings and 32 other Documents where such entry is required to show the change properly. 33 2. Accuracy of records shall be such that future search for items shown in the Contract 34 Documents may rely reasonably on information obtained from the approved Project 35 Record Documents. 36 01 78 39 - 2 DAP PROJECT RECORD DOCUMENTS Page 2 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 3. To facilitate accuracy of records, make entries within 24 hours after receipt of 1 information that the change has occurred. 2 4. Provide factual information regarding all aspects of the Work, both concealed and 3 visible, to enable future modification of the Work to proceed without lengthy and 4 expensive site measurement, investigation and examination. 5 1.10 STORAGE AND HANDLING 6 A. Storage and Handling Requirements 7 1. Maintain the job set of Record Documents completely protected from deterioration 8 and from loss and damage until completion of the Work and transfer of all recorded 9 data to the final Project Record Documents. 10 2. In the event of loss of recorded data, use means necessary to again secure the data 11 to the City's approval. 12 a. In such case, provide replacements to the standards originally required by the 13 Contract Documents. 14 1.11 FIELD [SITE] CONDITIONS [NOT USED] 15 1.12 WARRANTY [NOT USED] 16 PART 2 - PRODUCTS 17 2.1 OWNER-FURNISHED [OR] OWNER-SUPPLIED PRODUCTS [NOT USED] 18 2.2 RECORD DOCUMENTS 19 A. Job set 20 1. Promptly following receipt of the Notice to Proceed, secure from the City, at no 21 charge to the Contractor, 1 complete set of all Documents comprising the Contract. 22 B. Final Record Documents 23 1. At a time nearing the completion of the Work and prior to Final Inspection, provide 24 the City 1 complete set of all Final Record Drawings in the Contract. 25 2.3 ACCESSORIES [NOT USED] 26 2.4 SOURCE QUALITY CONTROL [NOT USED] 27 PART 3 - EXECUTION 28 3.1 INSTALLERS [NOT USED] 29 3.2 EXAMINATION [NOT USED] 30 3.3 PREPARATION [NOT USED] 31 3.4 MAINTENANCE DOCUMENTS 32 A. Maintenance of Job Set 33 1. Immediately upon receipt of the job set, identify each of the Documents with the 34 title, "RECORD DOCUMENTS - JOB SET". 35 01 78 39 - 3 DAP PROJECT RECORD DOCUMENTS Page 3 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 2. Preservation 1 a. Considering the Contract completion time, the probable number of occasions 2 upon which the job set must be taken out for new entries and for examination, 3 and the conditions under which these activities will be performed, devise a 4 suitable method for protecting the job set. 5 b. Do not use the job set for any purpose except entry of new data and for review 6 by the City, until start of transfer of data to final Project Record Documents. 7 c. Maintain the job set at the site of work. 8 3. Coordination with Construction Survey 9 a. At a minimum clearly mark any deviations from Contract Documents 10 associated with installation of the infrastructure. 11 4. Making entries on Drawings 12 a. Record any deviations from Contract Documents. 13 b. Use an erasable colored pencil (not ink or indelible pencil), clearly describe the 14 change by graphic line and note as required. 15 c. Date all entries. 16 d. Call attention to the entry by a "cloud" drawn around the area or areas affected. 17 e. In the event of overlapping changes, use different colors for the overlapping 18 changes. 19 5. Conversion of schematic layouts 20 a. In some cases on the Drawings, arrangements of conduits, circuits, piping, 21 ducts, and similar items, are shown schematically and are not intended to 22 portray precise physical layout. 23 1) Final physical arrangement is determined by the Contractor, subject to the 24 City's approval. 25 2) However, design of future modifications of the facility may require 26 accurate information as to the final physical layout of items which are 27 shown only schematically on the Drawings. 28 b. Show on the job set of Record Drawings, by dimension accurate to within 1 29 inch, the centerline of each run of items. 30 1) Final physical arrangement is determined by the Contractor, subject to the 31 City's approval. 32 2) Show, by symbol or note, the vertical location of the Item ("under slab", "in 33 ceiling plenum", "exposed", and the like). 34 3) Make all identification sufficiently descriptive that it may be related 35 reliably to the Specifications. 36 c. The City may waive the requirements for conversion of schematic layouts 37 where, in the City's judgment, conversion serves no useful purpose. However, 38 do not rely upon waivers being issued except as specifically issued in writing 39 by the City. 40 B. Final Project Record Documents 41 1. Transfer of data to Drawings 42 a. Carefully transfer change data shown on the job set of Record Drawings to the 43 corresponding final documents, coordinating the changes as required. 44 b. Clearly indicate at each affected detail and other Drawing a full description of 45 changes made during construction, and the actual location of items. 46 c. Call attention to each entry by drawing a "cloud" around the area or areas 47 affected. 48 01 78 39 - 4 DAP PROJECT RECORD DOCUMENTS Page 4 of 4 CITY OF FORT WORTH Lakes of River Trails East Phase 17A STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. - 102275 Revised April 7, 2014 d. Make changes neatly, consistently and with the proper media to assure 1 longevity and clear reproduction. 2 2. Transfer of data to other Documents 3 a. If the Documents, other than Drawings, have been kept clean during progress of 4 the Work, and if entries thereon have been orderly to the approval of the City, 5 the job set of those Documents, other than Drawings, will be accepted as final 6 Record Documents. 7 b. If any such Document is not so approved by the City, secure a new copy of that 8 Document from the City at the City's usual charge for reproduction and 9 handling, and carefully transfer the change data to the new copy to the approval 10 of the City. 11 3.5 REPAIR / RESTORATION [NOT USED] 12 3.6 RE-INSTALLATION [NOT USED] 13 3.7 FIELD [OR] SITE QUALITY CONTROL [NOT USED] 14 3.8 SYSTEM STARTUP [NOT USED] 15 3.9 ADJUSTING [NOT USED] 16 3.10 CLEANING [NOT USED] 17 3.11 CLOSEOUT ACTIVITIES [NOT USED] 18 3.12 PROTECTION [NOT USED] 19 3.13 MAINTENANCE [NOT USED] 20 3.14 ATTACHMENTS [NOT USED] 21 END OF SECTION 22 23 Revision Log DATE NAME SUMMARY OF CHANGE 4/7/2014 M.Domenech Revised for DAP Application 24 CITYOFFORT WORTH WATER DEPARTMENT'SSTANDARD PRODUCTS LIST33 05 13 Manhole Insert Knutson Enterprises Made to Order - Plastic ASTM D 124833 05 13 Manhole Insert South Western Packaging Made to Order - Plastic ASTM D 1248 33 05 13 Manhole Insert Noflow-Inflow Made to Order - Plastic ASTM D 1248 33 05 13 Manhole Insert Southwestern Packing & Seals, Inc. LifeSaver - Stainless Steel 33 05 13 Manhole Insert Southwestern Packing & Seals, Inc. TetherLok - Stainless Steel anholes & Bases/Frames & Covers/Rectangular 33-05-13 (Rev 2/3/16) 33 05 13 Manhole Frames and Covers Western Iron Works, Bass & Hays Foundry 1001 anholes & Bases/Frames & Covers/Standard (Round) 33-05-13 (Rev 2/3/16) 33 05 13 Manhole Frames and Covers Western Iron Works, Bass & Hays Foundry 30024 33 05 13 Manhole Frames and Covers McKinley Iron Works Inc. A 24 AM 33 05 13 Manhole Frames and Covers Neenah Casting 33 05 13 Manhole Frames and Covers Sigma Corporation MH-144N 33 05 13 Manhole Frames and Covers Sigma Corporation MH-143N 33 05 13 Manhole Frames and Covers Pont-A-Mousson GTS-STD 33 05 13 Manhole Frames and Covers Neenah Casting 33 05 13 Manhole Frames and Covers (Hinged) Powerseal Hinged Ductile Iron Manhole ASTM A536 33 05 13 Manhole Frames and Covers Saint-Gobain Pipelines (Pamrex/rexus) RE32-R8FS 33 05 13 30" DI MH Ring and Cover East Jordan Iron Works V1432-2 and V1483 Designs AASHTO M306-04 33 05 13 30" DI MH Ring and Cover Sigma Corporation MH1651FWN & MH16502 33 05 13 30" DI MH Ring and Cover Star Pipe Products MH32FTWSS-DC 33 05 13 30" DI MH Ring and Cover Accucast 220700 Heavy Duty with Gasket Ring 33 05 13 30" DI MH Ring and Cover (Hinged & Lockable) East Jordan Iron Works with Cam Lock/MPIC/T-Gasket ASSHTO M105 & ASTM A536 34 05 13 30" DI MH Ring and Cover (Hinged & Lockable) CI SIP Industries 2280 (32")ASTM A 48 33 05 13.01 30" DI MH Ring and Cover (Hinge & Lock) Composite SewperCover and Cover w/Lock HD/FRP Composite anholes & Bases/Frames & Covers/Water Tight & Pressure Tight 33-05-13 (Rev 2/3/16 33 05 13 Manhole Frames and Covers Pont-A-Mousson Pamtight 33 05 13 Manhole Frames and Covers Neenah Casting 33 05 13 Manhole Frames and Covers Western Iron Works,Bass & Hays Foundry 300-24P 33 05 13 Manhole Frames and Covers McKinley Iron Works Inc. WPA24AM 33 05 13 Manhole Frames and Covers Accucast RC-2100 ASTM A 48 33 05 13 Manhole Frames and Covers (SIP)Serampore Industries Private Ltd. 300-24-23.75 Ring and Cover ASTM A 48 anholes & Bases/New/Components 33-39-10 (Rev 2/3/16) 33 05 13 Urethane Hydrophilic Waterstop Asahi Kogyo K.K. Adeka Ultra-Seal P-201 ASTM D2240/D412/D792 33 05 13 Offset Joint for 4' Diam. MH Hanson Concrete Products Drawing No. 35-0048-001 33 05 13 Profile Gasket for 4' Diam. MH. Press-Seal Gasket Corp. 250-4G Gasket ASTM C-443/C-361 33 05 13 HDPE Manhole Adjustment Rings Ladtech, Inc HDPE Adjustment Ring N 33 05 13 Manhole External Wrap Canusa - CPS WrapidSeal Manhole Encapsulation System anholes & Bases/New/Precast Concrete (Rev 1/8/13) 33 39 10 Manhole, Precast Concrete Hydro Conduit Corp SPL Item #49 ASTM C 478 33 39 10 Manhole, Precast Concrete Wall Concrete Pipe Co. Inc. ASTM C-443 33 39 10 Manhole, Precast Concrete Forterra(formerly Gifford-Hill, Hanson ) ASTM C 478 33 39 10 MH, Single Offset Seal Joint Forterra(formerly Gifford-Hill, Hanson ) Type F Dwg 35-0048-001 ASTM C 478 33 39 10 Manhole, Precast Concrete Concrete Product Inc. 48" I.D. Manhole w/ 32" Cone ASTM C 478 33 39 10 Manhole, Precast Concrete The Turner Company 48", 60" I.D. Manhole w/ 32" Cone ASTM C 478 33 39 10 Manhole, Precast Concrete Oldcastle Precast Inc. 48" I.D. Manhole w/ 24" Cone ASTM C 478 48" 33 39 10 Manhole, Precast (Reinforce Polymer)Concrete US Composite Pipe Reinforced Polymer Concrete ASTM C-76 anholes & Bases/New/Fiberglass 33-39-13 (1/8/13) 33 39 13 Fiberglass Manhole Fluid Containment, Inc. Flowtite ASTM 3753 N 33 39 13 Fiberglass Manhole L.F. Manufacturing N anholes & Bases/Rehab Systems/Cementitious E1-14 Manhole Rehab Systems Quadex E1-14 Manhole Rehab Systems Standard Cement Materials, Inc. Reliner MSP E1-14 Manhole Rehab Systems AP/M Permaform E1-14 Manhole Rehab System Strong Company Strong Seal MS2A Rehab System E1-14 Manhole Rehab System (Liner) Poly-triplex Technologies MH repair product to stop infiltration ASTM D5813 General Concrete Repair FlexKrete Technologies Vinyl Polyester Repair Product anholes & Bases/Rehab Systems/NonCementitious E1-14 Manhole Rehab Systems Sprayroq, Spray Wall Polyurethane Coating ASTM D639/D790 E1-14 Manhole Rehab Systems Sun Coast Coating for Corrosion protection(Exterior) ERTECH Series 20230 and 2100 (Asphatic Emulsion) For Conc Coatings for Corrosion Protection Chesterton Arc 791, S1HB, S1, S2 Acid Resistance Test Se Coatings for Corrosion Protection Warren Environmental S-301 and M-301 Se Coatings for Corrosion Protection Citadel SLS-30 Solids Epoxy Se 05 16, 33 39 0, 33 39 20 Coating for Corrosion protection(Exterior) Sherwin Williams RR&C Dampproofing Non-Fibered Spray Grade (Asphatic Emulsion) For Conc pe/New/Centrifugally Cast Fiberglass Reinforced Pipe 33-31-13(1/8/13) 33 31 13 Cent. Cast Fiberglass Hobas Pipe USA, Inc. Hobas Pipe (Non-Pressure) ASTM D3262/D3754 33 31 13 Fiberglass Pipe Ameron Bondstrand RPMP Pipe ASTM D3262/D3754 Gl ib i f d l i A i h SA l i AS / CITYOFFORT WORTH WATER DEPARTMENT'SSTANDARD PRODUCTS LISTgypyyppHigh-density polyethylene pipe Polly Pipe, Inc. ASTM D 1248 High-density polyethylene pipe CSR Hydro Conduit/Pipeline Systems McConnell Pipe Enlargement ASTM D 1248 pes/New/PVC* 33-31-20 (7/1/13) 33-31-20 PVC Sewer Pipe Certain-Teed Products Corp ASTM D 3034 33-31-20 PVC Sewer Pipe Napco Manufacturing Corp ASTM D 3034, D 1784 33-31-20 PVC Sewer Pipe J-M Manufacturing Co., Inc. (JM Eagle) ASTM D 3034 33-31-20 PVC Sewer Pipe Diamond Plastics Corporation SDR-26 and SDR-35 ASTM F 789, ASTM D 3034 33-31-20 PVC Sewer Pipe Lamson Vylon Pipe ASTM F 789 33-31-20 PVC Sewer Pipe Royal Building Products Royal Seal Solid Wall Pipe SDR 26 & 35 ASTM 3034 33-31-20 PVC Sewer Pipe Vinyltech PVC Pipe Gravity Sewer ASTM D3034 33-31-20 PVC Sewer Pipe Diamond Plastics Corporation "S" Gravity Sewer Pipe ASTM F 679 33-31-20 PVC Sewer Pipe J-M Manufacturing Co, Inc. (JM Eagle) ASTM F 679 33-31-20 PVC Sewer Pipe Pipelife Jet Stream SDR-26 and SDr-35 ASTM F-679 33-31-20 PVC Solid Wall Pipe Diamond Plastics Corporation PS 46 ASTM F-679 33-31-20 PVC Sewer Fittings Harco SDR-26 and SDR-35 Gasket Fittings ASTM D-3034, D-1784, etc 33-31-20 PVC Sewer Fittings Plastic Trends, In.c Gasketed PVC Sewer Main Fittings ASTM D 3034 E100-2 Closed Profile PVC Pipe Diamond Plastics Corporation ASTM 1803/F794 33 31 20 PVC Sewer Pipe Pipelife Jet Stream SDR 35 ASTM F679 33 31 20 PVC Sewer Pipe Pipelife Jet Stream SDR 26 ASTM D3034 pes/New/Ribbed Open Profile Large Diameter E100-2 PVC Sewer Pipe, Ribbed Lamson Vylon Pipe Carlon Vylon H.C. Closed Profile Pipe, ASTM F 679 E100-2 PVC Sewer Pipe, Ribbed Extrusion Technologies, Inc. Ultra-Rib Open Profile Sewer Pipe ASTM F 679 E100-2 PVC Sewer Pipe, Ribbed Uponor ETI Company (E100-2) Polypropylene (PP) Sewer Pipe, Double Wall Advanced Drainage Systems (ADS) SaniTite HP Double Wall (Corrugated) ASTM F 2736 (E100-2) Polypropylene (PP) Sewer Pipe, Triple Wall Advanced Drainage Systems (ADS) SaniTite HP Triple Wall Pipe ASTM F 2764 Steel Reinforced Polyethylene Pipe ConTech Construction Products Durmaxx ASTM F 2562 pes/Rehab/CIPP 33-31-12 (01/18/13) Cured in Place Pipe Insituform Texark, Inc ASTM F 1216 Cured in Place Pipe National Envirotech Group National Liner, (SPL) Item #27 ASTM F-1216/D-5813 Cured in Place Pipe Reynolds Inc/Inliner Technolgy (Inliner USA)Inliner Technology ASTM F 1216 pes/Rehab/Fold & Form Fold and Form Pipe Cullum Pipe Systems, Inc. Fold and Form Pipe Insituform Technologies, Inc. Insituform "NuPIpe" ASTM F-1504 Fold and Form Pipe American Pipe & Plastics, Inc.De Fold and Form Pipe Ultraliner Ultraliner PVC Alloy Pipeliner ASTM F-1504, 1871, 1867 Fold and Form Pipe Miller Pipeline Corp. EX Method ASTM F-1504, F-1947 U pe Enlargment System (Method)33-31-23 (01/18/13) PIM System PIM Corporation Polyethylene PIM Corp., Piscata Way, N.J. Ap McConnell Systems McLat Construction Polyethylene Houston, Texas Ap TRS Systems Trenchless Replacement System Polyethylene Calgary, Canada Ap pe Casing Spacers 33-05-24 (07/01/13) Steel Band Casing Spacers Advanced Products and Systems, Inc. Carbon Steel Spacers, Model SI Stainless Steel Casing Spacer Advanced Products and Systems, Inc. Stainless Steel Spacer, Model SSI Casing Spacers Cascade Waterworks Manufacturing Casing Spacers Stainless Steel Casing Spacer Pipeline Seal and Insulator Stainless Steel Casing Spacer U Coated Steel Casin Spacers Pipeline Seal and Insulator Coated Steel Casin Spacers U Stainless Steel Casing Spacer Powerseal 4810 Powerchock U Casing Spacers BWM SS-12 Casing Spacer(Stainless Steel) Casing Spacers BWM FB-12 Casing Spacer(Coated Carbon Steel) for Non_pressure Pipe and Grouted Casing atings/Epoxy 33-39-60 (01/08/13) Epoxy Lining System Sauereisen, Inc SewerGard 210RS LA County #210-1.33 Epoxy Lining System Ertech Technical Coatings Ertech 2030 and 2100 Series Interior Ductile Iron Pipe Coating Induron Protecto 401 ASTM B-117 Duc Coatings for Corrosion Protection Chesterton Arc 791, S1HB, S1, S2 Acid Resistance Test Se Coatings for Corrosion Protection Warren Environmental S-301 and M-301 Se atings/Polyurethane e mbination Air Valves for Sanitary Sewer Force Mains 33-31-70 Air Release Valve A.R.I. USA, Inc. D025LTP02(Composite Body) WATER pes/33-31-70 (01/08/13) 33-11-12 PVC Pressure Pipe Vinyltech PVC Pipe AWWA C900, AWWA C605, ASTM D1784 33 11 12 PVC Pressure Pipe Pipelife Jet Stream DR14 AWWA C900 33 11 12 PVC Pressure Pipe Pipelife Jet Stream DR18 AWWA C900 34 11 12 PVC Pressure Pipe Diamond Plastics Corporation DR 14 AWWA C900 34 11 12 PVC Pressure Pipe Diamond Plastics Corporation Trans 21, DR 14, DR 18 AWWA C900 pes/Valves & Fittings/Combination Air Release 33-31-70 (01/08/13) E1-11 Combination Air Release Valve GA Industries, Inc. Empire Air and Vacuum Valve, Model 935 ASTM A 126 Class B, ASTM A E1-11 Combination Air Release Valve Multiplex Manufacturing Co. Crispin Air and Vacuum Valves, Model No. A5, A10 & A20 CITYOFFORT WORTH WATER DEPARTMENT'SSTANDARD PRODUCTS LIST33-11-11 Mechanical Joint Retainer Glands SIP Industries(Serampore)EZ Grip Joint Restraint (EZD) Red for C900 DR18 PVC Pipe ASTM A536 AWWA C111 OLTS, NUTS, AND GASKETS 33-11-05 (01/08/13) pes/Valves & Fittings/Resilient Seated Gate Valve* 33-12-20 (05/13/15) Resilient Wedged Gate Valve w/no Gears American Flow Control Series 2500 Drawing # 94-20247 Resilient Wedge Gate Valve American Flow Control Series 2530 and Series 2536 AWWA C515 Resilient Wedge Gate Valve American Flow Control Series 2520 & 2524 (SD 94-20255) AWWA C515 Resilient Wedge Gate Valve American Flow Control Series 2516 (SD 94-20247) AWWA C515 E1-26 Resilient Wedge Gate Valve American Flow Control Series 2500 (Ductile Iron) AWWA C515 Resilient Wedge Gate Valve American Flow Control 42" and 48" AFC 2500 AWWA C515 E1-26 Resilient Wedge Gate Valve American AVK Company American AVK Resilient Seaded GV AWWA C509 E1-26 Resilient Wedge Gate Valve American AVK Company E1-26 Resilient Seated Gate Valve Kennedy E1-26 Resilient Seated Gate Valve M&H E1-26 Resilient Seated Gate Valve Mueller Co. Resilient Wedge Gate Valve Mueller Co. Series A2361 (SD 6647) AWWA C515 Resilient Wedge Gate Valve Mueller Co. Series A2360 for 18"-24" (SD 6709) AWWA C515 Resilient Wedge Gate Valve Mueller Co. Mueller 30" & 36", C-515 AWWA C515 Resilient Wedge Gate Valve Mueller Co. Mueller 42" & 48", C-515 AWWA C515 E1-26 Resilient Wedge Gate Valve Clow Valve Co. AWWA C509 Resilient Wedge Gate Valve Clow Valve Co. 16" RS GV (SD D-20995) AWWA C515 E1-26 Resilient Wedge Gate Valve Clow Valve Co. Clow RW Valve (SD D-21652) AWWA C515 Resilient Wedge Gate Valve Clow Valve Co. Clow 30" & 36" C-515 AWWA C515 30 Resilient Wedge Gate Valve Clow Valve Co. Clow Valve Model 2638 AWWA C515 24 E1-26 Resilient Seated Gate Valve Stockham Valves & Fittings AWWA C 509, ANSI 420 - stem, ASTM lE1-26 Resilient Seated Gate Valve U.S. Pipe and Foundry Co.Metroseal 250, requirements SPL #74 33-12-20 Resilient Seated Gate Valve EJ (East Jordan Iron Works)EJ FlowMaster Gate Valve & Boxes pes/Valves & Fittings/Rubber Seated Butterfly Valve 33-12-21 (07/10/14) E1-30 Rubber Seated Butterfly Valve Henry Pratt Co. AWWA C-504 E1-30 Rubber Seated Butterfly Valve Mueller Co.AWWA C-504 E1-30 Rubber Seated Butterfly Valve Dezurik Valves Co. AWWA C-504 E1-30 Valmatic American Butterfly Valve Valmatic Valve and Manufacturing Corp. Valmatic American Butterfly Valve. AWWA C-504 U E1-30 Rubber Seated Butterfly Valve M&H Valve M&H Style 4500 & 1450 AWWA C-504 33 12 21 Rubber Seated Butterfly Valve G. A. Industries (Golden Anderson) AWWA C504 Butterfly Valve AWWA C-504 mpling Station Water Sampling Station Water Plus B20 Water Sampling Station y Barrel Fire Hydrants 33-12-40 (01/15/14) E-1-12 Dry Barrel Fire Hydrant American-Darling Valve Drawing Nos. 90-18608, 94-18560 AWWA C-502 E-1-12 Dry Barrel Fire Hydrant American Darling Valve Shop Drawing No. 94-18791 AWWA C-502 E-1-12 Dry Barrel Fire Hydrant Clow Corporation Shop Drawing No. D-19895 AWWA C-502 E-1-12 Dry Barrel Fire Hydrant American AVK Company Model 2700 AWWA C-502 E-1-12 Dry Barrel Fire Hydrant Clow Corporation Drawings D20435, D20436, B20506 AWWA C-502 E-1-12 Dry Barrel Fire Hydrant ITT Kennedy Valve Shop Drawing No. D-80783FW AWWA C-502 E-1-12 Dry Barrel Fire Hydrant M&H Valve Company Shop Drawing No. 13476 AWWA C-502 E-1-12 Dry Barrel Fire Hydrant Mueller Company Shop Drawings No. 6461 A-423 Centurion AWWA C-502 E1-12 Dry Barrel Fire Hydrant Mueller Company Shop Drawing FH-12 A-423 Super Centurion 200 AWWA C-502 E-1-12 Dry Barrel Fire Hydrant U.S. Pipe & Foundry Shop Drawing No. 960250 AWWA C-502 E-1-12 Dry Barrel Fire Hydrant Waterous Company Shop Drawing No. SK740803 AWWA C-502 33-12-40 Dry Barrel Fire Hydrant EJ (East Jordan Iron Works)WaterMaster 5CD250 ater Appurtenances 33-12-10 (07/01/13) 33-12-10 Double Strap Saddle Romac 202NS Nylon Coated AWWA C800 1"-2" Double Strap Saddle Smith Blair #317 Nylon Coated Double Strap Saddle 33-12-10 Double Strap Service Saddle Mueller Company DR2S Double (SS) Strap DI Saddle AWWA C800 1"-2" Curb Stops-Ball Meter Valves McDonald 6100M,6100MT & 610MT Curb Stops-Ball Meter Valves McDonald 4603B, 4604B, 6100M, 6100TM and 6101M 33-12-10 Curb Stops-Ball Meter Valves Ford Meter Box Co., Inc. FB600-7NL, FB1600-7-NL, FV23-777-W-NL, L22-77NL AWWA C800 33-12-10 Curb Stops-Ball Meter Valves Ford Meter Box Co., Inc. FB600-6-NL, FB1600-6-NL, FV23-666-W-NL, L22-66NL AWWA C800 33-12-10 Curb Stops-Ball Meter Valves Ford Meter Box Co., Inc. FB600-4-NL, FB1600-4-NL, B11-444-WR-NL, B22444-WR-NL, L28-44NL AWWA C800 33-12-10 Curb Stops-Ball Meter Valves Mueller Co., Ltd. B-25000N, B-24277N-3, B-20200N-3, H- 15000N, , H-1552N, H142276N AWWA C800, ANSF 61, ANSI/NSF 372 33-12-10 Curb Stops-Ball Meter Valves Mueller Co., Ltd. B-25000N, B-20200N-3, B-24277N-3,H- 15000N, H-14276N, H-15525N AWWA C800, ANSF 61, ANSI/NSF 372 33-12-10 Curb Stops-Ball Meter Valves Mueller Co., Ltd.B-25000N, B-20200N-3,H-15000N, H-15530N AWWA C800, ANSF 61, ANSI/NSF 372 Coated Tapping Saddle with Double SS Straps JCM Industries, Inc. #406 Double Band SS Saddle 1"-2 33-12-25 Tapping Sleeve (Coated Steel) JCM Industries, Inc. 412 Tapping Sleeve ESS AWWA C-223 Up CITYOFFORT WORTH WATER DEPARTMENT'SSTANDARD PRODUCTS LISTpp , p y pp p r Department’s Standard Products List has been developed to minimize the submittal review of products which meet the Fort Worth Water Department’s Standard Specifications during utility construction projects. When cific products, are included as part of the Construction Contract Documents, the requirements of the Technical Specification will override the Fort Worth Water Department’s Standard Specifications and the Fort Worth Wa t and approval of the specific products will be based on the requirements of the Technical Specification whether or not the specific product meets the Fort Worth Water Department’s Standard Specifications or is on the For d Products List. pe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.