Loading...
HomeMy WebLinkAbout055588-PM1 - Construction-Related - Contract - FG Aledo Development, Inc. and D.T. Utility Contractors, Inc.PROJECT MANUAL FOR THE CONSTRUCTION OF Water Main and Sewer Main Extensions to Serve East Parker County Subcourthouse IPRC Record No. 20-099 City Project No. 102824 FID No. J0114-0200431-102824-E07685 X File No. X-26663 Betsy Price David Cooke Mayor City Manager Christopher P. Harder, P.E. Director, Water Department William Johnson Director, Transportation and Public Works Department Prepared for The City of Fort Worth January 2021 949 Hilltop Drive, Weatherford, Texas 76086 Texas Registered Engineering Firm F-000044 Phone (817) 596-7575, Fax (817) 887-3016 2021-04-01 CSC No. 55588-PM1 00 00 00 STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS Page 1 of 5 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. 102824 Revised March 20, 2020 SECTION 00 00 10 TABLE OF CONTENTS DEVELOPER AWARDED PROJECTS Division 00 - General Conditions Last Revised 00 11 13 Invitation to Bidders 03/20/2020 00 21 13 Instructions to Bidders 03/20/2020 00 41 00 Bid Form 04/02/2014 00 42 43 Proposal Form 05/22/2019 00 43 13 Bid Bond 04/02/2014 00 45 11 Bidders Prequalification’s 04/02/2014 00 45 12 Prequalification Statement 09/01/2015 00 45 13 Bidder Prequalification Application 03/09/2020 00 45 26 Contractor Compliance with Workers' Compensation Law 04/02/2014 00 45 40 Minority Business Enterprise Goal 08/21/2018 00 52 43 Agreement 06/16/2016 00 61 25 Certificate of Insurance 07/01/2011 00 62 13 Performance Bond 01/31/2012 00 62 14 Payment Bond 01/31/2012 00 62 19 Maintenance Bond 01/31/2012 00 72 00 General Conditions 11/15/2017 00 73 00 Supplementary Conditions 07/01/2011 00 73 10 Standard City Conditions of the Construction Contract for Developer Awarded Projects 01/10/2013 Division 01 - General Requirements Last Revised 01 11 00 Summary of Work 12/20/2012 01 25 00 Substitution Procedures 08/30/2013 01 31 19 Preconstruction Meeting 08/30/2013 01 31 20 Project Meetings 07/01/2011 01 33 00 Submittals 08/30/2013 01 35 13 Special Project Procedures 08/30/2013 01 45 23 Testing and Inspection Services 03/20/2020 01 50 00 Temporary Facilities and Controls 07/01/2011 01 55 26 Street Use Permit and Modifications to Traffic Control 07/01/2011 01 57 13 Storm Water Pollution Prevention Plan 07/01/2011 01 60 00 Product Requirements 03/20/2020 01 66 00 Product Storage and Handling Requirements 04/07/2014 01 70 00 Mobilization and Remobilization 04/07/2014 01 71 23 Construction Staking 04/07/2014 01 74 23 Cleaning 04/07/2014 01 77 19 Closeout Requirements 04/07/2014 01 78 23 Operation and Maintenance Data 04/07/2014 01 78 39 Project Record Documents 04/07/2014 00 00 00 STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS Page 2 of 5 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. 102824 Revised March 20, 2020 Technical Specifications which have been modified by the Engineer specifically for this Project; hard copies are included in the Project’s Contract Documents NONE Technical Specifications listed below are included for this Project by reference and can be viewed/downloaded from the City’s website at: http://fortworthtexas.gov/tpw/contractors/ or https://apps.fortworthtexas.gov/ProjectResources/ Division 02 - Existing Conditions Last Revised 02 41 13 Selective Site Demolition 12/20/2012 02 41 14 Utility Removal/Abandonment 12/20/2012 02 41 15 Paving Removal 02/02/2016 Division 03 - Concrete 03 30 00 Cast-In-Place Concrete 12/20/2012 03 34 13 Controlled Low Strength Material (CLSM) 12/20/2012 03 34 16 Concrete Base Material for Trench Repair 12/20/2012 03 80 00 Modifications to Existing Concrete Structures 12/20/2012 Division 26 - Electrical 26 05 00 Common Work Results for Electrical 11/22/2013 26 05 10 Demolition for Electrical Systems 12/20/2012 26 05 33 Raceways and Boxes for Electrical Systems 12/20/2012 26 05 43 Underground Ducts and Raceways for Electrical Systems 07/01/2011 26 05 50 Communications Multi-Duct Conduit 02/26/2016 Division 31 - Earthwork 31 10 00 Site Clearing 12/20/2012 31 23 16 Unclassified Excavation 01/28/2013 31 23 23 Borrow 01/28/2013 31 24 00 Embankments 01/28/2013 31 25 00 Erosion and Sediment Control 12/20/2012 31 36 00 Gabions 12/20/2012 31 37 00 Riprap 12/20/2012 Division 32 - Exterior Improvements 32 01 17 Permanent Asphalt Paving Repair 12/20/2012 32 01 18 Temporary Asphalt Paving Repair 12/20/2012 32 01 29 Concrete Paving Repair 12/20/2012 32 11 23 Flexible Base Courses 12/20/2012 32 11 29 Lime Treated Base Courses 12/20/2012 32 11 33 Cement Treated Base Courses 12/20/2012 32 11 37 Liquid Treated Soil Stabilizer 08/21/2015 32 12 16 Asphalt Paving 12/20/2012 32 12 73 Asphalt Paving Crack Sealants 12/20/2012 32 13 13 Concrete Paving 12/20/2012 00 00 00 STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS Page 3 of 5 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. 102824 Revised March 20, 2020 32 13 20 Concrete Sidewalks, Driveways and Barrier Free Ramps 06/05/2018 32 13 73 Concrete Paving Joint Sealants 12/20/2012 32 14 16 Brick Unit Paving 12/20/2012 32 16 13 Concrete Curb and Gutters and Valley Gutters 10/05/2016 32 17 23 Pavement Markings 11/22/2013 32 17 25 Curb Address Painting 11/04/2013 32 31 13 Chain Fences and Gates 12/20/2012 32 31 26 Wire Fences and Gates 12/20/2012 32 31 29 Wood Fences and Gates 12/20/2012 32 32 13 Cast-in-Place Concrete Retaining Walls 06/05/2018 32 91 19 Topsoil Placement and Finishing of Parkways 12/20/2012 32 92 13 Hydro-Mulching, Seeding, and Sodding 12/20/2012 32 93 43 Trees and Shrubs 12/20/2012 Division 33 - Utilities 33 01 30 Sewer and Manhole Testing 12/20/2012 33 01 31 Closed Circuit Television (CCTV) Inspection 03/03/2016 33 03 10 Bypass Pumping of Existing Sewer Systems 12/20/2012 33 04 10 Joint Bonding and Electrical Isolation 12/20/2012 33 04 11 Corrosion Control Test Stations 12/20/2012 33 04 12 Magnesium Anode Cathodic Protection System 12/20/2012 33 04 30 Temporary Water Services 07/01/2011 33 04 40 Cleaning and Acceptance Testing of Water Mains 02/06/2013 33 04 50 Cleaning of Sewer Mains 12/20/2012 33 05 10 Utility Trench Excavation, Embedment, and Backfill 12/12/2016 33 05 12 Water Line Lowering 12/20/2012 33 05 13 Frame, Cover and Grade Rings – Cast Iron 01/22/2016 33 05 13.10 Frame, Cover and Grade Rings – Composite 01/22/2016 33 05 14 Adjusting Manholes, Inlets, Valve Boxes, and Other Structures to Grade 12/20/2012 33 05 16 Concrete Water Vaults 12/20/2012 33 05 17 Concrete Collars 12/20/2012 33 05 20 Auger Boring 12/20/2012 33 05 21 Tunnel Liner Plate 12/20/2012 33 05 22 Steel Casing Pipe 12/20/2012 33 05 23 Hand Tunneling 12/20/2012 33 05 24 Installation of Carrier Pipe in Casing or Tunnel Liner Plate 06/19/2013 33 05 26 Utility Markers/Locators 12/20/2012 33 05 30 Location of Existing Utilities 12/20/2012 33 11 05 Bolts, Nuts, and Gaskets 12/20/2012 33 11 10 Ductile Iron Pipe 12/20/2012 33 11 11 Ductile Iron Fittings 12/20/2012 33 11 12 Polyvinyl Chloride (PVC) Pressure Pipe 11/16/2018 33 11 13 Concrete Pressure Pipe, Bar-Wrapped, Steel Cylinder Type 12/20/2012 33 11 14 Buried Steel Pipe and Fittings 12/20/2012 33 12 10 Water Services 1-inch to 2-inch 02/14/2017 33 12 11 Large Water Meters 12/20/2012 33 12 20 Resilient Seated Gate Valve 12/20/2012 33 12 21 AWWA Rubber-Seated Butterfly Valves 12/20/2012 33 12 25 Connection to Existing Water Mains 02/06/2013 33 12 30 Combination Air Valve Assemblies for Potable Water Systems 12/20/2012 00 00 00 STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS Page 4 of 5 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. 102824 Revised March 20, 2020 33 12 40 Fire Hydrants 01/03/2014 33 12 50 Water Sample Stations 12/20/2012 33 12 60 Standard Blow-off Valve Assembly 06/19/2013 33 31 12 Cured in Place Pipe (CIPP) 12/20/2012 33 31 13 Fiberglass Reinforced Pipe for Gravity Sanitary Sewers 12/20/2012 33 31 15 High Density Polyethylene (HDPE) Pipe for Sanitary Sewer 12/20/2012 33 31 20 Polyvinyl Chloride (PVC) Gravity Sanitary Sewer Pipe 06/19/2013 33 31 21 Polyvinyl Chloride (PVC) Closed Profile Gravity Sanitary Sewer Pipe 12/20/2012 33 31 22 Sanitary Sewer Slip Lining 12/20/2012 33 31 23 Sanitary Sewer Pipe Enlargement 12/20/2012 33 31 50 Sanitary Sewer Service Connections and Service Line 04/26/2013 33 31 70 Combination Air Valve for Sanitary Sewer Force Mains 12/20/2012 33 39 10 Cast-in-Place Concrete Manholes 12/20/2012 33 39 20 Precast Concrete Manholes 12/20/2012 33 39 30 Fiberglass Manholes 12/20/2012 33 39 40 Wastewater Access Chamber (WAC) 12/20/2012 33 39 60 Epoxy Liners for Sanitary Sewer Structures 12/20/2012 33 41 10 Reinforced Concrete Storm Sewer Pipe/Culverts 07/01/2011 33 41 11 High Density Polyethylene (HDPE) Pipe for Storm Drain 12/20/2012 33 41 12 Reinforced Polyethlene (SRPE) Pipe 11/13/2015 33 46 00 Subdrainage 12/20/2012 33 46 01 Slotted Storm Drains 07/01/2011 33 46 02 Trench Drains 07/01/2011 33 49 10 Cast-in-Place Manholes and Junction Boxes 12/20/2012 33 49 20 Curb and Drop Inlets 12/20/2012 33 49 40 Storm Drainage Headwalls and Wingwalls 07/01/2011 Division 34 - Transportation 34 41 10 Traffic Signals 10/12/2015 34 41 10.01 Attachment A – Controller Cabinet 12/18/2015 34 41 10.02 Attachment B – Controller Specification 02/2012 34 41 10.03 Attachment C – Software Specification 01/2012 34 41 11 Temporary Traffic Signals 11/22/2013 34 41 13 Removing Traffic Signals 12/20/2012 34 41 15 Rectangular Rapid Flashing Beacon 11/22/2013 34 41 16 Pedestrian Hybrid Signal 11/22/2013 34 41 20 Roadway Illumination Assemblies 12/20/2012 34 41 20.01 Arterial LED Roadway Luminaires 06/15/2015 34 41 20.02 Freeway LED Roadway Luminaires 06/15/2015 34 41 20.03 Residential LED Roadway Luminaires 06/15/2015 34 41 30 Aluminum Signs 11/12/2013 34 41 50 Single-Mode Fiber Optic Cable 02/26/2016 34 71 13 Traffic Control 11/22/2013 00 00 00 STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS Page 5 of 5 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. 102824 Revised March 20, 2020 Appendix GC-4.01 Availability of Lands GC-4.02 Subsurface and Physical Conditions GC-4.04 Underground Facilities GC-4.06 Hazardous Environmental Condition at Site GC-6.06.D Minority and Women Owned Business Enterprise Compliance GC-6.07 Wage Rates GC-6.09 Permits and Utilities GC-6.24 Nondiscrimination GR-01 60 00 Product Requirements END OF SECTION 00 11 13 INVITATION TO BIDDERS Page 1 of 1 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. 102824 Revised March 20, 2020 SECTION 00 11 13 INVITATION TO BIDDERS DEVELOPER AWARDED CONTRACTS FOR PUBLICLY BID PROJECTS ONLY RECEIPT OF BIDS Sealed bids for the construction of the Water Main and Sewer Main Extensions to Serve East Parker County Subcourthouse will be received by the MORNINGSTAR MUNICIPAL UTILITY DISTRICT (M.U.D.): Welch Engineering, Inc. 1308 Norwood Drive, Suite 200 Bedford, Texas 70226 until 9:30 P.M. CST, Friday, February 5, 2021. Bids will be opened publicly and read aloud at 10:00 A.M. CST, Friday, February 5, 2021 at the location above. GENERAL DESCRIPTION OF WORK The major work will consist of the (approximate) following: Approximately 840 linear feet of 12” water Line and approximately 315 linear feet of 8” sanitary sewer extension with 2 additional manholes. PREQUALIFICATION The improvements included in this project must be performed by a contractor who is pre- qualified by the City at the time of bid opening. The procedures for qualification and pre- qualification are outlined in the Section 00 21 13 – INSTRUCTIONS TO BIDDERS. DOCUMENT EXAMINATION AND PROCUREMENTS Copies of the Bidding and Contract Documents may be acquired from Baird, Hampton & Brown, Inc. Contact Jake Hammons, PE at jhammons@bhbinc.com to be sent an ExaVault link to download the required documents. DEVELOPER/CITY'S RIGHT TO ACCEPT OR REJECT BIDS Developer and City reserves the right to waive irregularities and to accept or reject bids. INQUIRIES All inquiries relative to this procurement should be addressed to the following: Attn: Jake Hammons, PE, Baird, Hampton & Brown, Inc. Email: jhammons@bhbinc.com Phone: (817) 596-7575 ADVERTISEMENT DATES January 22, 2021 January 29, 2021 END OF SECTION 00 21 131 INSTRUCTIONS TO BIDDERS Page 1 of 9 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. 102824 Revised March 20, 2020 SECTION 00 21 13 INSTRUCTIONS TO BIDDERS DEVELOPER AWARDED CONTRACTS FOR PUBLICLY BID PROJECTS ONLY 1. Defined Terms 1.1. Certain additional terms used in these INSTRUCTIONS TO BIDDERS have the meanings indicated below which are applicable to both the singular and plural thereof. 1.1.1. Bidder: Any person, firm, partnership, company, association, or corporation acting directly through a duly authorized representative, submitting a bid for performing the work contemplated under the Contract Documents. 1.1.2. Successful Bidder: The responsible and responsive Bidder to whom Developer/City (on the basis of City's evaluation as hereinafter provided) makes an award. 2. Copies of Bidding Documents 2.1. Neither Developer/City nor Engineer shall assume any responsibility for errors or misinterpretations resulting from the Bidders use of incomplete sets of Bidding Documents. 2.2. Developer/City and Engineer in making copies of Bidding Documents available do so only for the purpose of obtaining Bids for the Work and do not authorize or confer a license or grant for any other use. 3. Prequalification of Bidders (Prime Contractors and Subcontractors) 3.1. All Bidders and their subcontractors are required to be prequalified for the work types requiring prequalification at the time of bidding. Bids received from contractors who are not prequalified (even if inadvertently opened) shall not be considered. Prequalification requirement work types and documentation are available by accessing all required files through the City’s website at: https://apps.fortworthtexas.gov/ProjectResources/ 3.1.1. Paving – Requirements document located at; Resources/Construction Documents/Contractor Prequalification/TPW Paving Contractor Prequalification Program 3.1.2. Roadway and Pedestrian Lighting – Requirements document located at; Resources/Construction Documents/Contractor Prequalification/TPW Roadway and Pedestrian Lighting Prequalification Program 3.1.3. Water and Sanitary Sewer – Requirements document located at; 02 - Construction Documents/Contractor Prequalification/Water and Sanitary Sewer Contractor Prequalification Program 00 21 132 INSTRUCTIONS TO BIDDERS Page 2 of 9 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. 102824 Revised March 20, 2020 3.2. Each Bidder unless currently prequalified, must be prepared to submit to City within seven (7) calendar days prior to Bid opening, the documentation identified in Section 00 45 11, BIDDERS PREQUALIFICATIONS. 3.2.1. Submission of and/or questions related to prequalification should be addressed to the City contact as provided in Paragraph 6.1. 3.3. The City reserves the right to require any pre-qualified contractor who is the successful bidder(s) for a project to submit such additional information as the City, in its sole discretion may require, including but not limited to manpower and equipment records, information about key personnel to be assigned to the project, and construction schedule, to assist the City in evaluating and assessing the ability of the successful bidder(s) to deliver a quality product and successfully complete projects for the amount bid within the stipulated time frame. Failure to submit the additional information, if requested, may be grounds for rejecting the successful bidder as non-responsive. 3.4. In addition to prequalification, additional requirements for qualification may be required within various sections of the Contract Documents. 4. Examination of Bidding and Contract Documents, Other Related Data, and Site 4.1. Before submitting a Bid, each Bidder shall: 4.1.1. Examine and carefully study the Contract Documents and other related data identified in the Bidding Documents (including "technical data" referred to in Paragraph 4.2. below). No information given by Developer/City or any representative of the Developer/City other than that contained in the Contract Documents and officially promulgated addenda thereto, shall be binding upon the Developer/City. 4.1.2. Visit the site to become familiar with and satisfy Bidder as to the general, local and site conditions that may affect cost, progress, performance or furnishing of the Work. 4.1.3. Consider federal, state and local Laws and Regulations that may affect cost, progress, performance or furnishing of the Work. 4.1.4. Study all: (i) reports of explorations and tests of subsurface conditions at or contiguous to the Site and all drawings of physical conditions relating to existing surface or subsurface structures at the Site (except Underground Facilities) that have been identified in the Contract Documents as containing reliable "technical data" and (ii) reports and drawings of Hazardous Environmental Conditions, if any, at the Site that have been identified in the Contract Documents as containing reliable "technical data." 00 21 133 INSTRUCTIONS TO BIDDERS Page 3 of 9 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. 102824 Revised March 20, 2020 4.1.5. Be advised that the Contract Documents on file with the City shall constitute all of the information which the City will furnish. All additional information and data which the City will supply after promulgation of the formal Contract Documents shall be issued in the form of written addenda and shall become part of the Contract Documents just as though such addenda were actually written into the original Contract Documents. No information given by the City other than that contained in the Contract Documents and officially promulgated addenda thereto, shall be binding upon the City. 4.1.6. Perform independent research, investigations, tests, borings, and such other means as may be necessary to gain a complete knowledge of the conditions which will be encountered during the construction of the project. Bidder must fill all holes and clean up and restore the site to its former conditions upon completion of such explorations, investigations, tests and studies. 4.1.7. Determine the difficulties of the Work and all attending circumstances affecting the cost of doing the Work, time required for its completion, and obtain all information required to make a proposal. Bidders shall rely exclusively and solely upon their own estimates, investigation, research, tests, explorations, and other data which are necessary for full and complete information upon which the proposal is to be based. It is understood that the submission of a proposal is prima-facie evidence that the Bidder has made the investigation, examinations and tests herein required. Claims for additional compensation due to variations between conditions actually encountered in construction and as indicated in the Contract Documents will not be allowed. 4.1.8. Promptly notify Developer of all conflicts, errors, ambiguities or discrepancies in or between the Contract Documents and such other related documents. The Contractor shall not take advantage of any gross error or omission in the Contract Documents, and the Developer shall be permitted to make such corrections or interpretations as may be deemed necessary for fulfillment of the intent of the Contract Documents. 4.2. Reference is made to Section 00 73 00 – Supplementary Conditions for identification of: 4.2.1. those reports of explorations and tests of subsurface conditions at or contiguous to the site which have been utilized by Developer in preparation of the Contract Documents. The logs of Soil Borings, if any, on the plans are for general information only. Neither the Developer nor the Engineer guarantee that the data shown is representative of conditions which actually exist. 4.2.2. those drawings of physical conditions in or relating to existing surface and subsurface structures (except Underground Facilities) which are at or contiguous to the site that have been utilized by Developer in preparation of the Contract Documents. 4.2.3. copies of such reports and drawings will be made available by City to any Bidder on request. Bidder is responsible for any interpretation or conclusion drawn from any "technical data" or any other data, interpretations, opinions or information. 00 21 134 INSTRUCTIONS TO BIDDERS Page 4 of 9 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. 102824 Revised March 20, 2020 4.3. The submission of a Bid will constitute an incontrovertible representation by Bidder (i) that Bidder has complied with every requirement of this Paragraph 4, (ii) that without exception the Bid is premised upon performing and furnishing the Work required by the Contract Documents and applying the specific means, methods, techniques, sequences or procedures of construction (if any) that may be shown or indicated or expressly required by the Contract Documents, (iii) that Bidder has given Developer written notice of all conflicts, errors, ambiguities and discrepancies in the Contract Documents and the written resolutions thereof by Developer are acceptable to Bidder, and when said conflicts, etc., have not been resolved through the interpretations by Developer as described in Paragraph 6., and (iv) that the Contract Documents are generally sufficient to indicate and convey understanding of all terms and conditions for performing and furnishing the Work. 4.4. The provisions of this Paragraph 4, inclusive, do not apply to Asbestos, Polychlorinated biphenyls (PCBs), Petroleum, Hazardous Waste or Radioactive Material, unless specifically identified in the Contract Documents. 5. Availability of Lands for Work, Etc. 5.1. The lands upon which the Work is to be performed, rights-of-way and easements for access thereto and other lands designated for use by Contractor in performing the Work are identified in the Contract Documents. All additional lands and access thereto required for temporary construction facilities, construction equipment or storage of materials and equipment to be incorporated in the Work are to be obtained and paid for by Contractor. Easements for permanent structures or permanent changes in existing facilities are to be obtained and paid for by Developer. 00 21 135 INSTRUCTIONS TO BIDDERS Page 5 of 9 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. 102824 Revised March 20, 2020 6. Interpretations and Addenda 6.1. All questions about the meaning or intent of the Bidding Documents are to be directed to Developer’s/City’s representative. Interpretations or clarifications considered necessary by Developer in response to such questions will be issued by Addenda delivered to all parties recorded by Developer as having received the Bidding Documents. Only questions answered by formal written Addenda will be binding Oral and other interpretations or clarifications will be without legal effect Address questions to: Attn: Jake Hammons, PE, Baird, Hampton & Brown, Inc. Email: jhammons@bhbinc.com Phone: (817) 596-7575 AND/OR Attn: Patrick Buckley, PE, City of Fort Worth Email: patrick.buckley@fortworthtexas.gov Phone: (817) 392-2443 6.2. Addenda may also be issued to modify the Bidding Documents as deemed advisable by Developer/City. 6.3. A prebid conference may be held at the time and place indicated in the Advertisement or INVITATION TO BIDDERS. Representatives of Developer will be present to discuss the Project. Bidders are encouraged to attend and participate in the conference. Developer’s representative will transmit to all prospective Bidders of record such Addenda as Developer considers necessary in response to questions arising at the conference. Oral statements may not be relied upon and will not be binding or legally effective. 7. Bid Security 7.1. Each Bid must be accompanied by Bid Bond made payable to Developer in an amount of five (5) percent of Bidder's maximum Bid price on form attached, issued by a surety meeting the requirements as listed in the General Conditions. 7.2. The Bid Bond of all Bidders will be retained until the conditions of the Notice of Award have been satisfied. If the Successful Bidder fails to execute and deliver the complete Agreement within 10 days after the Notice of Award, Developer may consider Bidder to be in default, rescind the Notice of Award, and the Bid Bond of that Bidder will be forfeited. Such forfeiture shall be Developer's exclusive remedy if Bidder defaults. The Bid Bond of all other Bidders whom Developer believes to have a reasonable chance of receiving the award will be retained by Developer until final contract execution. 00 21 136 INSTRUCTIONS TO BIDDERS Page 6 of 9 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. 102824 Revised March 20, 2020 8. Contract Times The number of days within which, or the dates by which, Milestones are to be achieved in accordance with the General Requirements and the Work is to be completed and ready for Final Acceptance is set forth in the Agreement or incorporated therein by reference to the attached Bid Form. 9. Liquidated Damages Provisions for liquidated damages are set forth in the Agreement. 10. Substitute and "Or-Equal" Items The Contract, if awarded, will be on the basis of materials and equipment described in the Bidding Documents without consideration of possible substitute or "or-equal" items. Whenever it is indicated or specified in the Bidding Documents that a "substitute" or "or- equal" item of material or equipment may be furnished or used by Contractor if acceptable to City, application for such acceptance will not be considered by City until after the Effective Date of the Agreement. The procedure for submission of any such application by Contractor and consideration by City is set forth in Section 01 25 00 of the General Requirements. 11. Bid Form 11.1. All blanks on the Bid Form must be completed by printing in ink and the Bid Form signed in ink. Erasures or alterations shall be initialed in ink by the person signing the Bid Form. A Bid price shall be indicated for each Bid item, alternative, and unit price item listed therein. In the case of optional alternatives, the words "No Bid," "No Change," or "Not Applicable" may be entered legibly, in ink or type, for which the Bidder proposes to do the work contemplated or furnish materials required. 11.2. Bids by corporations shall be executed in the corporate name by the president or a vice-president or other corporate officer accompanied by evidence of authority to sign. The corporate seal shall be affixed. The corporate name, address and state of incorporation shall be shown below the signature. 11.3. Bids by partnerships shall be executed in the partnership name and signed by a partner, whose title must appear under the signature accompanied by evidence of authority to sign. The official name and address of the partnership shall be shown below the signature. 11.4. Bids by limited liability companies shall be executed in the name of the firm by a member and accompanied by evidence of authority to sign. The name and state of formation of the firm and the official address of the firm shall be shown. 11.5. Bids by individuals shall show the Bidder's name and official address. 11.6. Bids by joint ventures shall be executed by each joint venturer in the manner indicated on the Bid Form. The official address of the joint venture shall be shown. 11.7. All names shall be typed or printed in ink below the signature. 00 21 137 INSTRUCTIONS TO BIDDERS Page 7 of 9 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. 102824 Revised March 20, 2020 11.8. The Bid shall contain an acknowledgement of receipt of all Addenda, the numbers of which shall be filled in on the Bid Form. 11.9. Postal and e-mail addresses and telephone number for communications regarding the Bid shall be shown. 11.10. Evidence of authority to conduct business as a Nonresident Bidder in the state of Texas shall be provided in accordance with Section 00 43 37 – Vendor Compliance to State Law Non Resident Bidder. 12. Submission of Bids 12.1. Bids shall be submitted on the prescribed Bid Form and proposal form, provided with the Bidding Documents, at the time and place indicated in the Advertisement or INVITATION TO BIDDERS, addressed to City of Fort Worth Project Manager, and shall be enclosed in an opaque sealed envelope, marked with the City Project Number, Project title, the name and address of Bidder, and accompanied by the Bid security, if required, and other required documents. 13. Modification and Withdrawal of Bids 13.1. Bids cannot be withdrawn prior to the time set for bid opening. A request for withdrawal must be made in writing by an appropriate document duly executed in the manner that a Bid must be executed and delivered to the place where Bids are to be submitted at any time prior to the opening of Bids. After all Bids not requested for withdrawal are opened and publicly read aloud, the Bids for which a withdrawal request has been properly filed may, at the option of the Developer/City, be returned unopened. 13.2 Bidders may modify their Bid by electronic communication at any time prior to the time set for the closing of Bid receipt. 14. Opening of Bids 14.1. Bids will be opened and read aloud publicly at the place where Bids are to be submitted. An abstract of the amounts of the base Bids and major alternates (if any) will be made available to Bidders after the opening of Bids. 15. Bids to Remain Subject to Acceptance 15.1. All Bids will remain subject to acceptance for the time period specified for Notice of Award and execution and delivery of a complete Agreement by Successful Bidder. Developer/City may, at their sole discretion, release any Bid and nullify the Bid security, if required, prior to that date. 00 21 138 INSTRUCTIONS TO BIDDERS Page 8 of 9 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. 102824 Revised March 20, 2020 16. Evaluation of Bids and Award of Contract 16.1. Developer/City reserves the right to reject any or all Bids, including without limitation the rights to reject any or all nonconforming, nonresponsive, unbalanced or conditional Bids and to reject the Bid of any Bidder if Developer/City believes that it would not be in the best interest of the Project to make an award to that Bidder, whether because the Bid is not responsive or the Bidder is unqualified or of doubtful financial ability or fails to meet any other pertinent standard or criteria established by City. Developer/City also reserves the right to waive informalities not involving price, contract time or changes in the Work with the Successful Bidder. Discrepancies between the multiplication of units of Work and unit prices will be resolved in favor of the unit prices. Discrepancies between the indicated sum of any column of figures and the correct sum thereof will be resolved in favor of the correct sum. 16.1.1. Any or all bids will be rejected if Developer/City has reason to believe that collusion exists among the Bidders, Bidder is an interested party to any litigation against Developer/City, Developer/City or Bidder may have a claim against the other or be engaged in litigation, Bidder is in arrears on any existing contract or has defaulted on a previous contract, Bidder has performed a prior contract in an unsatisfactory manner, or Bidder has uncompleted work which in the judgment of the Developer/City will prevent or hinder the prompt completion of additional work if awarded. 16.2. Developer/City may consider the qualifications and experience of Subcontractors, Suppliers, and other persons and organizations proposed for those portions of the Work as to which the identity of Subcontractors, Suppliers, and other persons and organizations must be submitted as provided in the Contract Documents or upon the request of the Developer/City. Developer/City also may consider the operating costs, maintenance requirements, performance data and guarantees of major items of materials and equipment proposed for incorporation in the Work when such data is required to be submitted prior to the Notice of Award. 16.3. Developer/City may conduct such investigations as Developer/City deems necessary to assist in the evaluation of any Bid and to establish the responsibility, qualifications, and financial ability of Bidders, proposed Subcontractors, Suppliers and other persons and organizations to perform and furnish the Work in accordance with the Contract Documents to Developer’s/City's satisfaction within the prescribed time. 16.4. If the Contract is to be awarded, it will be awarded to lowest responsible and responsive Bidder whose evaluation by Developer/City indicates that the award will be in the best interests of the Developer/City. 16.5. Failure or refusal to comply with the requirements may result in rejection of Bid. 00 21 139 INSTRUCTIONS TO BIDDERS Page 9 of 9 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Project No. 102824 Revised March 20, 2020 17. Signing of Agreement 17.1. When Developer issues a Notice of Award to the Successful Bidder, it will be accompanied by the required number of unsigned counterparts of the Agreement. The Contractor shall sign and deliver the required number of counterparts of the Agreement to Developer’s representative with the required Bonds, Certificates of Insurance, and all other required documentation. END OF SECTION 00 41 00 DAP BID FORM FOR PUBLICLY BID PROJECTS ONLY Page 1 of 3 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION BID FORM – DEVELOPER AWARDED PROJECTS City Project No. 102824 Form Revised April 2, 2014 00 41 00 Bid Form – DAP.docx SECTION 00 41 00 DAP BID FORM FOR PUBLICLY BID PROJECTS ONLY TO: Morningstar Municipal Utility District ATTN: Mr. Kim Gill 3045 Lackland Road Fort Worth, Texas 76116 FOR: Water Main and Sewer Main Extensions to serve East Parker County Sub Courthouse City Project No.: 102824 Units/Sections: Unit I: Water Improvements Unit II: Sanitary Sewer Improvements Unit III: Drainage Improvements 1. Enter Into Agreement The undersigned Bidder proposes and agrees, if this Bid is accepted, to enter into an Agreement with Developer in the form included in the Bidding Documents to perform and furnish all Work as specified or indicated in the Contract Documents for the Bid Price and within the Contract Time indicated in this Bid and in accordance with the other terms and conditions of the Contract Documents. 2. BIDDER Acknowledgements and Certification 2.1. In submitting this Bid, Bidder accepts all of the terms and conditions of the INVITATION TO BIDDERS and INSTRUCTIONS TO BIDDERS, including without limitation those dealing with the disposition of Bid Bond. 2.2. Bidder is aware of all costs to provide the required insurance, will do so pending contract award, and will provide a valid insurance certificate meeting all requirements in the construction contract. 2.3. Bidder certifies that this Bid is genuine and not made in the interest of or on behalf of any undisclosed individual or entity and is not submitted in conformity with any collusive agreement or rules of any group, association, organization, or corporation. 2.4. Bidder has not directly or indirectly induced or solicited any other Bidder to submit a false or sham Bid. 2.5. Bidder has not solicited or induced any individual or entity to refrain from bidding. 2.6. Bidder has not engaged in corrupt, fraudulent, collusive, or coercive practices in competing for the Contract. For the purposes of this Paragraph: a. "corrupt practice" means the offering, giving, receiving, or soliciting of anything of value likely to influence the action of a public official in the bidding process. b. "fraudulent practice" means an intentional misrepresentation of facts made (a) to influence the bidding process to the detriment of Developer (b) to establish Bid prices at 00 41 00 DAP BID FORM FOR PUBLICLY BID PROJECTS ONLY Page 2 of 3 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION BID FORM – DEVELOPER AWARDED PROJECTS City Project No. 102824 Form Revised April 2, 2014 00 41 00 Bid Form – DAP.docx artificial non-competitive levels, or (c) to deprive Developer of the benefits of free and open competition. c. "collusive practice" means a scheme or arrangement between two or more Bidders, with or without the knowledge of Developer, a purpose of which is to establish Bid prices at artificial, non-competitive levels. d. "coercive practice" means harming or threatening to harm, directly or indirectly, persons or their property to influence their participation in the bidding process or affect the execution of the Contract. 3. Prequalification The Bidder acknowledges that the following work types must be performed only by prequalified contractors and subcontractors: a. Water and Wastewater New Development Open Cut (16” and under) 4. Time of Completion 4.1. The Work will be complete for Final Acceptance within 30 working days after the date when the Contract Time commences to run as provided in the General Conditions. 4.2. Bidder accepts the provisions of the Agreement to liquidated damages, if applicable, in the event of failure to complete the Work {and/or achievement of Milestones} within the times specified in the Agreement. 5. Attached to this Bid The following documents are attached to and made a part of this Bid: a. This Bid Form, Section 00 41 00 b. Bid Bond (if required), Section 00 43 13 issued by a surety meeting the requirements of the General Conditions. c. Proposal Form, Section 00 42 43 d. MBE Forms (if required) e. Prequalification Statement, Section 00 45 12 f. Any additional documents that may be required by Section 12 of the Instructions to Bidders g. Bidder pre-qualification application (optional) 6. Total Bid Amount 6.1. Bidder will complete the Work in accordance with the Contract Documents for the following bid amount. In the space provided below, please enter the total bid amount for this project. Only this figure will be read publicly by the City at the bid opening. 6.2. It is understood and agreed by the Bidder in signing this proposal that the total bid amount entered below is subject to verification and/or modification by multiplying the unit bid prices for each pay item by the respective estimated quantities shown in this proposal and then totaling all of the extended amounts. ooai o0 DAP BID FORM FOR PUBLICLY BID PROJGCTS ONLS' Pa�c 3 of 3 7. Bid Submittal This Bid is submitted on February 5, 2021 by the entity named below Respectfully submitted, BY: �i��%/ (Signature) Colton Tollett (Printed Name) Title: Company: Address: Vice President D.T. Utility Contractors, Inc. 2614 Causbie Road Weatherford, TX 76087 State of Incorporation: Texas Email: colton c(�i dtutilitv.com Phone: (817) 596-0169 Receipt is acknowledged of the following Addenda: Initial Addendum No. 1 Addendum No. 2 Addendum No. 3 Addendum No. 4 END OF SECTION CIN OF FORT WOkTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION BID FORM — DEVELOPER AWARDED PROlECTS City Project No. 102824 Form Revised April 2, 2014 00 41 00 Bid Form — DAP.docx 00 42 43 DAP - BID PROPOSAL Page 1 of 5 1 3305.0109 Trench Safety 33 05 10 LF 836 $1.00 $836.00 2 3305.0202 Imported Embedment/Backfill, CSS 33 05 10 CY 35 $65.00 $2,275.00 3 3311.0001 Ductile Iron Water Fittings w/ Restraint 33 11 11 TON 2 $10,000.00 $16,000.00 4 3311.0241 8" Water Pipe 33 11 10, 33 11 12 LF 18 $30.00 $540.00 5 3311.0441 12" Water Pipe 33 11 10, 33 11 12 LF 797 $42.00 $33,474.00 6 3311.0442 12" Water Pipe, CSS Backfill 33 11 10, 33 11 12 LF 21 $76.00 $1,596.00 7 3312.0001 Fire Hydrant 33 12 40 EA 1 $4,600.00 $4,600.00 8 3312.2003 1" Water Service 32 12 10 EA 1 $850.00 $850.00 9 3312.2203 2" Water Service 33 12 10 EA 1 $2,300.00 $2,300.00 10 3312.3003 8" Gate Valve 33 12 20 EA 1 $1,000.00 $1,000.00 11 3312.3005 12" Gate Valve 33 12 20 EA 1 $1,850.00 $1,850.00 12 3312.4114 16" x 12" Tapping Sleeve & Valve 33 12 25 EA 1 $4,200.00 $4,200.00 13 9999.1001 Flushing Point EA 1 $2,100.00 $2,100.00 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 Bidlist Item No. UNIT I: WATER IMPROVEMENTS SECTION 00 42 43 Developer Awarded Projects - PROPOSAL FORM Bidder's Proposal Description TOTAL UNIT I: WATER IMPROVEMENTS $71,621.00 Bid Quantity Bidder's Application Unit Price Bid Value UNIT PRICE BID Specification Section No.Unit of Measure Project Item Information CITY OF FORT WORTH STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS - DEVELOPER AWARDED PROJECTS Form Version May 22, 2019 East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 00 42 43_Bid Proposal.xls 00 42 43 DAP - BID PROPOSAL Page 2 of 5 Bidlist Item No. SECTION 00 42 43 Developer Awarded Projects - PROPOSAL FORM Bidder's Proposal Description Bid Quantity Bidder's Application Unit Price Bid Value UNIT PRICE BID Specification Section No.Unit of Measure Project Item Information 1 3301.0002 Post-CCTV Inspection 33 01 31 LF 315 $3.80 $1,197.00 2 3301.0101 Manhole Vacuum Testing 33 01 30 EA 3 $175.00 $525.00 3 3305.0106 Manhole Adjustment, Major 33 05 14 EA 1 $1,500.00 $1,500.00 4 3305.0109 Trench Safety 33 05 10 LF 315 $1.00 $315.00 5 3305.0112 Concrete Collar 33 05 17 EA 3 $500.00 $1,500.00 6 3305.0113 Trench Water Stops 33 05 15 EA 1 $250.00 $250.00 7 3305.0202 Imported Embedment/Backfill, CSS 33 05 10 CY 30 $65.00 $1,950.00 8 3331.4108 6" Sewer Pipe 33 11 10, 33 31 12, 33 31 20 LF 6 $35.00 $210.00 9 3331.4115 8" Sewer Pipe 33 11 10, 33 31 12, 33 31 20 LF 288 $37.00 $10,656.00 10 3331.4116 8" Sewer Pipe, CSS Backfill 33 11 10, 33 31 12, 33 31 20 LF 21 $76.00 $1,596.00 11 3339.1001 4' Manhole 33 39 10, 33 39 20 EA 2 $3,800.00 $7,600.00 12 3339.1003 4' Extra Depth Manhole 33 39 10, 33 39 20 VF 4 $150.00 $600.00 13 9999.2001 Connect to Existing SSMH EA 2 $500.00 $1,000.00 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 UNIT II: SANITARY SEWER IMPROVEMENTS TOTAL UNIT II: SANITARY SEWER IMPROVEMENTS $28,899.00 CITY OF FORT WORTH STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS - DEVELOPER AWARDED PROJECTS Form Version May 22, 2019 East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 00 42 43_Bid Proposal.xls 00 42 43 DAP - BID PROPOSAL Page 3 of 5 Bidlist Item No. SECTION 00 42 43 Developer Awarded Projects - PROPOSAL FORM Bidder's Proposal Description Bid Quantity Bidder's Application Unit Price Bid Value UNIT PRICE BID Specification Section No.Unit of Measure Project Item Information 1 3110.0101 Site Clearing 31 10 00 LS 1 $10,000.00 $10,000.00 2 3292.0200 Seeding, Broadcast 32 92 13 SY 2,356 $6.50 $15,314.00 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 $25,314.00 UNIT III: DRAINAGE IMPROVEMENTS TOTAL UNIT III: DRAINAGE IMPROVEMENTS CITY OF FORT WORTH STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS - DEVELOPER AWARDED PROJECTS Form Version May 22, 2019 East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 00 42 43_Bid Proposal.xls 00 42 43 DAP - BID PROPOSAL Page 4 of 5 Bidlist Item No. SECTION 00 42 43 Developer Awarded Projects - PROPOSAL FORM Bidder's Proposal Description Bid Quantity Bidder's Application Unit Price Bid Value UNIT PRICE BID Specification Section No.Unit of Measure Project Item Information 1 None 1 None 1 None UNIT V: STREET LIGHTING IMPROVEMENTS UNIT VI: TRAFFIC SIGNAL IMPROVEMENTS UNIT IV: PAVING IMPROVEMENTS TOTAL UNIT VI: TRAFFIC SIGNAL IMPROVEMENTS TOTAL UNIT V: STREET LIGHTING IMPROVEMENTS TOTAL UNIT IV: PAVING IMPROVEMENTS CITY OF FORT WORTH STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS - DEVELOPER AWARDED PROJECTS Form Version May 22, 2019 East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 00 42 43_Bid Proposal.xls 00 42 43 DAP - BID PROPOSAL Page 5 of 5 Bidlist Item No. SECTION 00 42 43 Developer Awarded Projects - PROPOSAL FORM Bidder's Proposal Description Bid Quantity Bidder's Application Unit Price Bid Value UNIT PRICE BID Specification Section No.Unit of Measure Project Item Information Bid Summary BIDDER:BY: D.T. Utility Contractors, Inc. 2614 Causbie Road TITLE: Weatherford, TX 76087 DATE: 30 END OF SECTION Colton Tollett Vice President $125,834.00 UNIT IV: PAVING IMPROVEMENTS UNIT V: STREET LIGHTING IMPROVEMENTS This Bid is submitted by the entity named below: working days after the date when the UNIT II: SANITARY SEWER IMPROVEMENTS UNIT III: DRAINAGE IMPROVEMENTS UNIT I: WATER IMPROVEMENTS Total Construction Bid UNIT VI: TRAFFIC SIGNAL IMPROVEMENTS $71,621.00 $28,899.00 Contractor agrees to complete WORK for FINAL ACCEPTANCE within CONTRACT commences to run as provided in the General Conditions. $25,314.00 CITY OF FORT WORTH STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS - DEVELOPER AWARDED PROJECTS Form Version May 22, 2019 East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 00 42 43_Bid Proposal.xls 00 43 13 DAP BID BOND FORM FOR PUBLICLY BID PROJECTS ONLY Page 1 of 1 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION BID BOND FORM – DEVELOPER AWARDED PROJECTS City Project No. 102824 Form Version April 2, 2014 00 43 13_Bid Bond_DAP.docx SECTION 00 43 13 DAP - BID BOND BY THESE PRESENTS: That we, D.T. Utility Contractors, Inc . called the Principal, and a corporation or firm duly authorized to transact surety business in the State of Texas, hereinafter called the Surety, are held and firmly bound unto the City, hereinafter called the Obligee, in the sum of One hundred twenty-five thousand eight hundred thirty-four and 00/100 Dollars said Principal and the said Surety, bind ourselves, our heirs, executors, administrators, successors and assigns, jointly and severally, firm by these presents. WHEREAS the Principal has submitted a proposal to perform work for the following project of the Obligee identified as: WATER MAIN & SEWER MAIN EXTENSIONS TO SERVE EAST PARKER COUNTY SUBCOURTHOUSE NOW, THEREFORE, if the Obligee shall award the Contract for the foregoing project to the Principal, and the Principal shall satisfy all requirements and conditions required for the execution of the Contract and shall enter into the Contract in writing with the Obligee in accordance with the terms of such proposal, then this bond shall be null and void. If the Principal fails to execute such Contract in accordance with the terms of such proposal or fails to satisfy all requirements and conditions required for the execution of the Contract in accordance with the proposal, this bond shall become the property of the Obligee, without recourse of the Principal and/or Surety, not to exceed the penalty hereof, and shall be used to compensate Obligee for the difference between Principal’s Total Bid Amount and the next selected Bidder’s Total Bid Amount. SIGNED this ________ day of __________________, 20___. By: D.T. Utility Contractors, Inc. _______________________________________________________________________ (Signature and Title of Principal) By: _______________________________________________________________________ (Signature of Attorney-of-Fact) *Attach Power of Attorney (Surety) for Attorney-in-Fact Impressed Surety Seal Only END OF SECTION oo�s i� DAP PRGQUALfFICATION STATEIIENT Page 1 of ] SECTION 00 45 12 DAP — PREQUALIFICATION STATEMENT Each Bidder is required to complete the information below by identifying the prequalified contractors and/or subcontractors whom they intend to utilize for the ntajor work type(s) listed. In the "Major Work Tvpe" box provide the complete major work type and actual description as provided by the Water Department for water and sewer and TPW fo�avin�. Major Work Type Contractor/Subcontractor Company Name Prequalification Ex iration Date Water and Wastewater New Development Open Cut D.T. Utility Contractors, Inc. 04/30/2021 (16" and under) The undersigned hereby certifies that the contractors and/or subcontractors descriUed in the table above are currently prequalified for the work types listed. BIDDER: D.T. Utility Contractors, Inc. 2614 Causbie Road Weatherford, TX 76087 BY: Colton Tollett r � ���— (Signature) TITLE: Vice President DATE: END OF SECTION CITV OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION PREQUALIFICATION STATEMENT— DEVELOPER AWARDED PROJECTS City Project No. 102824 Form Version September 1, 2015 00 45 12_Prequalification Statement 2015_DAP.docx 004526-1 CONTRACTOR COMPLIANCE WITH WORKER'S COMPENSATION LAW Page 1 of 1 1 2 SECTION 00 45 26 CONTRACTOR COMPLIANCE WITH WORKER'S COMPENSATION LAW 3 4 Pursuant to Texas Labor Code Section 406.096(a), as amended, Contractor certifies that it 5 provides worker's compensation insurance coverage for all of its employees employed on City 6 Project No. 102824. Contractor further certifies that, pursuant to Texas Labor Code, Section 7 406.096(b), as amended, it will provide to City its subcontractor's certificates of compliance with 8 worker's compensation coverage. 0 10 CONTRACTOR: 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 _D.T. Utilitv Contractors, Inc. By: Colton Tollett Company (Please Print) 2614Causbie Road Signature: ����'�'�� Address Weatherford, TX 76087 Title: Vice President City/State/Zip (Please Print) THE STATE OF TEXAS § COUNTY OF TARRANT § BEFORE ME, the undersigned authority, on this day personally appeared �a/-�o:�L ! �y'� , known to me to be the person whose name is subscribed to the foregoing instrument, and acknowledged to me that he/she executed the same as the act and deed of D• f:_(,�f./:�;l����r5. .—L.ti • for the purposes and consideration therein expressed and in the capacity therein stated. GIVEN UNDER MY HAND AND SEAL OF OFFICE this ��1 day of ��/j�YC� , 20 Z/ o:���Y �� Alexandra Plumlee . _�� , MY Commission Exp�res 9'"•...... P'� 07/31/2022 �oF� ID No 131683911 ��iC� � Notary Public in and for the State of Texas END OF SECTION CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS City Project. Na. 102824 Revised April 2, 2014 005�43-1 Developer Awarded Project Agreement Page 1 of 4 1 2 3 4 5 6 7 SECTION 00 52 43 AGREEMENT THIS AGREEMENT, authorized on �=-- "��� I is made by and between the Developer, FG ALEDO DEVELOPMENT, LLC., authorized to do business in Texas ("Developer") , and D.T. UTILITY CONTRACTORS, INC., authorized to do business in Texas, acting by and through its duly authorized representative, ("Contractor"). 8 Developer and Contractor, in consideration of the mut�ial covenants hereinafter set forth, agree as 9 follows: 10 Article 1. WORK 11 12 13 14 15 16 17 18 19 20 21 22 Contractor shall complete all Work as specified or indicated in the Contract Documents for the Project identified herein. Article 2. PROJECT The project for which the Work under the Contract Documents may be the whole or only a part is generally described as follows: WATER MAIN & SEWER MAIN EXTENSIONS TO SERVE EAST PARKER COUNTY SUBCOURTHOUSE C� Proiect No. 102824 Article 3. CONTRACT TIME 3.1 Time is of the essence. All time limits for Milestones, if any, and Final Acceptance as stated in the Contract Documents are of the essence to this Contract. 23 32 Final Acceptance. 24 The Work will be complete for Final Acceptance within 30 working days after the date 25 when the Contract Time commences to run as provided in Paragraph 12.04 of the Standard 26 City Conditions of the Construction Contract for Developer Awarded Projects. 27 3.3 Liquidated damages 28 29 30 31 32 33 34 35 36 37 38 Contractor recognizes that time is of the essence of this Agreement and that Developer will suffer financial loss if the Work is not completed within the times specified in Paragraph 3.2 above, plus any extension thereof allowed in accordance with Article 10 of the Standard City Conditions of the Construction Contract for Developer Awarded Projects. The Contractor also recognizes the delays, expense and difficulties involved in proving in a legal proceeding the actual loss suffered by the Developer if the Work is not completed on time. Accordingly, instead of requiring any such proof , Contractor agrees that as liquidated damages for delay (but not as a penalty), Contractor shall pay Developer One thousand Dollars ($ 1,000.00 ) for each day that expires after the time specified in Paragraph 3.2 for Final Acceptance until the City issues the Final Letter of Acceptance. CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS—DEVELOPER AWARDED PROJECTS City Proj. No. 102824 Revised August 24,2020 00 52 43 - 2 Developer Awarded Project Agreement Page 2 of 4 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Proj. No. 102824 Revised August 24,2020 Article 4. CONTRACT PRICE 39 Developer agrees to pay Contractor for performance of the Work in accordance with the Contract 40 Documents an amount in current funds of _One hundred twenty-five thousand eight hundred 41 thirty-four_ Dollars ($_125,834.00_). 42 Article 5. CONTRACT DOCUMENTS 43 5.1 CONTENTS: 44 A. The Contract Documents which comprise the entire agreement between Developer and 45 Contractor concerning the Work consist of the following: 46 1. This Agreement. 47 2. Attachments to this Agreement: 48 a. Bid Form (As provided by Developer) 49 1) Proposal Form (DAP Version) 50 2) Prequalification Statement 51 3) State and Federal documents (project specific) 52 b. Insurance ACORD Form(s) 53 c. Payment Bond (DAP Version) 54 d. Performance Bond (DAP Version) 55 e. Maintenance Bond (DAP Version) 56 f. Power of Attorney for the Bonds 57 g. Worker’s Compensation Affidavit 58 h. MBE and/or SBE Commitment Form (If required) 59 3. Standard City General Conditions of the Construction Contract for Developer 60 Awarded Projects. 61 4. Supplementary Conditions. 62 5. Specifications specifically made a part of the Contract Documents by attachment 63 or, if not attached, as incorporated by reference and described in the Table of 64 Contents of the Project’s Contract Documents. 65 6. Drawings. 66 7. Addenda. 67 8. Documentation submitted by Contractor prior to Notice of Award. 68 9. The following which may be delivered or issued after the Effective Date of the 69 Agreement and, if issued, become an incorporated part of the Contract Documents: 70 a. Notice to Proceed. 71 b. Field Orders. 72 c. Change Orders. 73 d. Letter of Final Acceptance. 74 75 76 00 52 43 - 3 Developer Awarded Project Agreement Page 3 of 4 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS City Proj. No. 102824 Revised August 24,2020 Article 6. INDEMNIFICATION 77 6.1 Contractor covenants and agrees to indemnify, hold harmless and defend, at its own 78 expense, the city, its officers, servants and employees, from and against any and all 79 claims arising out of, or alleged to arise out of, the work and services to be performed 80 by the contractor, its officers, agents, employees, subcontractors, licenses or invitees 81 under this contract. This indemnification provision is specifically intended to operate 82 and be effective even if it is alleged or proven that all or some of the damages being 83 sought were caused, in whole or in part, by any act, omission or negligence of the city. 84 This indemnity provision is intended to include, without limitation, indemnity for 85 costs, expenses and legal fees incurred by the city in defending against such claims and 86 causes of actions. 87 88 6.2 Contractor covenants and agrees to indemnify and hold harmless, at its own expense, 89 the city, its officers, servants and employees, from and against any and all loss, damage 90 or destruction of property of the city, arising out of, or alleged to arise out of, the work 91 and services to be performed by the contractor, its officers, agents, employees, 92 subcontractors, licensees or invitees under this contract. This indemnification 93 provision is specifically intended to operate and be effective even if it is alleged or 94 proven that all or some of the damages being sought were caused, in whole or in part, 95 by any act, omission or negligence of the city. 96 97 Article 7. MISCELLANEOUS 98 7.1 Terms. 99 Terms used in this Agreement are defined in Article 1 of the Standard City Conditions of 100 the Construction Contract for Developer Awarded Projects. 101 7.2 Assignment of Contract. 102 This Agreement, including all of the Contract Documents may not be assigned by the 103 Contractor without the advanced express written consent of the Developer. 104 7.3 Successors and Assigns. 105 Developer and Contractor each binds itself, its partners, successors, assigns and legal 106 representatives to the other party hereto, in respect to all covenants, agreements and 107 obligations contained in the Contract Documents. 108 7.4 Severability. 109 Any provision or part of the Contract Documents held to be unconstitutional, void or 110 unenforceable by a court of competent jurisdiction shall be deemed stricken, and all 111 remaining provisions shall continue to be valid and binding upon DEVELOPER and 112 CONTRACTOR. 113 7.5 Governing Law and Venue. 114 This Agreement, including all of the Contract Documents is performable in the State of 115 Texas. Venue shall be Tarrant County, Texas, or the United States District Court for the 116 Northern District of Texas, Fort Worth Division. 117 005243-4 Developer Awarded Project Agreement Page 4 of 4 118 119 120 121 122 123 124 125 126 127 7.6 A�rthority to Sign. Contractor shall attach evidence of authority to sign Agreement, if other than duly authorized signatory of the Contractor. IN WITNESS WHEREOF, Developer and Contractor have executed this Agreement in multiple counterparts. This A�reement is effective as of the last date signed by the Parties ("Effective Date") Contractor: D.T. Utility Contractors, Inc. Developer: FG Aledo Development, LLC �" By. �% `��� BY� � / ;�;C-`� (Signature) ° (Sionatuce) 128 Colton Tollett (Printed Name) Title: Vice President Company Name: D.T. Utility Contractors, Inc. Address: 2614 Causbic Road City/State/Zip: Weatlierford, TX 76087 Date Kim Gill (Printed Name) Title: President Company name: FG Aledo Development, LLC Address: 3045 Lackland Road City/State/Zip: Fort Worth, TX 76116 � � �-/ Date CITY OF fORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS—DEVELOPER AWARDED PROJECTS City Proj. No. 102824 Revised August 24,2020 SPECIAL CONDITIONS TO THE AGREEMENT Notwithstanding any other items, conditions or provisions of the general or special conditions or any other provision of the Contract Documents to the contrary, Morningstar Ranch Municipal Utility District Nos. 1 and 2 (“District”) and/or the City of Fort Worth (“City”) when dictated by and applicable contract shall be deemed and considered as Owner for all purposes under the Contract Documents, except that FG Aledo Development, LLC. (“Developer”) shall be considered the “Owner” for purposes of approving requests for and making payments to Contractor of all or any portion of the Contract Price and for paying all or any damages that might ever be due, including any costs associated with any change orders to the Contract. After submission to and approval by District and by Developer of the invoices, certificates and supporting documentation in connection with a request for payment, Contractor agrees to and shall look solely to Developer for payment of such invoices. Developer agrees to pay Contractor's invoices or work performed, subject to the terms of the Contract, in an aggregate amount not to exceed the Contract Price, plus change orders and extras approved by District and by Developer. Failure by Developer to make such payments to Contractor shall constitute a default by Owner and shall entitle Contractor to all rights and remedies arising under the Contract Documents for a default in payment of sums due Contractor pursuant to the Contract Documents; provided, however, District and/or City shall have no obligation for payment of sums due or to become due under the approved invoices or any part of the Contract Price. Neither the District nor the City is holding any security to guarantee payment for work performed on the Project. Developer reserves the right to assign its obligations hereunder to District and/or City subject to written acceptance thereof by District and/or City, respectively. A copy of any such assignment and the acceptance thereof shall be provided to Contractor, and thereafter assignee shall be obligated to make all payments thereafter becoming due to Contractor pursuant to this Contract and the obligations of the assignor contained in the first paragraph of these Special Conditions shall terminate. For purposes of convenient administration of the Contract, District may from time to time make payments due Contractor pursuant to this Contract from funds advanced to District by Developer, provided, however, no such payment by District will obligate District to make further payments due Contractor pursuant to this Contract unless and until District has accepted an assignment of Developer’s obligations hereunder and a copy of the assignment and District’s acceptance is delivered to Contractor, whereupon District shall become liable for payment to the extent of the assignment. If Developer breaches its obligations in any respect under the Contract, before exercising any remedy Contractor shall give written notice to District and City at the address below specifying the breach and the steps necessary to cure the breach and District shall have the right and power, within thirty (30) days after receipt of such notice, to cure or cause the breach to be cured, if it so elects, before Contractor exercises any of its remedies under the Contract. The undersigned CONTRACTOR does hereby release the City and District from any and all claims related to any failure of payment for work performed on the project by or through Contractor. The undersigned CONTRACTOR agrees, covenants and represents that it will include this Special Conditions to the Agreement in all of its subcontracts. On Behalf of Morningstar Ranch MUD Nos. ]& 2 On Behalf of Developer G��� On Behalf of Contractor 006213-1 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 SECTION 00 6213 PERFORMANCE BOND THE STATE OF TEXAS COUNTY OF TARRANT PERFORMANCE BOND Page 1 of 3 Bond No. 5938671 Premium: $2,825.00 Executed in Four (4) Originals § § KNOW ALL BY THESE PRESENTS: § That we, D.T. Utilitv Contractors, inc. , known as "Principal" herein and Old Republic Surety Company a corporate surety (sureties, if more than one) duly authorized to do business in the State ofTexas, known as "Surety" herein (whether one or more}, are held and firmly bound unto the Developer, FG Aledo Developrnent, LLC, authorized to do business in Texas ("Developer") and the City of Fort Worth, a Texas municipal corporation ("City"), in the penal sum of, One hundred twentv-�ve thousand ei�ht hundred thirtv-four and 00/100 Dollars ($ 125,834.00 ), lawful money of the United States, to be paid in Fort Worth, Tarrant County, Texas for the payment of which sum well and truly to be made jointly unto the Developer and the City as dual obligees, we bind ourselves, our heirs, executors, administrators, successors and assigns, jointly and severally, firmly by these presents. WHEREAS, Developer and City have entered into an Agreement for the construction of community facilities in the City of Fort Worth by and through a Community Facilities Agreement, CFA Number CFA 20-0111 and 20 WHEREAS, the Principal has entered into a certain written contract with the Developer awarded 21 the St'' day of _ February , 20 21 , which Contract is hereby referred to and made a part 22 hereof for all purposes as if fuliy set forth herein, to furnish all materials, equipment labor and 23 24 25 other accessories defined by law, in the prosecution of the Work, including any Change Orders, as provided for in said Contract designated as WATER MAIN & SEWER MAIN EXTENSIONS TO SERVE EAST PARKER COUNTY SUBCOURTHOUSE. 26 NOW, THEREFORE, the condition of this obligation is such that if the said Principal shall 27 faithfully perform it obligations under the Contract and shall in all respects duly and faithfully 28 perform the Work, including Change Orders, under the Contract, according to the plans, 29 specifications, and contract documents therein referred to, and as well during any period of CITV OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CITY CONDITIONS — DEVELOPER AWARDED PROJECTS City Proj. No. 102824 Revised lanuary 31, 2012 1 2 006213-2 PERFORMANCE BOND Page 2 of 3 extension of the Contract that may be granted on the part of the Developer and/or City, then this obligation shall be and become null and void, otherwise to remain in full force and effect. 3 PROVIDED FURTHER, that if any legal action be filed on this Bond, venue shall lie in 4 Tarrant County, Texas or the United States District Court for the Northern District of Texas, Fort 5 Worth Division. 6 This bond is made and executed in compliance with the provisions of Chapter 2253 of 7 the Texas Government Code, as amended, and all liabilities on this bond shall be determined in 8 accordance with the provisions of said statue. 9 IN WITNESS WHEREOF, the Principal and the Surety have SIGNED and SEALED this 10 instrument by duly authorized agents and officers on this the 17th day of March 11 , 20 21 . 12 13 14 15 16 17 18 19 ATT ST: 20 � GL 21 (Principal) Secretary 22 23 � �---'�/'�. ��c..-_��e 24 Witness as to Principal 25 26 CITY OF FORT WORTH STANDARD CITY CONDITIONS— DEVELOPER AWARDED PROJECTS Revised January 31, 2012 PRINCIPAL: D.T. Utilitv Contractors, Inc. BY: ��/ / Signature Colton Tollett Name and Title Add ress: 2614 Causbie Road Weatherford, TX 76087 East Parker County Subcourthouse Water & Sewer Main Extensions City Proj. No. 102824 006213-3 PERFORMANCE BOND Page 3 of 3 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 SURETY: , Old Republic Surety Company PO Box 1635, Milwaukee, WI 53201-1635 ;���,�' I� � BY: �- �� � � . Signature David F. Druml, Attorney-In-Fact Name and Title Q � r -� � •�.nA.�'�-ri ��"�"°'�� Linda Druml, Attestee Witness as to Surety Add ress: 445 S. Moorland Road, Suite 200 Brookfield, WI 53005 Telephone Number: (262) 797-2640 *Note: If signed by an officer of the Surety Company, there must be on file a certified extract from the by-laws showing that this person has authority to sign such obligation. If Surety's physical address is different from its mailing address, both must be provided. The date of the bond shall not be prior to the date the Contract is awarded. CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CIN CONDITIONS — DEVELOPER AWARDED PROJECTS City Proj. No. 102824 Revised January3l, 2012 **** 1t * * C)I�D REPLJBLIC SURrTY COMPANY �**** POWER OF ATTORNEY KNOW ALL MEN BY THESE PRESENTS: That OLD REPUBLIC SURETY COMPANY, a Wisconsin stock insurance corporation, does make, constitute and < appoinL DAVID F. DRUML, HORACE A. NABERS III, OF FOSTER CITY, CA its true and lawful Altomey(s)-in-Fact, widi full power and authority, for and on behalf of the company as surety, to execute and deliverand af6x the seal of the company thereto (if a seal is required), bonds, undertakings, recognizances or other written obligations in the nature thereof, (other than bail bonds, bank depositoiy b�nds, mo�tgage deliciency bonds. mortg�ige guaranly boizds, guarantees of insl�ilimenl paper and notc guaranty bonds, sclt'-insurance workers ;: compensation bonds guaranteeing payment af benelits or black lung bonds), as follows: ALL WRITTEN INSTRUMENTS and to bind OLD REPUBLIC SURETY COMPANY thereby, and all of the acis of said Attomeys-in-Fact, pursuant to these presents, are ratified and confirmed. ; This appointment is madc under and by aulhority of d�e board of dircc[ors at a special meeting held on Febivary 18, 1982. This Power of Attomey is signcd and sealed by facsimile under and by the authority of the following resolutions adopted by the board of directors of the OLD REPUBLIC SURETY COMPANY on February 18, 1982. RESOLVED that, the president, any vice-president, or assistant vice president, in conjunction with the secretary or any assistant secretary, may appoint attomeys-in-fact or agents with authority as dcfined or limited in [he instrument evidencing the appointmcnt in each case, for and on behalf of the company to execute and deliver and affix the seal of the company to bonds, undertakings, recognizances, and surctyship obligations of all kinds; and said officers may removc any such attomey-in-fact or agent and revoke any Power of Attorney previously granted to such person. RESOLVED FURTHER, that any bond, undertaking, recognizance, or suretyship obligation shall be valid and binding upon the Company (i) when signed by the president, any vice president or assistant vice president, and attested and sealed (if a seal be required) by any secretary or assistan[ secretary; or (ii) when signed by the president, any vice president or assistant vice president, secrctary or assistant secretary, and countersigned andsealed (if a seal be required) by a duly authorized attorney-in-fact or agent; or (iii) when duly exccuted and sealed (if a seal be required) by one or more attorneys-in-fact or agents pursuant to and wiUiin the limits ofthe au[hority evidenced by the Power of Attorney issued by the company to such person or peisons. RESOLVED FURTHER, ihat the signature of any authorized officer and the seal oCthe company may be affixed by facsimile to any Power of Attomey or ceriification there of authorizing the execution and delivery of any bond, undertaking, recognizance, or other suretyship obligations of the company; and such signaturc and seal when so used shall have the same force and effect as though manually affixed. [N WITNESS WHEREOF, OLD REPUBL[C SURETY COMPANY has caused these presents to be signed by its proper officer, and its corponte seal to be ' affixed tliis I ST day of FEBRUARY, 2021. OLD REPUBLIC SURETY COMPANY •� Y Assistant Secretary STATE OF WISCONSIN, COUNTY OF WAUKESHA-SS _.0'�G .UNEr'' . � 3J; ,� � �an.oe.,� °a -. :. n�� � F i�. T., i�_ � 2: ° .�.� � ' i �—__� _ President On this 1ST day of FEBRUARY, 2021 , personally came before me, Alan Pavlic and Karen 1 Haffner , to me known to be Qie individuais and officers of the OLD REPUBLIC SURETY COMPANY who exccuted the above instrument, and they each acknowledged thc execution of the samc, and being by me duly swom, did scverally depose and say; that they are the said officers of the corporation aforesaid, and that the seal afGxed to the above instrument is the seal of thc corporation, and that said corporafe seal and their signatures as such officers were duly affixed and su6scribed to the said instrument by the authority of tlie board of directors of said coiporatioii. �� .. . �n n.,!'� t / � � _ _— �a.,'' . '�; ��pT tqH•`� � � J} ,e�eL�� .;� Notary Public *'•• .: •� My commission expires: 9/28/2022 cF'CC, � CERTIFICATE (Expiration of notary commission does not invalidate this instrument) I, the undersigned, assistant sr,i:retary of the OLD REPUBLIC SURETY COMPANY, a Wisconsin corporation, CERTIFY that the foregoing and attached Power of Attomey remains in fu!: Porce a.ud has »ot been revoked; and furthennore, that the Resolutions of the board of directors set forih in the Power of Attomey, arc now in force. 31-1473 - _ ����. 'f � � . _ �y��, SUNE.Ff �. 'WV �rran�rr p ' t = �Eti�. ,- , °n .�„ ? ` { DIRECT SURETY INSURANCE SERV 2851-W Nonoas iozozo Stgned and sealed at the Crty of Brookhcld, WI Ihis �� day of--� i''�/ ,�"{"' L. f icLs.u�- C�' - y�'a.�-�cc.4� Assistant Secretary CALIFORNIA ALL-PURPOSE ACKNOWLEDGMENT CIVIL CODE § 1189 Y'�,c: o�-�,cr.c c��t's��,cX:e: f�t: C:tiS',cS��S�Y;e�`�'�5',cY�s�>��-e�`,cE'z-r,M,e�,�-�c�,cY`,cY>:cY`�'a=: r,e.r.cc,e�,rr,�=�r,�=r.�y�,s;r�cY',e��� A notary public or other officer completing this certificate verifies only the identity of the individual who signed the document to which this certificate is attached, and not the truthfulness, accuracy, or validity of that document. State of California County of San Mateo On � � l 7��� 21 before me, Horace Alexander Nabers Date Here Insert Name and Title of the Officer personally appeared David F. Druml Name(s) of Signer(s) who proved to me on the basis of satisfactory evidence to be the person(s) whose name(s) is/are subscribed to the within instrument and acknowledged to me that he/she/they executed the same in his/her/their authorized capacity(ies), and that by his/her/their signature(s) on the instrument the person(s), or the entity upon behalf of which the person(s) acted, executed the instrument. �HOR,4CE ALEXANDER NABERS �k: Notary publtt - California � :� Santa Clara County � ` Commission � 2333015 - � My Comrr„ Ezaires Sep 1, 2p2q I certify under PENALTY OF PERJURY under the laws of the State of California that the foregoing paragraph is true and correct. ,� WITNESS my hand,and official s. I, , % , -�,r /.- . /��. i ��/, Signatu <i /� !%% .t tary Place Notary Seal Above OPTIONAL Though this section is optional, completing this information can deter alteration of the document or fraudulent reattachment of this form to an unintended document. Description of Attached Document Title or Type of Document: Document Date: Number of Pages: Signer(s) Other Than Named Above: Capacity(ies) Claimed by Signer(s) Signer's Name: ❑ Corporate Officer — Title(s): ❑ Partner — ❑ Limited ❑ General ❑ Individual ❑ Attorney in Fact ❑ Trustee ❑ Guardian or Conservator ❑ Other: Signer Is Representing: Signer's Name: ❑ Corporate Officer — Title(s): ❑ Partner — ❑ Limited ❑ General ❑ Individual ❑ Attorney in Fact ❑ Trustee ❑ Guardian or Conservator ❑ Other: Signer Is Representing: �.`�G`�Z:�=l,`�`-G�:�C,`z=G`c�i�.Q?.�`c[.�G�G`�%C;� �.g:G`�:G�.e=CSz%G`�C.�.Q?:`u.�,�%<.�c.`�,�c.e;c`�-:C.`�Z`z%G`�C:`�,�C.`zZ`�C.�cz.`�-G�-C.`cL� %C;�?C.`�L:� �02014 National Notary Association • www.NationalNotary.org • 1-800-US NOTARY (1-800-876-6827) Item #5907 006214-1 PAYMENTBOND Page 1 of 3 1 2 3 4 5 6 SECTION 00 62 14 PAYMENT BOND THE STATE OF TEXAS COUNTY OF TARRANT Bond No. 5938671 Premium: Included Executed in Four (4) Originals § § KNfJW ALL BY THESE PRESENTS: § 7 That we, D.T. Utilitv Contractors, Inc. , known as "Principal" herein, and $ Old Republic Surety Company , a COrpordte surety ( or 9 sureties if more than one), duly authorized to do business in the State of Texas, known as 10 11 "Surety" herein (whether one or more), are held and firmly bound unto the Developer, FG Aledo Development, LLC, authorized to do business in Texas "(Developer"), and the City of Fort Worth, 12 a Texas municipal corporation ("City"), in the penal sum of One hundred twentv-five 13 thousand ei�ht hundred thirtv-four and 00/100 Dollars ($ 125,834.00 ), lawful money of 14 the United States, to be paid in Fort Worth, Tarrant County, Texas, for the payment of which 15 16 17 18 19 20 sum well and truly be made jointly unto the Develaper and the City as dual obligees, we bind ourselves, our heirs, executors, administrators, successors and assigns, jointly and severally, firmly by these presents: WHEREAS, Developer and City have entered into an Agreement for the construction of community facilities in the City of Fort Worth, by and through a Community Facilities Agreement, CFA Number CFA20-011; and 21 WHEREAS, Principal has entered into a certain written Contract with Developer, 22 awarded the 5th day of February , 20 21 , which Contract is hereby 23 referred to and made a part hereof for all purposes as if fully set forth herein, to furnish all 24 materials, equipment, labor and other accessories as defined by law, in the prosecution of the 25 Work as provided for in said Contract and designated as WATER MAIN & SEER MAIN 26 EXTENSIONS TO SERVE EAST PARKER COUNTY SUBCOURTHOUSE. 27 ��'•3 � N�W, THEREFORE, THE CONDITION OF THIS OBLIGATION is such that if Principal shall pay all monies owing to any (and all) payment bond beneficiary (as defined in Chapter 2253 of the Texas Government Code, as amended) in the prosecution of the Work under the Contract, CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CITY CONDITIONS — DEVELOPER AWARDED PROJECTS City Project No. 102824 Revised January 31, 2012 006214-2 PAYMENTBOND Page 2 of 3 then this obligation shall be and become null and void; otherwise to remain in full force and effect. 1 2 3 This bond is made and executed in compliance with the provisions of Chapter 2253 of 4 the Texas Government Code, as amended, and all liabilities on this bond shall be determined in 5 accordance with the provisions of said statute. 6 IN WITNESS WHEREOF, the Principal and Surety have each SIGNED and SEALED this 7 instrument by duly authorized agents and officers on this the 17th day of 8 March , 20 21 E ATTEST: ��� (Principal) Secretary ,��----�.`� y� Witness as to Principal CITY OF FORT WORTH STANDARD CITY CONDITIONS — DEVELOPER AWARDED PROJECTS Revised January3l, 2012 PRINCIPAL: D.T. Utilitv Contractors, Inc. BY: /%�// ��� Signature Colton Tollett Name and Title Address: 2614 Causbie Road Weatherford, TX 76087 East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 006214-3 PAYMENTBOND Page 3 of 3 ATTEST: (Surety) Secretary �r�t�� ��,�,.,�,; �� \..� �/L t �il `� � '�-�' e Linda Druml, Attestee Witness as to Surety 1 SU RETY: Old Republic Surety Company PO Box 1635, Milwaukee, WI 53201-1635 .Y�' �_ � '�l ; BY: C�r�. ���, �� f Signature David F. Druml, Attorney-In-Fact Name and Title Address: 445 S. Moorland Rd., Suite 200 Brookfield, WI 53005 Telephone Number: (262) 797-2640 2 Note: If signed by an officer of the Surety, there must be on file a certified extract from the 3 bylaws showing that this person has authority to sign such obligation. If 5urety's physical 4 address is different from its mailing address, both must be provided. �7 6 The date of the bond shall not be prior to the date the Contract is awarded. 7 �'.� END OF SECTION CI7Y OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CITY CONDITIONS— DEVELOPER AWARDED PROJECTS City Project No. 1028�4 Revised January 31, 2012 ; ; �*** * .t * C)I1D RI:Pt1BLIC SURFT�►' COMPANY ** * ** POWER OF ATTORNEY KNOW ALL MEN BY THESE PRESENTS: That OLD REPUBLIC SURETY COMPANY, a Wisconsin stock insurance corporation, does make, constitute and ' appoint: DAVID F. DRUML, HORACE A. NABERS III, OF FOSTER CITY, CA its lrue and lawful Attorney(s)-in-Fact, with full power and authority, for and on behalf oP the company as surety, to exccute and deliverand affix the seal of the company thereto (if a seal is required), bonds, underiakings, recognizances or other written obligations in lhe nature t6ereof, (othcr than bail bonds, bank deposi[ay bonds, mo�tgage delicicncy bonds, mortgagc guaranty bonds, guarantees of installment paper and note guaranty bonds, sclf-insurance workers �� = compensation honds guaranteeing payment ol'benrhts or black lung bonds), as follows: ALL WRITTEN INSTRUMENTS - and to bind OLD REPUBLIC SURETY COMPANY thcreby, and all of the acts of said Attorneys-in-Fact, pursuant to thcse presents, are ratificd and confirmed. This appointment is made under and by authority of the board oCdirectors at a special inceting held on February 18, 1982. This Power of Attomey is signed and sealed by facsimile under and by d�c authority of the following resolutions adop[ed by the board of directors of the OLD REPUBL[C 3URETY COMPANY on February 18, 1982. __... .... RESOLVED that, the president, any vice-president, or assis[ant vice president, in conjunction with the secretary or any assistant secretary, may appoint attorneys-in-fact or agen[s with authority as defined or limited in the instrument evidencing the appoinhnent in each case, for and on bel�alf of d�c company to execute and deliver and affix the seal oC the company to bonds, underiakings, recognizances, and sw�etyship obligations of all kinds; and said officers may remove any such attomey-in-fact or agent and revoke any Powcr of Attomey previously granted to such person. RESOLVED FURTHER, that any bond, underiaking, recognirance, or suretyship obligation shall be valid and binding upon the Company - (i) when signed by thc president, any vicc president or assistant vice president, and attested and sealed (iCa seal be required) by any secretary or assistant secretary; ar (ii) whcn signed by the president, any vicc president or assistant vice president, secrelary or assistant secretary, and countersigned andsealed (if a seal be required) by a duly authorized attorney-in-fact or agcnt; or (iii) when duly executed and sealed (if a scal be required) by one or more attorncys-in-fact or agcnts pursuant to and within the limits oRhe authority evidenced by the Power of Attorney issued 6y the company to such person or persons. RESOLVED FURTHER, that the signature of any authorized officer and thc seal of the company may be affixed by facsimile to any Power of Attorney or certification there of authorizing the execution and delivery of any bond, undeRaking, recognizance, or other suretyship obligations of the company; and such signature and seal when so used shall have the same Forec and effect as though manually affixed. [N WITNESS WHEREOF, OLD REPUBLIC SURETY COMPANY has caused these presen[s to be signed by its proper officer, and its corporate seal to be affixed this l ST day of FEBRUARY, 202 L OLD RGPUBLIC SURETY COMPANY �i�.ut- C� -'1-kt.�-�t[h� Assistant Secretary STATE OF WISCONSIN, COUNTY OF WAUKESHA-SS _ .� J� SUN f f^„ w3J �nroe.�� .�p -. .. `�' SEAL ;� � 1 = � ��n r : � � ., s .; ` �� - � --- .: _. �. President On this � ST day of FEBRUARY, 2021 , personally came before me, Alan Pavlic and Karen J Haffner , to me known to be tlie individuals and officers of the OLD REPUBLIC SURETY COMPANY who executed thc above inslrument, and ihey cach acknowledged the execution of the same, and being by me duly swom, did severally depose and say; that they are the said officers of the corporation aforesaid, and that [he seal affixed to the above instrument is the seal of the corporation, and that said corporate sea] and Uieir signatures as such officers were duly affixed and subscribed to the said instrument by the authority of the board of directors of said co�poration. �; t� nf � �/J ' �s 1 4 . �. 4`p1 tq�;�.,� . _ m _� J�' „ �� :a Notary �ublic VBL y +;:.... . a* My conunission expires: 9/28/2022 '(H �Y:!•4 . CERTIFICATE (Expiration of �otary commission does not invalidate this instrument) I, the undersigned, assistant s��cretary of ihe OLD REPUBLIC SURETY COMPANY, a Wisconsin corporation, CERTIFY that the foregoing and attached Power of Attomey remains in futl fC!'ce and has not becn revoked; and furihermore, that the Resolutions of the board of directors set forih in thc Powcr of Attomcy, are now in Force. 31-1473 % �;,t ';,� .`�tilL SVNf��}�. ��w ��Gr�1� r(i " n �JF.,A �, r = �. � 'Ili .� Y _ � . DIRECT SURETY INSURANCE SF.hV 2851-W ronoRs iozozo Signed and sealed at the Crty of Brookficld, WI this �_ day of Ev C..( , GGv1 , f 1�i�ut- �!' - Assistant Secretary CALIFORNIA ALL-PURPOSE ACKNOWLEDGMENT CIVIL CODE § 1189 A notary public or other officer completing this certificate verifies only the identity of the individual who signed the document to which this certificate is attached, and not the truthfulness, accuracy, or validity of that document. State of California County of San Mateo � On � l 17 1 Z��l before me, Horace Alexander Nabers Date Here Insert Name and Title of the Officer personally appeared David F. Druml Name(s) of Signer(s) who proved to me on the basis of satisfactory evidence to be the person(s) whose name(s) is/are subscribed to the within instrument and acknowledged to me that he/she/they executed the same in his/her/their authorized capacity(ies), and that by his/her/their signature(s) on the instrument the person(s), or the entity upon behalf of which the person(s) acted, executed the instrument. I certify under PENALTY OF PERJURY under the laws of the State of California that the foregoing paragraph is true and correct. , �.:., HOR.eCEALEI(qNDERNABERS " '/ � No[ary Public - California WITNESS my-ha ' and officia�s�ea .;- -�/ z �� - '� Santa Clara County � ,� / Commission p 2333075 � !� / �� �' , � My Comm. Ezpfres Se 1, 2p2q � ' �� / /'� / �� i % p Signature,i"�---�//,�� ��/ ,���� �%',`t/%i�fi/�/; ��� ��/ti.��— �` `� Signature o.YNotary Public � Place Notary Seal Above OPTIONAL Though this section is optional, completing this information can deter alteration of the document or fraudulent reattachment of this form to an unintended document. Description of Attached Document Title or Type of Document: Document Date: Number of Pages: Signer(s) Other Than Named Above: Capacity(ies) Claimed by Signer(s) Signer's Name: ❑ Corporate Officer — Title(s): ❑ Partner — ❑ Limited ❑ General ❑ Individual ❑ Attorney in Fact ❑ Trustee ❑ Guardian or Conservator ❑ Other: Signer Is Representing: Signer's Name: ❑ Corporate Officer — Title(s): ❑ Partner — ❑ Limited ❑ General ❑ Individual ❑ Attorney in Fact ❑ Trustee ❑ Guardian or Conservator ❑ Other: Signer Is Representing: ��.�L`�.�c;c.e=e`�,�Q=V�G�:�4`��`�C,�Z.�cc`�b��,�=c`�=�;`�Ce.G`�G`�G`�c'�G�`�=�,Q=c;`�%G`�%C;`�%G��c.�Z;��-c`�>vc`�c`�c;�=z.e>c,`�i`�i:�e`� c,`�i;`� �02014 National Notary Association • www.NationalNotary.org • 1-800-US NOTARY (1-800-876-6827) Item #5907 006219-1 MAINTENANCE BOND Page 1 of 4 Bond No. 5938671 Premium: Included Executed in Four (4) Originals 1 2 3 4 5 6 SECTION OQ 62 19 MAINTENANCE BOND THE STATE OF TEXAS COUNTY OF TARRANT § § KNOW ALL BY THESE PRESENTS: § 7 That we D.T. utilitv Contractors, Inc. , known as "Principal" herein and 8 Old Republic Surety Company , a corporate surety (sureties, if more than 9 one) duly authorized to do business in the State of Texas, known as "Surety" herein (whether 10 11 12 13 14 15 16 17 one or more), are held and firmly bound unto the Developer, Parker County, Texas, authorized to do business in Texas ("Developer") and the City of Fort Worth, a Texas municipal corporation ("City"), in the sum of One hundred twentv-five thousand ei�ht hundred thirtv-four and 00 100 Dollars ($ 125,834.00 ), lawful money of the United States, to be paid in Fort Worth, Tarrant County, Texas, for payment of which sum well and truly be made jointly unto the Developer and the City as dual obligees and their successors, we bind ourselves, our heirs, executors, administrators, successors and assigns, jointly and severally, firmly by these presents. 18 WHEREAS, Developer and City have entered into an Agreement for the construction of 19 community facilities in the City of Fort Worth by and through a Community Facilities Agreement, 20 CFA Number CFA 20-0111;and 21 22 WHEREAS, the Principal has entered into a certain written contract with the Developer 23 awarded the 5th day of February , 20 21 , which Contract is hereby 24 referred to and a made part hereof for all purposes as if fully set forth herein, to furnish all 25 materials, equipment labor and other accessories as defined by law, in the prosecution of the 26 Work, including any Work resulting from a duly authorized Change Order (collectively herein, 27 the "Work") as provided for in said Contract and designated as WATER MAIN & SEWER MAIN 28 EXTESNSIONS TO SERVE EAST PARKER COUNTY SUBCOURTHOUSE; and CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CITY CONDITIONS — DEVELOPER AWARDED PROJECTS City Project No. 10Z824 Revised January 31, 2012 00 62 19 - 2 MAINTENANCE BOND Page 2 of 4 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS City Project No. 102824 Revised January 31, 2012 1 WHEREAS, Principal binds itself to use such materials and to so construct the Work in 2 accordance with the plans, specifications and Contract Documents that the Work is and will 3 remain free from defects in materials or workmanship for and during the period of two (2) years 4 after the date of Final Acceptance of the Work by the City (“Maintenance Period”); and 5 6 WHEREAS, Principal binds itself to repair or reconstruct the Work in whole or in part upon 7 receiving notice from the Developer and/or City of the need thereof at any time within the 8 Maintenance Period. 9 10 NOW THEREFORE, the condition of this obligation is such that if Principal shall remedy 11 any defective Work, for which timely notice was provided by Developer or City, to a completion 12 satisfactory to the City, then this obligation shall become null and void; otherwise to remain in 13 full force and effect. 14 15 PROVIDED, HOWEVER, if Principal shall fail so to repair or reconstruct any timely 16 noticed defective Work, it is agreed that the Developer or City may cause any and all such 17 defective Work to be repaired and/or reconstructed with all associated costs thereof being 18 borne by the Principal and the Surety under this Maintenance Bond; and 19 20 PROVIDED FURTHER, that if any legal action be filed on this Bond, venue shall lie in 21 Tarrant County, Texas or the United States District Court for the Northern District of Texas, Fort 22 Worth Division; and 23 24 PROVIDED FURTHER, that this obligation shall be continuous in nature and successive 25 recoveries may be had hereon for successive breaches. 26 006219-3 MAINTENANCE BOND Page 3 of 4 1 IN WITNESS WHEREOF, the Principal and the Surety have each SIGNED and SEALED this 2 instrument by duly authorized agents and officers on this the 17th day of March 3 ------------------ 20 21 4 5 6 7 8 9 10 ATTEST: 11 i�f 2-- ���-+� 12 (Principal) Secretary 13 14 � �.--� P,�---�-� ,� 15 Witness as to Principal 16 17 18 PRINCIPAL: D.T. Utilitv Contractors, Inc. BY: �� Signature Colton Tollett Name and Title Address: 2614 Causbie Road Weatherford. TX 76087 CIN OF FORT WORTH STANDARD CIN CONDITIONS — DEVELOPER AWARDED PROJECTS Revised January 31, 2012 East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 006219-4 MAINTENANCE BOND Page 4 of 4 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 SURETY: Old Republic Surety Company PO Box 1635, Milwaukee, WI 53201-1635 % - � � BY: ✓c: u , --- Signature ATTEST: (Surety) Secretary ����� .�.��,�T� � Linda Druml, Attestee Witness as to Surety David F. Druml, Attorney-In-Fact Name and Title Address: 445 S. Moorland Rd., Suite 200 Brookfield, WI 53005 Telephone Number: (262) 797-2640 *Note: If signed by an officer of the Surety Company, there must be on file a certified extract from the by-laws showing that this person has authority to sign such obligation. If Surety's physical address is different from its mailing address, both must be provided. The date of the bond shall not be prior to the date the Contract is awarded. CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CITY CONDITIONS— DEVELOPER AWARDED PROJECTS City Project No. 102824 Revised January 31, 2012 , **** * � * ULD REPUBLIC �URFTY CUMPr�NY * * *** POWER OF ATTORNEY KNOW ALL MEN BY THESE PRESENTS: That OLD REPUBLIC SURETY COMPANY, a Wisconsin stock insurance corporation, does make, constitute and _ ' appoint: DAVID F. DRUML, HORACE A. NABERS III, OF FOSTER CITY, CA its true and lawful Attorney(s)-in-Fact, with full power and audiority, for and on behalf of the company as surety, to execute and deliverand affix the seal of U�e company thereto (if a seal is required), bonds, undertakings, recognizances or other written obligations in the nature thereof, (other than bail bonds, bank deposilory bo��ds, moitgagc dcliciency bonds, mortgage guaranty bonds, guarantees of instalhnent paper and notc guaranty bonds, self-insurance workers compensation bonds guaranteeing payment ofbcnclils or black lung bonds), as follows: ALL WRITTEN INSTRUMENTS and to bind OLD REPUBL[C SURETY COMPANY thereby, and all of tlie acts of said Attomeys-in-Fact, pursuant to these presents, arc ratified and confirmed. This appointment is made under and by authority of the board of directors at a special mee[ing held on February 1 S, 1982. This Power of Attorney is signed and sealcd by facsimile under and by thc authority of the following resolutions adopted by the board of directors of thc OLD REPUBLIC SURETY COMPANY on February 18, 1482. RESOLVED tha[, the president, any vice-presidenl, or assistant vice president, in conjunction witlt the secretary or any assistant secre[ary, may appoint attorneys-in-fact or agents with authority as defined or limited in the instrument evidencing the appoinunent in each case, for and on behalf of the company to execute and deliver and affix the seal of ihe company to bonds, underiakings, recognizances, and surctyship obligations of all kinds; and said officers may remove any such attomcy-in-fact or agent and revoke any Power of A[[orney previously granted to such person. RESOLVED FURTHER, that any bond, undertaking, recognizance, or suretyship obligation shall be valid and binding upon the Company (i) when signed by the president, any vice president or assislant vice president, and attested and sealed (if a seal be required) by any secretary or assistant secretary; or (ii) when signed by the president, any vice president or assistant vice president, secretary or assistant secretary, and countersigned andscaled (iFa seal be rcquired) by a duly authorized attomey-in-fact or agent; or (iii) when duly executed and sealed (if a seal be required) by one or more at[orneys-in-fact or agents pursuant to and within the limits ofthe authority evidenced by the Power of Attorney issued by the company to such person or persons. RESOLVED FURTHER, that the signature of any authorizcd officer and the seal of the company may be affixed by facsimile to any Power of Attomey or ccrtification there of authorizing the execution and delivery of any bond, undertaking, recognizanee, or other surelyship obligations of the company; and such signature and seal when so used shall have the same force and effect as though manually affixed. IN WITNESS WHEREOF, OLD REPUBL[C SURETY COMPANY has caused these presents to be signed by its proper officer, and its coiporate seal to be affixed this l ST day of FEBRUARY, 2021. OLD REPUBLIC SURETY COMPANY " f��� Assistant Secretary STATE OF WISCONSIN, COUNTY OF WAUKESHA-SS Signed and sealed at the City oPBrookfield, WI this : v� day of 'I� � e,, , G✓vL ;�Y',� SUHFt`. dJ' �o .ce� q . O -n n S��ij. �.>°'. o =- ��i1 }' A On this � ST day of FEBRUARY, 2021 , personally came before me, Alan Pavlic and Karen J Haffner , to me known to be the individuals and officers of [he OLD REPUBLIC SURETY COMPANY who executed ihe above inst�ument, and thcy cach acknowledged the execution of thc samc, and being by me duly sworn, did severally depose and say; that they are dic said officers of [hc corporation aforesaid, and that the seal affixed to the above instrument is the seal of the corporation, and that said corporate seal and their signatures as such officers were duly affixed and subscribed to the said instrument by the authority of the board of directors of said corpo�ation. ;11 ", f I `rv� � ..r. �.�-____. �.. �,,,.. . . 12. S �, �,o,.,n,, :� ;, ;; :, A"'""` s Notary r ublic _. ;. ,,,., ua�.� : �a * '�;,:y:s;,�af' My couimission expires: 9/28/2022 CERT[FICATE (Expiration of notary commission does not invalidate this instrument) I, the undersigned, assistant secretary ofthe OLD REPUBL[C SURETY COMPANY, a Wisconsin corporation, CERTIFY that the foregoing and attached Power of Attomey remains in full fc�rce c�,d has not been revokcd; and Furlhermore, that the Resolutions of the board of directors set forth in the Power of Attomey, are now in force. 31-1473 , � �y� �� 1 �� .uart,� o�. ��w .� �ye.�e.rr o '- ' o S�}�i1, i - e � r�a• Y : } DIRECT SURETY INSUP,t;NCE SERV � � � President 3 j��- C�' • v4�a..�-�x��iJ Assistant Secretary '2851-W �'onoas iozozo CALIFORNIA ALL-PURPOSE ACKNOWLEDGMENT CIVIL CODE § 1189 `�'s�Y`tir�s`�.er,m,�-c�,M,�c,�-r�c; ��c�C c�c�'�cY'�cr;c�,cr,c��c'��.e��c�C�c�sY�.e�'��cr,cY��C`�,rn;c.r.�`�cGeC`�Y'�;S.c�e,er,c�o,e�;er,c: rs A notary public or other officer completing this certificate verifies only the identity of the individual who signed the document to which this certificate is attached, and not the truthfulness, accuracy, or validity of that document. State of California County of San Mateo On �� � i%�?—�<=—/ before me, Horace Alexander Nabers Date Here Insert Name and Title of the Officer personally appeared David F. Druml Name(s) of Signer(s) who proved to me on the basis of satisfactory evidence to be the person(s) whose name(s) is/are subscribed to the within instrument and acknowledged to me that he/she/they executed the same in his/her/their authorized capacity(ies), and that by his/her/their signature(s) on the instrument the person(s), or the entity upon behalf of which the person(s) acted, executed the instrument. HOR.4CEaLEXANDER NABERS � v Notary Public - CaUfornia i ; -i Sanca Clara County � ` Commission z 2333075 ' �` My Comm. Expires Sep 1, 202a Place Notary Seal Above I certify under PENALTY OF PERJURY under the laws of the State of California that the foregoing paragraph is true and correct. WITNESS my.h _— � . �/ IdL' Notary OPTIONAL Though this section is optional, completing this information can deter alteration of the document or fraudulent reattachment of this form to an unintended document. Description of Attached Document Title or Type of Document: Document Date: Number of Pages: Signer(s) Other Than Named Above: Capacity(ies) Claimed by Signer(s) Signer's Name: ❑ Corporate Officer — Title(s): ❑ Partner — ❑ Limited ❑ General ❑ Individual ❑ Attorney in Fact ❑ Trustee ❑ Guardian or Conservator ❑ Other: Signer Is Representing: Signer's Name: ❑ Corporate Officer — Title(s): ❑ Partner — ❑ Limited ❑ General ❑ Individual ❑ Attorney in Fact ❑ Trustee ❑ Guardian or Conservator ❑ Other: Signer Is Representing: ��/ ��.e=e.��c�;�=c�=e.�z;�=e�e�,Y���.?�z.�e�:�;���c.�.�.�;�e.�:e�;�>��u�;��e�;�=�:��cY: z:e=e�c�.�.��r;� 002014 National Notary Association • www.NationalNotary.org • 1-800-US NOTARY (1-800-876-6827) Item #5907 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 STANDARD CITY CONDITIONS OF THE CONSTRUCTION CONTRACT FOR DEVELOPER AWARDED PROJECTS CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 STANDARD CITY CONDITIONS OF THE CONSTRUCTION CONTRACT FOR DEVELOPER AWARDED PROJECTS TABLE OF CONTENTS Page Article 1 – Definitions and Terminology .......................................................................................................... 1  1.01 Defined Terms ............................................................................................................................... 1  1.02 Terminology .................................................................................................................................. 5  Article 2 – Preliminary Matters ......................................................................................................................... 6  2.01 Before Starting Construction ........................................................................................................ 6  2.02 Preconstruction Conference .......................................................................................................... 6  2.03 Public Meeting .............................................................................................................................. 6  Article 3 – Contract Documents and Amending ............................................................................................... 6  3.01 Reference Standards ..................................................................................................................... 6  3.02 Amending and Supplementing Contract Documents .................................................................. 6  Article 4 – Bonds and Insurance ....................................................................................................................... 7  4.01 Licensed Sureties and Insurers ..................................................................................................... 7  4.02 Performance, Payment, and Maintenance Bonds ........................................................................ 7  4.03 Certificates of Insurance ............................................................................................................... 7  4.04 Contractor’s Insurance .................................................................................................................. 9  4.05 Acceptance of Bonds and Insurance; Option to Replace ........................................................... 12  Article 5 – Contractor’s Responsibilities ........................................................................................................ 12  5.01 Supervision and Superintendent ................................................................................................. 12  5.02 Labor; Working Hours ................................................................................................................ 13  5.03 Services, Materials, and Equipment ........................................................................................... 13  5.04 Project Schedule .......................................................................................................................... 14  5.05 Substitutes and “Or-Equals” ....................................................................................................... 14  5.06 Pre-Qualification of Bidders (Prime Contractors and Subcontractors) ..................................... 16  5.07 Concerning Subcontractors, Suppliers, and Others ................................................................... 16  5.08 Wage Rates.................................................................................................................................. 18  5.09 Patent Fees and Royalties ........................................................................................................... 19  5.10 Laws and Regulations ................................................................................................................. 19  5.11 Use of Site and Other Areas ....................................................................................................... 19  5.12 Record Documents ...................................................................................................................... 20  5.13 Safety and Protection .................................................................................................................. 21  5.14 Safety Representative ................................................................................................................. 21  5.15 Hazard Communication Programs ............................................................................................. 22  5.16 Submittals .................................................................................................................................... 22  5.17 Contractor’s General Warranty and Guarantee .......................................................................... 23  CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 5.18 Indemnification ........................................................................................................................... 24  5.19 Delegation of Professional Design Services .............................................................................. 24  5.20 Right to Audit: ............................................................................................................................ 25  5.21 Nondiscrimination....................................................................................................................... 25  Article 6 – Other Work at the Site ................................................................................................................... 26  6.01 Related Work at Site ................................................................................................................... 26  Article 7 – City’s Responsibilities................................................................................................................... 26  7.01 Inspections, Tests, and Approvals .............................................................................................. 26  7.02 Limitations on City’s Responsibilities ....................................................................................... 26  7.03 Compliance with Safety Program ............................................................................................... 27  Article 8 – City’s Observation Status During Construction ........................................................................... 27  8.01 City’s Project Representative ..................................................................................................... 27  8.02 Authorized Variations in Work .................................................................................................. 27  8.03 Rejecting Defective Work .......................................................................................................... 27  8.04 Determinations for Work Performed .......................................................................................... 28  Article 9 – Changes in the Work ..................................................................................................................... 28  9.01 Authorized Changes in the Work ............................................................................................... 28  9.02 Notification to Surety .................................................................................................................. 28  Article 10 – Change of Contract Price; Change of Contract Time ................................................................ 28  10.01 Change of Contract Price ............................................................................................................ 28  10.02 Change of Contract Time............................................................................................................ 28  10.03 Delays .......................................................................................................................................... 28  Article 11 – Tests and Inspections; Correction, Removal or Acceptance of Defective Work ...................... 29  11.01 Notice of Defects ........................................................................................................................ 29  11.02 Access to Work ........................................................................................................................... 29  11.03 Tests and Inspections .................................................................................................................. 29  11.04 Uncovering Work ....................................................................................................................... 30  11.05 City May Stop the Work ............................................................................................................. 30  11.06 Correction or Removal of Defective Work ................................................................................ 30  11.07 Correction Period ........................................................................................................................ 30  11.08 City May Correct Defective Work ............................................................................................. 31  Article 12 – Completion .................................................................................................................................. 32  12.01 Contractor’s Warranty of Title ................................................................................................... 32  12.02 Partial Utilization ........................................................................................................................ 32  12.03 Final Inspection ........................................................................................................................... 32  12.04 Final Acceptance ......................................................................................................................... 33  Article 13 – Suspension of Work .................................................................................................................... 33  13.01 City May Suspend Work ............................................................................................................ 33  Article 14 – Miscellaneous .............................................................................................................................. 34  14.01 Giving Notice .............................................................................................................................. 34  CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 14.02 Computation of Times ................................................................................................................ 34  14.03 Cumulative Remedies ................................................................................................................. 34  14.04 Survival of Obligations ............................................................................................................... 35  14.05 Headings ...................................................................................................................................... 35  00 73 10- 1 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 1 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 ARTICLE 1 – DEFINITIONS AND TERMINOLOGY 1.01 Defined Terms A. Wherever used in these General Conditions or in other Contract Documents, the terms listed below have the meanings indicated which are applicable to both the singular and plural thereof, and words denoting gender shall include the masculine, feminine and neuter. Said terms are generally capitalized or written in italics, but not always. When used in a context consistent with the definition of a listed-defined term, the term shall have a meaning as defined below whether capitalized or italicized or otherwise. In addition to terms specifically defined, terms with initial capital letters in the Contract Documents include references to identified articles and paragraphs, and the titles of other documents or forms. 1. Agreement - The written instrument which is evidence of the agreement between Developer and Contractor covering the Work 2. Asbestos—Any material that contains more than one percent asbestos and is friable or is releasing asbestos fibers into the air above current action levels established by the United States Occupational Safety and Health Administration. 3. Business Day – A business day is defined as a day that the City conducts normal business, generally Monday through Friday, except for federal or state holidays observed by the City. 4. Buzzsaw – City’s on-line, electronic document management and collaboration system. 5. Calendar Day – A day consisting of 24 hours measured from midnight to the next midnight. 6. City— The City of Fort Worth, Texas, a Texas home-rule municipal corporation, acting by, its governing body through its City Manager, his designee, or agents authorized pursuant to its duly authorized charter on his behalf. 7. Community Facilities Agreement (CFA) -–A Contract between the Developer and the City for the Construction of one or more following public facilities within the City public right-of- way or easement: Water, Sanitary Sewer, Street, Storm Drain, Street Light, and Street Signs. A CFA may include private facilities within the right-of-way dedicated as private right-of- way or easement on a recorded plat. 8. Contract—The entire and integrated written document incorporating the Contract Documents between the Developer, Contractor, and/or City concerning the Work. The Contract supersedes prior negotiations, representations, or agreements, whether written or oral. 9. Contract Documents—Those items that make up the contract and which must include the Agreement, and it’s attachments such as standard construction specifications, standard City Conditions, other general conditions of the Developer, including: a. An Agreement 00 73 10- 2 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 2 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 b. Attachments to the Agreement i. Bid Form ii. Vendor Compliance with State Law Non-Resident Bidder iii. Prequalification Statement c. Current Prevailing Wage Rates Table (if required by City) d. Insurance Accord Form e. Payment Bond f. Performance Bond g. Maintenance Bond h. Power of Attorney for Bonds i. Workers Compensation Affidavit j. MWBE Commitment Form( If required by City) k. General Conditions l. Supplementary Conditions m. The Standard City Conditions n. Specifications specifically made part of the Contract Documents by attachment, if not attached, as incorporated by reference and described in the Table of Contents of the Project’s Contract Documents o. Drawings p. Documentation submitted by contractor prior to Notice of Award. q. The following which may be delivered or issued after the effective date if the Agreement and, if issued become an incorporated part of the Contract Documents i. Notice to Proceed ii. Field Orders iii. Change Orders iv. Letters of Final Acceptance r. Approved Submittals, other Contractor submittals, and the reports and drawings of subsurface and physical conditions are not Contract Documents. 10. Contractor—The individual or entity with whom Developer has entered into the Agreement. 11. Day or day – A day, unless otherwise defined, shall mean a Calendar Day. 12. Developer – An individual or entity that desires to make certain improvements within the City of Fort Worth 13. Drawings—That part of the Contract Documents prepared or approved by Engineer which graphically shows the scope, extent, and character of the Work to be performed by Contractor. Submittals are not Drawings as so defined. 14. Engineer—The licensed professional engineer or engineering firm registered in the State of Texas performing professional services for the Developer. 15. Final Acceptance – The written notice given by the City to the Developer and/or Contractor that the Work specified in the Contract Documents has been completed to the satisfaction of the City. 00 73 10- 3 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 3 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 16. Final Inspection – Inspection carried out by the City to verify that the Contractor has completed the Work, and each and every part or appurtenance thereof, fully, entirely, and in conformance with the Contract Documents. 17. General Requirements—A part of the Contract Documents between the Developer and a Contractor. 18. Laws and Regulations—Any and all applicable laws, rules, regulations, ordinances, codes, and orders of any and all governmental bodies, agencies, authorities, and courts having jurisdiction. 19. Liens—Charges, security interests, or encumbrances upon Project funds, real property, or personal property. 20. Milestone—A principal event specified in the Contract Documents relating to an intermediate Contract Time prior to Final Acceptance of the Work. 21. Non-Participating Change Order—A document, which is prepared for and reviewed by the City, which is signed by Contractor, and Developer, and authorizes an addition, deletion, or revision in the Work or an adjustment in the Contract Price or the Contract Time, issued on or after the Effective Date of the Agreement. 22. Participating Change Order—A document, which is prepared for and approved by the City, which is signed by Contractor, Developer, and City and authorizes an addition, deletion, or revision in the Work or an adjustment in the Contract Price or the Contract Time, issued on or after the Effective Date of the Agreement. 23. Plans – See definition of Drawings. 24. Project Schedule—A schedule, prepared and maintained by Contractor, in accordance with the General Requirements, describing the sequence and duration of the activities comprising the Contractor’s plan to accomplish the Work within the Contract Time. 25. Project—The Work to be performed under the Contract Documents. 26. Project Representative—The authorized representative of the City who will be assigned to the Site. 27. Public Meeting – An announced meeting conducted by the Developer to facilitate public participation and to assist the public in gaining an informed view of the Project. 28. Regular Working Hours – Hours beginning at 7:00 a.m. and ending at 6:00 p.m., Monday thru Friday (excluding legal holidays). 29. Samples—Physical examples of materials, equipment, or workmanship that are representative of some portion of the Work and which establish the standards by which such portion of the Work will be judged. 00 73 10- 4 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 4 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 30. Schedule of Submittals—A schedule, prepared and maintained by Contractor, of required submittals and the time requirements to support scheduled performance of related construction activities. 31. Site—Lands or areas indicated in the Contract Documents as being furnished by City or Developer upon which the Work is to be performed, including rights-of-way, permits, and easements for access thereto, and such other lands furnished by City or Developer which are designated for the use of Contractor. 32. Specifications—That part of the Contract Documents consisting of written requirements for materials, equipment, systems, standards and workmanship as applied to the Work, and certain administrative requirements and procedural matters applicable thereto. Specifications may be specifically made a part of the Contract Documents by attachment or, if not attached, may be incorporated by reference as indicated in the Table of Contents (Division 00 00 00) of each Project. 33. Standard City Conditions – That part of the Contract Documents setting forth requirements of the City. 34. Subcontractor—An individual or entity having a direct contract with Contractor or with any other Subcontractor for the performance of a part of the Work at the Site. 35. Submittals—All drawings, diagrams, illustrations, schedules, and other data or information which are specifically prepared or assembled by or for Contractor and submitted by Contractor to illustrate some portion of the Work. 36. Superintendent – The representative of the Contractor who is available at all times and able to receive instructions from the City and/or Developer and to act for the Contractor. 37. Supplementary Conditions—That part of the Contract Documents which amends or supplements the General Conditions. 38. Supplier—A manufacturer, fabricator, supplier, distributor, materialman, or vendor having a direct contract with Contractor or with any Subcontractor to furnish materials or equipment to be incorporated in the Work by Contractor or Subcontractor. 39. Underground Facilities—All underground pipelines, conduits, ducts, cables, wires, manholes, vaults, tanks, tunnels, or other such facilities or attachments, and any encasements containing such facilities, including but not limited to, those that convey electricity, gases, steam, liquid petroleum products, telephone or other communications, cable television, water, wastewater, storm water, other liquids or chemicals, or traffic or other control systems. 40. Weekend Working Hours – Hours beginning at 9:00 a.m. and ending at 5:00 p.m., Saturday, Sunday or legal holiday, as approved in advance by the City. 00 73 10- 5 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 5 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 41. Work—The entire construction or the various separately identifiable parts thereof required to be provided under the Contract Documents. Work includes and is the result of performing or providing all labor, services, and documentation necessary to produce such construction including any Participating Change Order, Non-Participating Change Order, or Field Order, and furnishing, installing, and incorporating all materials and equipment into such construction, all as required by the Contract Documents. 42. Working Day – A working day is defined as a day, not including Saturdays, Sundays, or legal holidays authorized by the City for contract purposes, in which weather or other conditions not under the control of the Contractor will permit the performance of the principal unit of work underway for a continuous period of not less than 7 hours between 7 a.m. and 6 p.m. 1.02 Terminology A. The words and terms discussed in Paragraph 1.02.B through D are not defined but, when used in the Bidding Requirements or Contract Documents, have the indicated meaning. B. Defective: 1. The word “defective,” when modifying the word “Work,” refers to Work that is unsatisfactory, faulty, or deficient in that it: a. does not conform to the Contract Documents; or b. does not meet the requirements of any applicable inspection, reference standard, test, or approval referred to in the Contract Documents; or c. has been damaged prior to City’s written acceptance. C. Furnish, Install, Perform, Provide: 1. The word “Furnish” or the word “Install” or the word “Perform” or the word “Provide” or the word “Supply,” or any combination or similar directive or usage thereof, shall mean furnishing and incorporating in the Work including all necessary labor, materials, equipment, and everything necessary to perform the Work indicated, unless specifically limited in the context used. D. Unless stated otherwise in the Contract Documents, words or phrases that have a well-known technical or construction industry or trade meaning are used in the Contract Documents in accordance with such recognized meaning. 00 73 10- 6 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 6 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 ARTICLE 2 – PRELIMINARY MATTERS 2.01 Before Starting Construction Baseline Schedules: Submit to City in accordance with the Contract Documents, and prior to starting the Work. New schedules will be submitted to City when Participating Change Orders or Non- Participating Change Orders occur. 2.02 Preconstruction Conference Before any Work at the Site is started, the Contractor shall attend a Preconstruction Conference as specified in the Contract Documents. 2.03 Public Meeting Contractor may not mobilize any equipment, materials or resources to the Site prior to Contractor attending the Public Meeting as scheduled by the City. ARTICLE 3 – CONTRACT DOCUMENTS AND AMENDING 3.01 Reference Standards A. Standards, Specifications, Codes, Laws, and Regulations 1. Reference to standards, specifications, manuals, or codes of any technical society, organization, or association, or to Laws or Regulations, whether such reference be specific or by implication, shall mean the standard, specification, manual, code, or Laws or Regulations in effect at the time of opening of Bids (or on the Effective Date of the Agreement if there were no Bids), except as may be otherwise specifically stated in the Contract Documents. 2. No provision or instruction shall be effective to assign to City, or any of its officers, directors, members, partners, employees, agents, consultants, or subcontractors, any duty or authority to supervise or direct the performance of the Work or any duty or authority to undertake responsibility inconsistent with the provisions of the Contract Documents. 3.02 Amending and Supplementing Contract Documents A. The Contract Documents may be amended to provide for additions, deletions, and revisions in the Work or to modify the terms and conditions thereof by a Participating Change Order or a Non-Participating Change Order. B. The requirements of the Contract Documents may be supplemented, and minor variations and deviations in the Work not involving a change in Contract Price or Contract Time, may be authorized, by one or more of the following ways: 1. A Field Order; 00 73 10- 7 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 7 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 1. City’s or Engineer’s review of a Submittal (subject to the provisions of Paragraph 5.16.C); or 2. City’s written interpretation or clarification. ARTICLE 4 – BONDS AND INSURANCE 4.01 Licensed Sureties and Insurers All bonds and insurance required by the Contract Documents to be purchased and maintained by Contractor shall be obtained from surety or insurance companies that are duly licensed or authorized in the State of Texas to issue bonds or insurance policies for the limits and coverage so required. Such surety and insurance companies shall also meet such additional requirements and qualifications as may be provided Section 4.04. 4.02 Performance, Payment, and Maintenance Bonds A. Contractor shall furnish performance and payment bonds in the name of Developer and City, in accordance with Texas Government Code Chapter 2253 or successor statute, each in an amount equal to the Contract Price as security for the faithful performance and payment of all of Contractor’s obligations under the Contract Documents. B. Contractor shall furnish maintenance bonds in the name of Developer and City in an amount equal to the Contract Price as security to protect the City against any defects in any portion of the Work described in the Contract Documents. Maintenance bonds shall remain in effect for two (2) years after the date of Final Acceptance by the City. C. All bonds shall be in the form prescribed by the Contract Documents except as provided otherwise by Laws or Regulations, and shall be executed by such sureties as are named in the list of “Companies Holding Certificates of Authority as Acceptable Sureties on Federal Bonds and as Acceptable Reinsuring Companies” as published in Circular 570 (amended) by the Financial Management Service, Surety Bond Branch, U.S. Department of the Treasury. All bonds signed by an agent or attorney-in-fact must be accompanied by a sealed and dated power of attorney which shall show that it is effective on the date the agent or attorney-in-fact signed each bond. D. If the surety on any bond furnished by Contractor is declared bankrupt or becomes insolvent or its right to do business is terminated in the State of Texas or it ceases to meet the requirements of Paragraph 4.02.C, Contractor shall promptly notify City and shall, within 30 days after the event giving rise to such notification, provide another bond and surety, both of which shall comply with the requirements of Paragraphs 4.01 and 4.02.C. 4.03 Certificates of Insurance Contractor shall deliver to Developer and City, with copies to each additional insured and loss payee identified in these Standard City Conditions certificates of insurance (and other evidence of insurance requested by City or any other additional insured) which Contractor is required to purchase and maintain. 00 73 10- 8 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 8 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 1. The certificate of insurance shall document the City, an as “Additional Insured” on all liability policies. 2. The Contractor’s general liability insurance shall include a, “per project” or “per location”, endorsement, which shall be identified in the certificate of insurance provided to the City. 3. The certificate shall be signed by an agent authorized to bind coverage on behalf of the insured, be complete in its entirety, and show complete insurance carrier names as listed in the current A.M. Best Property & Casualty Guide 4. The insurers for all policies must be licensed and/or approved to do business in the State of Texas. Except for workers’ compensation, all insurers must have a minimum rating of A-: VII in the current A. M. Best Key Rating Guide or have reasonably equivalent financial strength and solvency to the satisfaction of Risk Management. If the rating is below that required, written approval of City is required. 5. All applicable policies shall include a Waiver of Subrogation (Rights of Recovery) in favor of the City. In addition, the Contractor agrees to waive all rights of subrogation against the Engineer (if applicable), and each additional insured identified in these Standard City Conditions. Failure of the City to demand such certificates or other evidence of full compliance with the insurance requirements or failure of the City to identify a deficiency from evidence that is provided shall not be construed as a waiver of Contractor’s obligation to maintain such lines of insurance coverage. 6. If insurance policies are not written for specified coverage limits, an Umbrella or Excess Liability insurance for any differences is required. Excess Liability shall follow form of the primary coverage. 7. Unless otherwise stated, all required insurance shall be written on the “occurrence basis”. If coverage is underwritten on a claims-made basis, the retroactive date shall be coincident with or prior to the date of the effective date of the agreement and the certificate of insurance shall state that the coverage is claims-made and the retroactive date. The insurance coverage shall be maintained for the duration of the Contract and for three (3) years following Final Acceptance provided under the Contract Documents or for the warranty period, whichever is longer. An annual certificate of insurance submitted to the City shall evidence such insurance coverage. 8. Policies shall have no exclusions by endorsements, which, neither nullify or amend, the required lines of coverage, nor decrease the limits of said coverage unless such endorsements are approved in writing by the City. In the event a Contract has been bid or executed and the exclusions are determined to be unacceptable or the City desires additional insurance coverage, and the City desires the contractor/engineer to obtain such coverage, the contract price shall be adjusted by the cost of the premium for such additional coverage plus 10%. 9. Any self-insured retention (SIR), in excess of $25,000.00, affecting required insurance coverage shall be approved by the City in regards to asset value and stockholders' equity. In 00 73 10- 9 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 9 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 lieu of traditional insurance, alternative coverage maintained through insurance pools or risk retention groups, must also be approved by City. 10. Any deductible in excess of $5,000.00, for any policy that does not provide coverage on a first-dollar basis, must be acceptable to and approved by the City. 11. City, at its sole discretion, reserves the right to review the insurance requirements and to make reasonable adjustments to insurance coverage’s and their limits when deemed necessary and prudent by the City based upon changes in statutory law, court decision or the claims history of the industry as well as of the contracting party to the City. The City shall be required to provide prior notice of 90 days, and the insurance adjustments shall be incorporated into the Work by Change Order. 12. City shall be entitled, upon written request and without expense, to receive copies of policies and endorsements thereto and may make any reasonable requests for deletion or revision or modifications of particular policy terms, conditions, limitations, or exclusions necessary to conform the policy and endorsements to the requirements of the Contract. Deletions, revisions, or modifications shall not be required where policy provisions are established by law or regulations binding upon either party or the underwriter on any such policies. 13. City shall not be responsible for the direct payment of insurance premium costs for Contractor’s insurance. 4.04 Contractor’s Insurance A. Workers Compensation and Employers’ Liability. Contractor shall purchase and maintain such insurance coverage with limits consistent with statutory benefits outlined in the Texas Workers’ Compensation Act (Texas Labor Code, Ch. 406, as amended), and minimum limits for Employers’ Liability as is appropriate for the Work being performed and as will provide protection from claims set forth below which may arise out of or result from Contractor’s performance of the Work and Contractor’s other obligations under the Contract Documents, whether it is to be performed by Contractor, any Subcontractor or Supplier, or by anyone directly or indirectly employed by any of them to perform any of the Work, or by anyone for whose acts any of them may be liable: 1. claims under workers’ compensation, disability benefits, and other similar employee benefit acts; 2. claims for damages because of bodily injury, occupational sickness or disease, or death of Contractor’s employees. 3. The limits of liability for the insurance shall provide the following coverages for not less than the following amounts or greater where required by Laws and Regulations a. Statutory limits b. Employer's liability 00 73 10- 10 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 10 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 1) $100,000 each accident/occurrence 2) $100,000 Disease - each employee 3) $500,000 Disease - policy limit B. Commercial General Liability. Coverage shall include but not be limited to covering liability (bodily injury or property damage) arising from: premises/operations, independent contractors, products/completed operations, personal injury, and liability under an insured contract. Insurance shall be provided on an occurrence basis, and as comprehensive as the current Insurance Services Office (ISO) policy. This insurance shall apply as primary insurance with respect to any other insurance or self-insurance programs afforded to the City. The Commercial General Liability policy, shall have no exclusions by endorsements that would alter of nullify premises/operations, products/completed operations, contractual, personal injury, or advertising injury, which are normally contained with the policy, unless the City approves such exclusions in writing. 1. For construction projects that present a substantial completed operation exposure, the City may require the contractor to maintain completed operations coverage for a minimum of no less than three (3) years following the completion of the project 2. Contractor's Liability Insurance under this Section which shall be on a per project basis covering the Contractor with minimum limits of: a. $1,000,000 each occurrence b. $2,000,000 aggregate limit 3. The policy must have an endorsement (Amendment – Aggregate Limits of Insurance) making the General Aggregate Limits apply separately to each job site. 4. The Commercial General Liability Insurance policies shall provide “X”, “C”, and “U” coverage’s. Verification of such coverage must be shown in the Remarks Article of the Certificate of Insurance. C. Automobile Liability. A commercial business auto policy shall provide coverage on “any auto”, defined as autos owned, hired and non-owned and provide indemnity for claims for damages because bodily injury or death of any person and or property damage arising out of the work, maintenance or use of any motor vehicle by the Contractor, any Subcontractor or Supplier, or by anyone directly or indirectly employed by any of them to perform any of the Work, or by anyone for whose acts any of them may be liable. 1. Automobile Liability, Contractor’s Liability Insurance under this Section, which shall be in an amount not less than the following amounts: a. Automobile Liability - a commercial business policy shall provide coverage on "Any Auto", defined as autos owned, hired and non-owned. 00 73 10- 11 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 11 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 1) $1,000,000 each accident on a combined single limit basis. Split limits are acceptable if limits are at least: 2) $250,000 Bodily Injury per person 3) $500,000 Bodily Injury per accident / 4) $100,000 Property Damage D. Railroad Protective Liability. If any of the work or any warranty work is within the limits of railroad right-of-way, the Contractor shall comply with the following requirements: 1. The Contractor’s construction activities will require its employees, agents, subcontractors, equipment, and material deliveries to cross railroad properties and tracks owned and operated by: ____________________________________________________________ Write the name of the railroad company. (If none, then write none) 2. The Contractor shall conduct its operations on railroad properties in such a manner as not to interfere with, hinder, or obstruct the railroad company in any manner whatsoever in the use or operation of its/their trains or other property. Such operations on railroad properties may require that Contractor to execute a “Right of Entry Agreement” with the particular railroad company or companies involved, and to this end the Contractor should satisfy itself as to the requirements of each railroad company and be prepared to execute the right-of-entry (if any) required by a railroad company. The requirements specified herein likewise relate to the Contractor’s use of private and/or construction access roads crossing said railroad company’s properties. 3. The Contractual Liability coverage required by Paragraph 5.04D of the General Conditions shall provide coverage for not less than the following amounts, issued by companies satisfactory to the City and to the Railroad Company for a term that continues for so long as the Contractor’s operations and work cross, occupy, or touch railroad property: a. General Aggregate: _____________________________________ Enter limits provided by Railroad Company (If none, write none) b. Each Occurrence: : _____________________________________ Enter limits provided by Railroad Company (If none, write none) 4. With respect to the above outlined insurance requirements, the following shall govern: a. Where a single railroad company is involved, the Contractor shall provide one insurance policy in the name of the railroad company. However, if more than one grade separation or at-grade crossing is affected by the Project at entirely separate locations on the line or lines of the same railroad company, separate coverage may be required, each in the amount stated above. b. Where more than one railroad company is operating on the same right-of-way or where several railroad companies are involved and operated on their own separate rights-of- None None None 00 73 10- 12 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 12 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 way, the Contractor may be required to provide separate insurance policies in the name of each railroad company. c. If, in addition to a grade separation or an at-grade crossing, other work or activity is proposed on a railroad company’s right-of-way at a location entirely separate from the grade separation or at-grade crossing, insurance coverage for this work must be included in the policy covering the grade separation. d. If no grade separation is involved but other work is proposed on a railroad company’s right-of-way, all such other work may be covered in a single policy for that railroad, even though the work may be at two or more separate locations. 5. No work or activities on a railroad company’s property to be performed by the Contractor shall be commenced until the Contractor has furnished the City with an original policy or policies of the insurance for each railroad company named, as required above. All such insurance must be approved by the City and each affected Railroad Company prior to the Contractor’s beginning work. 6. The insurance specified above must be carried until all Work to be performed on the railroad right-of-way has been completed and the grade crossing, if any, is no longer used by the Contractor. In addition, insurance must be carried during all maintenance and/or repair work performed in the railroad right-of-way. Such insurance must name the railroad company as the insured, together with any tenant or lessee of the railroad company operating over tracks involved in the Project. E. Notification of Policy Cancellation: Contractor shall immediately notify City upon cancellation or other loss of insurance coverage. Contractor shall stop work until replacement insurance has been procured. There shall be no time credit for days not worked pursuant to this section. 4.05 Acceptance of Bonds and Insurance; Option to Replace If City has any objection to the coverage afforded by or other provisions of the bonds or insurance required to be purchased and maintained by the Contractor in accordance with Article 5 on the basis of non-conformance with the Contract Documents, the Developer and City shall so notify the Contractor in writing within 10 Business Days after receipt of the certificates (or other evidence requested). Contractor shall provide to the City such additional information in respect of insurance provided as the Developer or City may reasonably request. If Contractor does not purchase or maintain all of the bonds and insurance required by the Contract Documents, the Developer or City shall notify the Contractor in writing of such failure prior to the start of the Work, or of such failure to maintain prior to any change in the required coverage. ARTICLE 5 – CONTRACTOR’S RESPONSIBILITIES 5.01 Supervision and Superintendent A. Contractor shall supervise, inspect, and direct the Work competently and efficiently, devoting such attention thereto and applying such skills and expertise as may be necessary to perform the 00 73 10- 13 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 13 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 Work in accordance with the Contract Documents. Contractor shall be solely responsible for the means, methods, techniques, sequences, and procedures of construction. B. At all times during the progress of the Work, Contractor shall assign a competent, English- speaking, Superintendent who shall not be replaced without written notice to City. The Superintendent will be Contractor’s representative at the Site and shall have authority to act on behalf of Contractor. All communication given to or received from the Superintendent shall be binding on Contractor. C. Contractor shall notify the City 24 hours prior to moving areas during the sequence of construction. 5.02 Labor; Working Hours A. Contractor shall provide competent, suitably qualified personnel to perform construction as required by the Contract Documents. Contractor shall at all times maintain good discipline and order at the Site. B. Except as otherwise required for the safety or protection of persons or the Work or property at the Site or adjacent thereto, and except as otherwise stated in the Contract Documents, all Work at the Site shall be performed during Regular Working Hours. Contractor will not permit the performance of Work beyond Regular Working Hours or for Weekend Working Hours without City’s written consent (which will not be unreasonably withheld). Written request (by letter or electronic communication) to perform Work: 1. for beyond Regular Working Hours request must be made by noon at least two (2) Business Days prior 2. for Weekend Working Hours request must be made by noon of the preceding Thursday 3. for legal holidays request must be made by noon two Business Days prior to the legal holiday. 5.03 Services, Materials, and Equipment A. Unless otherwise specified in the Contract Documents, Contractor shall provide and assume full responsibility for all services, materials, equipment, labor, transportation, construction equipment and machinery, tools, appliances, fuel, power, light, heat, telephone, water, sanitary facilities, temporary facilities, and all other facilities and incidentals necessary for the performance, Contractor required testing, start-up, and completion of the Work. B. All materials and equipment incorporated into the Work shall be as specified or, if not specified, shall be of good quality and new, except as otherwise provided in the Contract Documents. All special warranties and guarantees required by the Specifications shall expressly run to the benefit of City. If required by City, Contractor shall furnish satisfactory evidence (including reports of required tests) as to the source, kind, and quality of materials and equipment. 00 73 10- 14 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 14 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 C. All materials and equipment to be incorporated into the Work shall be stored, applied, installed, connected, erected, protected, used, cleaned, and conditioned in accordance with instructions of the applicable Supplier, except as otherwise may be provided in the Contract Documents. 5.04 Project Schedule A. Contractor shall adhere to the Project Schedule established in accordance with Paragraph 2.01 and the General Requirements as it may be adjusted from time to time as provided below. 1. Contractor shall submit to City for acceptance (to the extent indicated in Paragraph 2.01 and the General Requirements) proposed adjustments in the Project Schedule. 2. Proposed adjustments in the Project Schedule that will change the Contract Time shall be submitted in accordance with the requirements of Article 9. Adjustments in Contract Time for projects with City participation shall be made by participating change orders. 5.05 Substitutes and “Or-Equals” A. Whenever an item of material or equipment is specified or described in the Contract Documents by using the name of a proprietary item or the name of a particular Supplier, the specification or description is intended to establish the type, function, appearance, and quality required. Unless the specification or description contains or is followed by words reading that no like, equivalent, or “or-equal” item or no substitution is permitted, other items of material or equipment of other Suppliers may be submitted to City for review under the circumstances described below. 1. “Or-Equal” Items: If in City’s sole discretion an item of material or equipment proposed by Contractor is functionally equal to that named and sufficiently similar so that no change in related Work will be required, it may be considered by City as an “or-equal” item, in which case review and approval of the proposed item may, in City’s sole discretion, be accomplished without compliance with some or all of the requirements for approval of proposed substitute items. For the purposes of this Paragraph 5.05.A.1, a proposed item of material or equipment will be considered functionally equal to an item so named if: a. City determines that: 1) it is at least equal in materials of construction, quality, durability, appearance, strength, and design characteristics; 2) it will reliably perform at least equally well the function and achieve the results imposed by the design concept of the completed Project as a functioning whole; and 3) it has a proven record of performance and availability of responsive service; and b. Contractor certifies that, if approved and incorporated into the Work: 1) there will be no increase in cost to the City or increase in Contract Time; and 00 73 10- 15 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 15 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 2) it will conform substantially to the detailed requirements of the item named in the Contract Documents. 2. Substitute Items: a. If in City’s sole discretion an item of material or equipment proposed by Contractor does not qualify as an “or-equal” item under Paragraph 5.05.A.1, it may be submitted as a proposed substitute item. b. Contractor shall submit sufficient information as provided below to allow City to determine if the item of material or equipment proposed is essentially equivalent to that named and an acceptable substitute therefor. Requests for review of proposed substitute items of material or equipment will not be accepted by City from anyone other than Contractor. c. Contractor shall make written application to City for review of a proposed substitute item of material or equipment that Contractor seeks to furnish or use. The application shall comply with Section 01 25 00 and: 1) shall certify that the proposed substitute item will: i. perform adequately the functions and achieve the results called for by the general design; ii. be similar in substance to that specified; iii. be suited to the same use as that specified; and 2) will state: i. the extent, if any, to which the use of the proposed substitute item will prejudice Contractor’s achievement of final completion on time; ii. whether use of the proposed substitute item in the Work will require a change in any of the Contract Documents (or in the provisions of any other direct contract with City for other work on the Project) to adapt the design to the proposed substitute item; iii. whether incorporation or use of the proposed substitute item in connection with the Work is subject to payment of any license fee or royalty; and 3) will identify: i. all variations of the proposed substitute item from that specified; ii. available engineering, sales, maintenance, repair, and replacement services; and 00 73 10- 16 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 16 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 4) shall contain an itemized estimate of all costs or credits that will result directly or indirectly from use of such substitute item, including costs of redesign and Damage Claims of other contractors affected by any resulting change. B. Substitute Construction Methods or Procedures: If a specific means, method, technique, sequence, or procedure of construction is expressly required by the Contract Documents, Contractor may furnish or utilize a substitute means, method, technique, sequence, or procedure of construction approved by City. Contractor shall submit sufficient information to allow City, in City’s sole discretion, to determine that the substitute proposed is equivalent to that expressly called for by the Contract Documents. Contractor shall make written application to City for review in the same manner as those provided in Paragraph 5.05.A.2. C. City’s Evaluation: City will be allowed a reasonable time within which to evaluate each proposal or submittal made pursuant to Paragraphs 5.05.A and 5.05.B. City may require Contractor to furnish additional data about the proposed substitute. City will be the sole judge of acceptability. No “or-equal” or substitute will be ordered, installed or utilized until City’s review is complete, which will be evidenced by a Change Order in the case of a substitute and an accepted Submittal for an “or-equal.” City will advise Contractor in writing of its determination. D. Special Guarantee: City may require Contractor to furnish at Contractor’s expense a special performance guarantee, warranty, or other surety with respect to any substitute. Contractor shall indemnify and hold harmless City and anyone directly or indirectly employed by them from and against any and all claims, damages, losses and expenses (including attorneys fees) arising out of the use of substituted materials or equipment. E. City’s Cost Reimbursement: City will record City’s costs in evaluating a substitute proposed or submitted by Contractor pursuant to Paragraphs 5.05.A.2 and 5.05.B. Whether or not City approves a substitute so proposed or submitted by Contractor, Contractor may be required to reimburse City for evaluating each such proposed substitute. Contractor may also be required to reimburse City for the charges for making changes in the Contract Documents. F. Contractor’s Expense: Contractor shall provide all data in support of any proposed substitute or “or-equal” at Contractor’s expense. G. Substitute Reimbursement: Costs (savings or charges) attributable to acceptance of a substitute shall be incorporated to the Contract by Participating Change Order. 5.06 Pre-Qualification of Bidders (Prime Contractors and Subcontractors) A. The Contractor and any subcontractors are required to be prequalified for the work types requiring pre-qualification 5.07 Concerning Subcontractors, Suppliers, and Others A. Minority and Women Owned Business Enterprise Compliance: 00 73 10- 17 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 17 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 Required for this Contract. (Check this box if there is any City Participation) Not Required for this Contract. It is City policy to ensure the full and equitable participation by Minority and Women Business Enterprises (MWBE) in the procurement of goods and services on a contractual basis. If the Contract Documents provide for a MWBE goal, Contractor is required to comply with the intent of the City’s MWBE Ordinance (as amended) by the following: 1. Contractor shall, upon request by City, provide complete and accurate information regarding actual work performed by a MWBE on the Contract and payment therefor. 2. Contractor will not make additions, deletions, or substitutions of accepted MWBE without written consent of the City. Any unjustified change or deletion shall be a material breach of Contract and may result in debarment in accordance with the procedures outlined in the Ordinance. 3. Contractor shall, upon request by City, allow an audit and/or examination of any books, records, or files in the possession of the Contractor that will substantiate the actual work performed by an MWBE. Material misrepresentation of any nature will be grounds for termination of the Contract. Any such misrepresentation may be grounds for disqualification of Contractor to bid on future contracts with the City for a period of not less than three years. B. Contractor shall be fully responsible to City for all acts and omissions of the Subcontractors, Suppliers, and other individuals or entities performing or furnishing any of the Work just as Contractor is responsible for Contractor’s own acts and omissions. Nothing in the Contract Documents: 1. shall create for the benefit of any such Subcontractor, Supplier, or other individual or entity any contractual relationship between City and any such Subcontractor, Supplier or other individual or entity; nor 2. shall create any obligation on the part of City to pay or to see to the payment of any moneys due any such Subcontractor, Supplier, or other individual or entity except as may otherwise be required by Laws and Regulations. C. Contractor shall be solely responsible for scheduling and coordinating the Work of Subcontractors, Suppliers, and other individuals or entities performing or furnishing any of the Work under a direct or indirect contract with Contractor. D. All Subcontractors, Suppliers, and such other individuals or entities performing or furnishing any of the Work shall communicate with City through Contractor. E. All Work performed for Contractor by a Subcontractor or Supplier will be pursuant to an appropriate agreement between Contractor and the Subcontractor or Supplier which specifically binds the Subcontractor or Supplier to the applicable terms and conditions of these Contract 00 73 10- 18 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 18 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 Documents, Contractor shall provide City contract numbers and reference numbers to the Subcontractors and/or Suppliers. 5.08 Wage Rates Required for this Contract. Not Required for this Contract. A. Duty to pay Prevailing Wage Rates. The Contractor shall comply with all requirements of Chapter 2258, Texas Government Code (as amended), including the payment of not less than the rates determined by the City Council of the City of Fort Worth to be the prevailing wage rates in accordance with Chapter 2258. Such prevailing wage rates are included in these Contract Documents. B. Penalty for Violation. A Contractor or any Subcontractor who does not pay the prevailing wage shall, upon demand made by the City, pay to the City $60 for each worker employed for each calendar day or part of the day that the worker is paid less than the prevailing wage rates stipulated in these contract documents. This penalty shall be retained by the City to offset its administrative costs, pursuant to Texas Government Code 2258.023. C. Complaints of Violations and City Determination of Good Cause. On receipt of information, including a complaint by a worker, concerning an alleged violation of 2258.023, Texas Government Code, by a Contractor or Subcontractor, the City shall make an initial determination, before the 31st day after the date the City receives the information, as to whether good cause exists to believe that the violation occurred. The City shall notify in writing the Contractor or Subcontractor and any affected worker of its initial determination. Upon the City’s determination that there is good cause to believe the Contractor or Subcontractor has violated Chapter 2258, the City shall retain the full amounts claimed by the claimant or claimants as the difference between wages paid and wages due under the prevailing wage rates, such amounts being subtracted from successive progress payments pending a final determination of the violation. D. Arbitration Required if Violation Not Resolved. An issue relating to an alleged violation of Section 2258.023, Texas Government Code, including a penalty owed to the City or an affected worker, shall be submitted to binding arbitration in accordance with the Texas General Arbitration Act (Article 224 et seq., Revised Statutes) if the Contractor or Subcontractor and any affected worker does not resolve the issue by agreement before the 15th day after the date the City makes its initial determination pursuant to Paragraph C above. If the persons required to arbitrate under this section do not agree on an arbitrator before the 11th day after the date that arbitration is required, a district court shall appoint an arbitrator on the petition of any of the persons. The City is not a party in the arbitration. The decision and award of the arbitrator is final and binding on all parties and may be enforced in any court of competent jurisdiction. E. Records to be Maintained. The Contractor and each Subcontractor shall, for a period of three (3) years following the date of acceptance of the work, maintain records that show (i) the name and 00 73 10- 19 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 19 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 occupation of each worker employed by the Contractor in the construction of the Work provided for in this Contract; and (ii) the actual per diem wages paid to each worker. The records shall be open at all reasonable hours for inspection by the City. The provisions of Paragraph 6.23, Right to Audit, shall pertain to this inspection. F. Progress Payments. With each progress payment or payroll period, whichever is less, the Contractor shall submit an affidavit stating that the Contractor has complied with the requirements of Chapter 2258, Texas Government Code. G. Posting of Wage Rates. The Contractor shall post prevailing wage rates in a conspicuous place at all times. H. Subcontractor Compliance. The Contractor shall include in its subcontracts and/or shall otherwise require all of its Subcontractors to comply with Paragraphs A through G above. 5.09 Patent Fees and Royalties A. To the fullest extent permitted by Laws and Regulations, Contractor shall indemnify and hold harmless City, from and against all claims, costs, losses, and damages (including but not limited to all fees and charges of engineers, architects, attorneys, and other professionals and all court or arbitration or other dispute resolution costs) arising out of or relating to any infringement of patent rights or copyrights incident to the use in the performance of the Work or resulting from the incorporation in the Work of any invention, design, process, product, or device not specified in the Contract Documents. 5.10 Laws and Regulations A. Contractor shall give all notices required by and shall comply with all Laws and Regulations applicable to the performance of the Work. Except where otherwise expressly required by applicable Laws and Regulations, the City shall not be responsible for monitoring Contractor’s compliance with any Laws or Regulations. B. If Contractor performs any Work knowing or having reason to know that it is contrary to Laws or Regulations, Contractor shall bear all claims, costs, losses, and damages (including but not limited to all fees and charges of engineers, architects, attorneys, and other professionals and all court or arbitration or other dispute resolution costs) arising out of or relating to such Work. However, it shall not be Contractor’s responsibility to make certain that the Specifications and Drawings are in accordance with Laws and Regulations, but this shall not relieve Contractor of Contractor’s obligations under Paragraph 3.01. 5.11 Use of Site and Other Areas A. Limitation on Use of Site and Other Areas: 1. Contractor shall confine construction equipment, the storage of materials and equipment, and the operations of workers to the Site and other areas permitted by Laws and Regulations, and shall not unreasonably encumber the Site and other areas with construction equipment or 00 73 10- 20 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 20 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 other materials or equipment. Contractor shall assume full responsibility for any damage to any such land or area, or to the owner or occupant thereof, or of any adjacent land or areas resulting from the performance of the Work. 2. At any time when, in the judgment of the City, the Contractor has obstructed or closed or is carrying on operations in a portion of a street, right-of-way, or easement greater than is necessary for proper execution of the Work, the City may require the Contractor to finish the section on which operations are in progress before work is commenced on any additional area of the Site. 3. Should any Damage Claim be made by any such owner or occupant because of the performance of the Work, Contractor shall promptly attempt to resolve the Damage Claim. 4. Pursuant to Paragraph 5.18, Contractor shall indemnify and hold harmless City, from and against all claims, costs, losses, and damages arising out of or relating to any claim or action, legal or equitable, brought by any such owner or occupant against City. B. Removal of Debris During Performance of the Work: During the progress of the Work Contractor shall keep the Site and other areas free from accumulations of waste materials, rubbish, and other debris. Removal and disposal of such waste materials, rubbish, and other debris shall conform to applicable Laws and Regulations. C. Site Maintenance Cleaning: 24 hours after written notice is given to the Contractor that the clean-up on the job site is proceeding in a manner unsatisfactory to the City or Developer, if the Contractor fails to correct the unsatisfactory procedure, the City may take such direct action as the City deems appropriate to correct the clean-up deficiencies cited to the Contractor in the written notice (by letter or electronic communication), and shall be entitled to recover its cost in doing so. The City may withhold Final Acceptance until clean-up is complete and cost are recovered. D. Final Site Cleaning: Prior to Final Acceptance of the Work Contractor shall clean the Site and the Work and make it ready for utilization by City or adjacent property owner. At the completion of the Work Contractor shall remove from the Site all tools, appliances, construction equipment and machinery, and surplus materials and shall restore to original condition or better all property disturbed by the Work. E. Loading Structures: Contractor shall not load nor permit any part of any structure to be loaded in any manner that will endanger the structure, nor shall Contractor subject any part of the Work or adjacent property to stresses or pressures that will endanger it. 5.12 Record Documents A. Contractor shall maintain in a safe place at the Site or in a place designated by the Contractor and approved by the City, one (1) record copy of all Drawings, Specifications, Addenda, Change Orders, Field Orders, and written interpretations and clarifications in good order and annotated to show changes made during construction. These record documents together with all approved 00 73 10- 21 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 21 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 Samples and a counterpart of all accepted Submittals will be available to City for reference. Upon completion of the Work, these record documents, any operation and maintenance manuals, and Submittals will be delivered to City prior to Final Inspection. Contractor shall include accurate locations for buried and imbedded items. 5.13 Safety and Protection A. Contractor shall be solely responsible for initiating, maintaining and supervising all safety precautions and programs in connection with the Work. Such responsibility does not relieve Subcontractors of their responsibility for the safety of persons or property in the performance of their work, nor for compliance with applicable safety Laws and Regulations. Contractor shall take all necessary precautions for the safety of, and shall provide the necessary protection to prevent damage, injury or loss to: 1. all persons on the Site or who may be affected by the Work; 2. all the Work and materials and equipment to be incorporated therein, whether in storage on or off the Site; and 3. other property at the Site or adjacent thereto, including trees, shrubs, lawns, walks, pavements, roadways, structures, utilities, and Underground Facilities not designated for removal, relocation, or replacement in the course of construction. B. Contractor shall comply with all applicable Laws and Regulations relating to the safety of persons or property, or to the protection of persons or property from damage, injury, or loss; and shall erect and maintain all necessary safeguards for such safety and protection. Contractor shall notify owners of adjacent property and of Underground Facilities and other utility owners when prosecution of the Work may affect them, and shall cooperate with them in the protection, removal, relocation, and replacement of their property. C. Contractor shall comply with the applicable requirements of City’s safety programs, if any. D. Contractor shall inform City of the specific requirements of Contractor’s safety program, if any, with which City’s employees and representatives must comply while at the Site. E. All damage, injury, or loss to any property referred to in Paragraph 5.13.A.2 or 5.13.A.3 caused, directly or indirectly, in whole or in part, by Contractor, any Subcontractor, Supplier, or any other individual or entity directly or indirectly employed by any of them to perform any of the Work, or anyone for whose acts any of them may be liable, shall be remedied by Contractor. F. Contractor’s duties and responsibilities for safety and for protection of the Work shall continue until such time as all the Work is completed and City has accepted the Work. 5.14 Safety Representative Contractor shall inform City in writing of Contractor’s designated safety representative at the Site. 00 73 10- 22 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 22 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 5.15 Hazard Communication Programs Contractor shall be responsible for coordinating any exchange of material safety data sheets or other hazard communication information required to be made available to or exchanged between or among employers in accordance with Laws or Regulations. 5.16 Submittals A. Contractor shall submit required Submittals to City for review and acceptance. Each submittal will be identified as required by City. 1. Submit number of copies specified in the General Requirements. 2. Data shown on the Submittals will be complete with respect to quantities, dimensions, specified performance and design criteria, materials, and similar data to show City the services, materials, and equipment Contractor proposes to provide and to enable City to review the information for the limited purposes required by Paragraph 5.16.C. 3. Submittals submitted as herein provided by Contractor and reviewed by City for conformance with the design concept shall be executed in conformity with the Contract Documents unless otherwise required by City. 4. When Submittals are submitted for the purpose of showing the installation in greater detail, their review shall not excuse Contractor from requirements shown on the Drawings and Specifications. 5. For-Information-Only submittals upon which the City is not expected to conduct review or take responsive action may be so identified in the Contract Documents. 6. Submit required number of Samples specified in the Specifications. 7. Clearly identify each Sample as to material, Supplier, pertinent data such as catalog numbers, the use for which intended and other data as City may require to enable City to review the submittal for the limited purposes required by Paragraph 5.16.C. B. Where a Submittal is required by the Contract Documents or the Schedule of Submittals, any related Work performed prior to City’s review and acceptance of the pertinent submittal will be at the sole expense and responsibility of Contractor. C. City’s Review: 1. City will provide timely review of required Submittals in accordance with the Schedule of Submittals acceptable to City. City’s review and acceptance will be only to determine if the items covered by the submittals will, after installation or incorporation in the Work, conform to the information given in the Contract Documents and be compatible with the design concept of the completed Project as a functioning whole as indicated by the Contract Documents. 00 73 10- 23 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 23 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 2. City’s review and acceptance will not extend to means, methods, techniques, sequences, or procedures of construction (except where a particular means, method, technique, sequence, or procedure of construction is specifically and expressly called for by the Contract Documents) or to safety precautions or programs incident thereto. The review and acceptance of a separate item as such will not indicate approval of the assembly in which the item functions. 3. City’s review and acceptance shall not relieve Contractor from responsibility for any variation from the requirements of the Contract Documents unless Contractor has complied with the requirements of Section 01 33 00 and City has given written acceptance of each such variation by specific written notation thereof incorporated in or accompanying the Submittal. City’s review and acceptance shall not relieve Contractor from responsibility for complying with the requirements of the Contract Documents. 5.17 Contractor’s General Warranty and Guarantee A. Contractor warrants and guarantees to City that all Work will be in accordance with the Contract Documents and will not be defective. City and its officers, directors, members, partners, employees, agents, consultants, and subcontractors shall be entitled to rely on representation of Contractor’s warranty and guarantee. B. Contractor’s warranty and guarantee hereunder excludes defects or damage caused by: 1. abuse, modification, or improper maintenance or operation by persons other than Contractor, Subcontractors, Suppliers, or any other individual or entity for whom Contractor is responsible; or 2. normal wear and tear under normal usage. C. Contractor’s obligation to perform and complete the Work in accordance with the Contract Documents shall be absolute. None of the following will constitute an acceptance of Work that is not in accordance with the Contract Documents or a release of Contractor’s obligation to perform the Work in accordance with the Contract Documents: 1. observations by City; 2. recommendation or payment by City or Developer of any progress or final payment; 3. the issuance of a certificate of Final Acceptance by City or any payment related thereto by City; 4. use or occupancy of the Work or any part thereof by City; 5. any review and acceptance of a Submittal by City; 6. any inspection, test, or approval by others; or 00 73 10- 24 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 24 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 7. any correction of defective Work by City. D. The Contractor shall remedy any defects or damages in the Work and pay for any damage to other work or property resulting therefrom which shall appear within a period of two (2) years from the date of Final Acceptance of the Work unless a longer period is specified and shall furnish a good and sufficient maintenance bond, complying with the requirements of Article 4.02.B. The City will give notice of observed defects with reasonable promptness. 5.18 Indemnification A. Contractor covenants and agrees to indemnify, hold harmless and defend, at its own expense, the City, its officers, servants and employees, from and against any and all claims arising out of, or alleged to arise out of, the work and services to be performed by the Contractor, its officers, agents, employees, subcontractors, licenses or invitees under this Contract. THIS INDEMNIFICATION PROVISION IS SPECIFICALLY INTENDED TO OPERATE AND BE EFFECTIVE EVEN IF IT IS ALLEGED OR PROVEN THAT ALL OR SOME OF THE DAMAGES BEING SOUGHT WERE CAUSED, IN WHOLE OR IN PART, BY ANY ACT, OMISSION OR NEGLIGENCE OF THE CITY. This indemnity provision is intended to include, without limitation, indemnity for costs, expenses and legal fees incurred by the City in defending against such claims and causes of actions. B. Contractor covenants and agrees to indemnify and hold harmless, at its own expense, the City, its officers, servants and employees, from and against any and all loss, damage or destruction of property of the City, arising out of, or alleged to arise out of, the work and services to be performed by the Contractor, its officers, agents, employees, subcontractors, licensees or invitees under this Contract. THIS INDEMNIFICATION PROVISION IS SPECIFICALLY INTENDED TO OPERATE AND BE EFFECTIVE EVEN IF IT IS ALLEGED OR PROVEN THAT ALL OR SOME OF THE DAMAGES BEING SOUGHT WERE CAUSED, IN WHOLE OR IN PART, BY ANY ACT, OMISSION OR NEGLIGENCE OF THE CITY. 5.19 Delegation of Professional Design Services A. Contractor will not be required to provide professional design services unless such services are specifically required by the Contract Documents for a portion of the Work or unless such services are required to carry out Contractor’s responsibilities for construction means, methods, techniques, sequences and procedures. B. If professional design services or certifications by a design professional related to systems, materials or equipment are specifically required of Contractor by the Contract Documents, City will specify all performance and design criteria that such services must satisfy. Contractor shall cause such services or certifications to be provided by a properly licensed professional, whose signature and seal shall appear on all drawings, calculations, specifications, certifications, and Submittals prepared by such professional. Submittals related to the Work designed or certified by such professional, if prepared by others, shall bear such professional’s written approval when submitted to City. 00 73 10- 25 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 25 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 C. City shall be entitled to rely upon the adequacy, accuracy and completeness of the services, certifications or approvals performed by such design professionals, provided City has specified to Contractor performance and design criteria that such services must satisfy. D. Pursuant to this Paragraph 5.19, City’s review and acceptance of design calculations and design drawings will be only for the limited purpose of checking for conformance with performance and design criteria given and the design concept expressed in the Contract Documents. City’s review and acceptance of Submittals (except design calculations and design drawings) will be only for the purpose stated in Paragraph 5.16.C. 5.20 Right to Audit: A. The City reserves the right to audit all projects utilizing City funds B. The Contractor agrees that the City shall, until the expiration of three (3) years after final payment under this Contract, have access to and the right to examine and photocopy any directly pertinent books, documents, papers, and records of the Contractor involving transactions relating to this Contract. Contractor agrees that the City shall have access during Regular Working Hours to all necessary Contractor facilities and shall be provided adequate and appropriate work space in order to conduct audits in compliance with the provisions of this Paragraph. The City shall give Contractor reasonable advance notice of intended audits. C. Contractor further agrees to include in all its subcontracts hereunder a provision to the effect that the subcontractor agrees that the City shall, until the expiration of three (3) years after final payment under this Contract, have access to and the right to examine and photocopy any directly pertinent books, documents, papers, and records of such Subcontractor, involving transactions to the subcontract, and further, that City shall have access during Regular Working Hours to all Subcontractor facilities, and shall be provided adequate and appropriate work space in order to conduct audits in compliance with the provisions of this Paragraph. The City shall give Subcontractor reasonable advance notice of intended audits. D. Contractor and Subcontractor agree to photocopy such documents as may be requested by the City. The City agrees to reimburse Contractor for the cost of the copies as follows at the rate published in the Texas Administrative Code in effect as of the time copying is performed. 5.21 Nondiscrimination A. The City is responsible for operating Public Transportation Programs and implementing transit- related projects, which are funded in part with Federal financial assistance awarded by the U.S. Department of Transportation and the Federal Transit Administration (FTA), without discriminating against any person in the United States on the basis of race, color, or national origin. B. Title VI, Civil Rights Act of 1964 as amended: Contractor shall comply with the requirements of the Act and the Regulations as further defined in the Supplementary Conditions for any project receiving Federal assistance. 00 73 10- 26 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 26 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 ARTICLE 6 – OTHER WORK AT THE SITE 6.01 Related Work at Site A. City may perform other work related to the Project at the Site with City’s employees, or other City contractors, or through other direct contracts therefor, or have other work performed by utility owners. If such other work is not noted in the Contract Documents, then written notice thereof will be given to Contractor prior to starting any such other work; and B. Contractor shall afford each other contractor who is a party to such a direct contract, each utility owner, and City, if City is performing other work with City’s employees or other City contractors, proper and safe access to the Site, provide a reasonable opportunity for the introduction and storage of materials and equipment and the execution of such other work, and properly coordinate the Work with theirs. Contractor shall do all cutting, fitting, and patching of the Work that may be required to properly connect or otherwise make its several parts come together and properly integrate with such other work. Contractor shall not endanger any work of others by cutting, excavating, or otherwise altering such work; provided, however, that Contractor may cut or alter others' work with the written consent of City and the others whose work will be affected. C. If the proper execution or results of any part of Contractor’s Work depends upon work performed by others under this Article 7, Contractor shall inspect such other work and promptly report to City in writing any delays, defects, or deficiencies in such other work that render it unavailable or unsuitable for the proper execution and results of Contractor’s Work. Contractor’s failure to so report will constitute an acceptance of such other work as fit and proper for integration with Contractor’s Work except for latent defects in the work provided by others. ARTICLE 7 – CITY’S RESPONSIBILITIES 7.01 Inspections, Tests, and Approvals City’s responsibility with respect to certain inspections, tests, and approvals is set forth in Paragraph 11.03. 7.02 Limitations on City’s Responsibilities A. The City shall not supervise, direct, or have control or authority over, nor be responsible for, Contractor’s means, methods, techniques, sequences, or procedures of construction, or the safety precautions and programs incident thereto, or for any failure of Contractor to comply with Laws and Regulations applicable to the performance of the Work. City will not be responsible for Contractor’s failure to perform the Work in accordance with the Contract Documents. B. City will notify the Contractor of applicable safety plans pursuant to Paragraph 5.13. 00 73 10- 27 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 27 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 7.03 Compliance with Safety Program While at the Site, City’s employees and representatives shall comply with the specific applicable requirements of Contractor’s safety programs of which City has been informed pursuant to Paragraph 5.13. ARTICLE 8 – CITY’S OBSERVATION STATUS DURING CONSTRUCTION 8.01 City’s Project Representative City will provide one or more Project Representative(s) during the construction period. The duties and responsibilities and the limitations of authority of City’s representative during construction are set forth in the Contract Documents. A. City’s Project Representative will make visits to the Site at intervals appropriate to the various stages of construction as City deems necessary in order to observe the progress that has been made and the quality of the various aspects of Contractor’s executed Work. Based on information obtained during such visits and observations, City’s Project Representative will determine, in general, if the Work is proceeding in accordance with the Contract Documents. City’s Project Representative will not be required to make exhaustive or continuous inspections on the Site to check the quality or quantity of the Work. City’s Project Representative’s efforts will be directed toward providing City a greater degree of confidence that the completed Work will conform generally to the Contract Documents. B. City’s Project Representative’s visits and observations are subject to all the limitations on authority and responsibility in the Contract Documents. 8.02 Authorized Variations in Work City’s Project Representative may authorize minor variations in the Work from the requirements of the Contract Documents which do not involve an adjustment in the Contract Price or the Contract Time and are compatible with the design concept of the completed Project as a functioning whole as indicated by the Contract Documents. These may be accomplished by a Field Order and will be binding on City Developer, and also on Contractor, who shall perform the Work involved promptly. 8.03 Rejecting Defective Work City will have authority to reject Work which City’s Project Representative believes to be defective, or will not produce a completed Project that conforms to the Contract Documents or that will prejudice the integrity of the design concept of the completed Project as a functioning whole as indicated by the Contract Documents. City will have authority to conduct special inspection or testing of the Work as provided in Article 11, whether or not the Work is fabricated, installed, or completed. 00 73 10- 28 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 28 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 8.04 Determinations for Work Performed Contractor will determine the actual quantities and classifications of Work performed. City’s Project Representative will review with Contractor the preliminary determinations on such matters before rendering a written recommendation. City’s written decision will be final (except as modified to reflect changed factual conditions or more accurate data). ARTICLE 9 – CHANGES IN THE WORK 9.01 Authorized Changes in the Work A. Without invalidating the Contract and without notice to any surety, City may, at any time or from time to time, order Extra Work. Upon notice of such Extra Work, Contractor shall promptly proceed with the Work involved which will be performed under the applicable conditions of the Contract Documents (except as otherwise specifically provided). Extra Work shall be memorialized by a Participating Change Order which may or may not precede an order of Extra work. B. For minor changes of Work not requiring changes to Contract Time or Contract Price on a project with City participation, a Field Order may be issued by the City. 9.02 Notification to Surety If the provisions of any bond require notice to be given to a surety of any change affecting the general scope of the Work or the provisions of the Contract Documents (including, but not limited to, Contract Price or Contract Time), the giving of any such notice will be Contractor’s responsibility. The amount of each applicable bond will be adjusted by the Contractor to reflect the effect of any such change. ARTICLE 10 – CHANGE OF CONTRACT PRICE; CHANGE OF CONTRACT TIME 10.01 Change of Contract Price A. The Contract Price may only be changed by a Participating Change Order for projects with City participation. 10.02 Change of Contract Time A. The Contract Time may only be changed by a Participating Change Order for projects with City participation. 10.03 Delays A. If Contractor is delayed, City shall not be liable to Contractor for any claims, costs, losses, or damages (including but not limited to all fees and charges of engineers, architects, attorneys, and other professionals and all court or arbitration or other dispute resolution costs) sustained by Contractor on or in connection with any other project or anticipated project. 00 73 10- 29 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 29 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 ARTICLE 11 – TESTS AND INSPECTIONS; CORRECTION, REMOVAL OR ACCEPTANCE OF DEFECTIVE WORK 11.01 Notice of Defects Notice of all defective Work of which City has actual knowledge will be given to Contractor. Defective Work may be rejected, corrected, or accepted as provided in this Article 13. 11.02 Access to Work City, independent testing laboratories, and governmental agencies with jurisdictional interests will have access to the Site and the Work at reasonable times for their observation, inspection, and testing. Contractor shall provide them proper and safe conditions for such access and advise them of Contractor’s safety procedures and programs so that they may comply therewith as applicable. 11.03 Tests and Inspections A. Contractor shall give City timely notice of readiness of the Work for all required inspections, tests, or approvals and shall cooperate with inspection and testing personnel to facilitate required inspections or tests. B. If Contract Documents, Laws or Regulations of any public body having jurisdiction require any of the Work (or part thereof) to be inspected, tested, or approved, Contractor shall assume full responsibility for arranging and obtaining such independent inspections, tests, retests or approvals, pay all costs in connection therewith, and furnish City the required certificates of inspection or approval; excepting, however, those fees specifically identified in the Supplementary Conditions or any Texas Department of Licensure and Regulation (TDLR) inspections, which shall be paid as described in the Supplementary Conditions. C. Contractor shall be responsible for arranging and obtaining and shall pay all costs in connection with any inspections, tests, re-tests, or approvals required for City’s acceptance of materials or equipment to be incorporated in the Work; or acceptance of materials, mix designs, or equipment submitted for approval prior to Contractor’s purchase thereof for incorporation in the Work. Such inspections, tests, re-tests, or approvals shall be performed by organizations approved by City. D. City may arrange for the services of an independent testing laboratory (“Testing Lab”) to perform any inspections or tests (“Testing”) for any part of the Work, as determined solely by City. 1. City will coordinate such Testing to the extent possible, with Contractor; 2. Should any Testing under this Section 11.03 D result in a “fail”, “did not pass” or other similar negative result, the Contractor shall be responsible for paying for any and all retests. Contractor’s cancellation without cause of City initiated Testing shall be deemed a negative result and require a retest. 00 73 10- 30 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 30 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 3. Any amounts owed for any retest under this Section 11.03 D shall be paid directly to the Testing Lab by Contractor. City will forward all invoices for retests to Developer/Contractor. 4. If Contractor fails to pay the Testing Lab, City will not issue a letter of Final Acceptance until the Testing Lab is Paid E. If any Work (or the work of others) that is to be inspected, tested, or approved is covered by Contractor without written concurrence of City, Contractor shall, if requested by City, uncover such Work for observation. 11.04 Uncovering Work A. If any Work is covered contrary to the Contract Documents or specific instructions by the City, it must, if requested by City, be uncovered for City’s observation and replaced at Contractor’s expense. 11.05 City May Stop the Work If the Work is defective, or Contractor fails to supply sufficient skilled workers or suitable materials or equipment, or fails to perform the Work in such a way that the completed Work will conform to the Contract Documents, City may order Contractor to stop the Work, or any portion thereof, until the cause for such order has been eliminated; however, this right of City to stop the Work shall not give rise to any duty on the part of City to exercise this right for the benefit of Contractor, any Subcontractor, any Supplier, any other individual or entity, or any surety for, or employee or agent of any of them. 11.06 Correction or Removal of Defective Work A. Promptly after receipt of written notice, Contractor shall correct all defective Work pursuant to an acceptable schedule, whether or not fabricated, installed, or completed, or, if the Work has been rejected by City, remove it from the Project and replace it with Work that is not defective. Contractor shall pay all claims, costs, additional testing, losses, and damages (including but not limited to all fees and charges of engineers, architects, attorneys, and other professionals and all court or arbitration or other dispute resolution costs) arising out of or relating to such correction or removal (including but not limited to all costs of repair or replacement of work of others). Failure to require the removal of any defective Work shall not constitute acceptance of such Work. B. When correcting defective Work under the terms of this Paragraph 11.06 or Paragraph 11.07, Contractor shall take no action that would void or otherwise impair City’s special warranty and guarantee, if any, on said Work. 11.07 Correction Period A. If within two (2) years after the date of Final Acceptance (or such longer period of time as may be prescribed by the terms of any applicable special guarantee required by the Contract 00 73 10- 31 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 31 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 Documents), any Work is found to be defective, or if the repair of any damages to the land or areas made available for Contractor’s use by City or permitted by Laws and Regulations as contemplated in Paragraph 5.10.A is found to be defective, Contractor shall promptly, without cost to City and in accordance with City’s written instructions: 1. repair such defective land or areas; or 2. correct such defective Work; or 3. if the defective Work has been rejected by City, remove it from the Project and replace it with Work that is not defective, and 4. satisfactorily correct or repair or remove and replace any damage to other Work, to the work of others or other land or areas resulting therefrom. B. If Contractor does not promptly comply with the terms of City’s written instructions, or in an emergency where delay would cause serious risk of loss or damage, City may have the defective Work corrected or repaired or may have the rejected Work removed and replaced. All claims, costs, losses, and damages (including but not limited to all fees and charges of engineers, architects, attorneys, and other professionals and all court or other dispute resolution costs) arising out of or relating to such correction or repair or such removal and replacement (including but not limited to all costs of repair or replacement of work of others) will be paid by Contractor. C. Where defective Work (and damage to other Work resulting therefrom) has been corrected or removed and replaced under this Paragraph 11.07, the correction period hereunder with respect to such Work may be required to be extended for an additional period of one year after the end of the initial correction period. City shall provide 30 days written notice to Contractor and Developer should such additional warranty coverage be required. Contractor’s obligations under this Paragraph 11.07 are in addition to any other obligation or warranty. The provisions of this Paragraph 11.07 shall not be construed as a substitute for, or a waiver of, the provisions of any applicable statute of limitation or repose. 11.08 City May Correct Defective Work A. If Contractor fails within a reasonable time after written notice from City to correct defective Work, or to remove and replace rejected Work as required by City in accordance with Paragraph 11.06.A, or if Contractor fails to perform the Work in accordance with the Contract Documents, or if Contractor fails to comply with any other provision of the Contract Documents, City may, after seven (7) days written notice to Contractor and the Developer, correct, or remedy any such deficiency. B. In exercising the rights and remedies under this Paragraph 11.09, City shall proceed expeditiously. In connection with such corrective or remedial action, City may exclude Contractor from all or part of the Site, take possession of all or part of the Work and suspend Contractor’s services related thereto, and incorporate in the Work all materials and equipment incorporated in the Work, stored at the Site or for which City has paid Contractor but which are 00 73 10- 32 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 32 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 stored elsewhere. Contractor shall allow City, City’s representatives, agents, consultants, employees, and City’s other contractors, access to the Site to enable City to exercise the rights and remedies under this Paragraph. C. All claims, costs, losses, and damages (including but not limited to all fees and charges of engineers, architects, attorneys, and other professionals and all court or other dispute resolution costs) incurred or sustained by City in exercising the rights and remedies under this Paragraph 13.09 will be charged against Contractor, and a Change Order will be issued incorporating the necessary revisions in the Contract Documents with respect to the Work; and City shall be entitled to an appropriate decrease in the Contract Price. D. Contractor shall not be allowed an extension of the Contract Time because of any delay in the performance of the Work attributable to the exercise of City’s rights and remedies under this Paragraph 11.09. ARTICLE 12 – COMPLETION 12.01 Contractor’s Warranty of Title Contractor warrants and guarantees that title to all Work, materials, and equipment covered by any Application for Payment will pass to City no later than the time of Final Acceptance and shall be free and clear of all Liens. 12.02 Partial Utilization A. Prior to Final Acceptance of all the Work, City may use or occupy any substantially completed part of the Work which has specifically been identified in the Contract Documents, or which City, determines constitutes a separately functioning and usable part of the Work that can be used by City for its intended purpose without significant interference with Contractor’s performance of the remainder of the Work. City at any time may notify Contractor in writing to permit City to use or occupy any such part of the Work which City determines to be ready for its intended use, subject to the following conditions: 1. Contractor at any time may notify City in writing that Contractor considers any such part of the Work ready for its intended use. 2. Within a reasonable time after notification as enumerated in Paragraph 14.05.A.1, City and Contractor shall make an inspection of that part of the Work to determine its status of completion. If City does not consider that part of the Work to be substantially complete, City will notify Contractor in writing giving the reasons therefor. 3. Partial Utilization will not constitute Final Acceptance by City. 12.03 Final Inspection A. Upon written notice from Contractor that the entire Work is complete in accordance with the Contract Documents: 00 73 10- 33 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 33 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 1. within 10 days, City will schedule a Final Inspection with Contractor. 2. City will notify Contractor in writing of all particulars in which this inspection reveals that the Work is incomplete or defective. Contractor shall immediately take such measures as are necessary to complete such Work or remedy such deficiencies. 12.04 Final Acceptance A. Upon completion by Contractor to City’s satisfaction, of any additional Work identified in the Final Inspection, City will issue to Contractor a letter of Final Acceptance upon the satisfaction of the following: 1. All documentation called for in the Contract Documents, including but not limited to the evidence of insurance required by Paragraph 5.03; 2. consent of the surety, if any, to Final Acceptance; 3. a list of all pending or released Damage Claims against City that Contractor believes are unsettled; and 4. affidavits of payments and complete and legally effective releases or waivers (satisfactory to City) of all Lien rights arising out of or Liens filed in connection with the Work. 5. after all Damage Claims have been resolved: a. directly by the Contractor or; b. Contractor provides evidence that the Damage Claim has been reported to Contractor’s insurance provider for resolution. 6. Issuing Final Acceptance by the City shall not relieve the Contractor of any guarantees or other requirements of the Contract Documents which specifically continue thereafter. ARTICLE 13 – SUSPENSION OF WORK 13.01 City May Suspend Work A. At any time and without cause, City may suspend the Work or any portion thereof by written notice to Contractor and which may fix the date on which Work will be resumed. Contractor shall resume the Work on the date so fixed. During temporary suspension of the Work covered by these Contract Documents, for any reason, the City will stop contract time on City participation projects. B. Should the Contractor not be able to complete a portion of the Project due to causes beyond the control of and without the fault or negligence of the Contractor, and should it be determined by mutual consent of the Contractor and City that a solution to allow construction to proceed is not 00 73 10- 34 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 34 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 available within a reasonable period of time, Contractor may request an extension in Contract Time, directly attributable to any such suspension. C. If it should become necessary to suspend the Work for an indefinite period, the Contractor shall store all materials in such a manner that they will not obstruct or impede the public unnecessarily nor become damaged in any way, and he shall take every precaution to prevent damage or deterioration of the work performed; he shall provide suitable drainage about the work, and erect temporary structures where necessary. ARTICLE 14 – MISCELLANEOUS 14.01 Giving Notice A. Whenever any provision of the Contract Documents requires the giving of written notice, it will be deemed to have been validly given if: 1. delivered in person to the individual or to a member of the firm or to an officer of the corporation for whom it is intended; or 2. delivered at or sent by registered or certified mail, postage prepaid, to the last business address known to the giver of the notice. B. Business address changes must be promptly made in writing to the other party. C. Whenever the Contract Documents specifies giving notice by electronic means such electronic notice shall be deemed sufficient upon confirmation of receipt by the receiving party. 14.02 Computation of Times When any period of time is referred to in the Contract Documents by days, it will be computed to exclude the first and include the last day of such period. If the last day of any such period falls on a Saturday or Sunday or on a day made a legal holiday the next Working Day shall become the last day of the period. 14.03 Cumulative Remedies The duties and obligations imposed by these General Conditions and the rights and remedies available hereunder to the parties hereto are in addition to, and are not to be construed in any way as a limitation of, any rights and remedies available to any or all of them which are otherwise imposed or available by Laws or Regulations, by special warranty or guarantee, or by other provisions of the Contract Documents. The provisions of this Paragraph will be as effective as if repeated specifically in the Contract Documents in connection with each particular duty, obligation, right, and remedy to which they apply. 00 73 10- 35 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 35 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 14.04 Survival of Obligations All representations, indemnifications, warranties, and guarantees made in, required by, or given in accordance with the Contract Documents, as well as all continuing obligations indicated in the Contract Documents, will survive final payment, completion, and acceptance of the Work or termination or completion of the Contract or termination of the services of Contractor. 14.05 Headings Article and paragraph headings are inserted for convenience only and do not constitute parts of these General Conditions. 01 11 00 - 1 DAP SUMMARY OF WORK Page 1 of 3 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – Developer Awarded Projects City Project No. 102824 Revised December 20, 2012 SECTION 01 11 00 1 SUMMARY OF WORK 2 PART 1 - GENERAL 3 1.1 SUMMARY 4 A. Section Includes: 5 1. Summary of Work to be performed in accordance with the Contract Documents 6 B. Deviations from this City of Fort Worth Standard Specification 7 1. None. 8 C. Related Specification Sections include, but are not necessarily limited to: 9 1. Division 0 - Bidding Requirements, Contract Forms, and Conditions of the Contract 10 2. Division 1 - General Requirements 11 1.2 PRICE AND PAYMENT PROCEDURES 12 A. Measurement and Payment 13 1. Work associated with this Item is considered subsidiary to the various items bid. 14 No separate payment will be allowed for this Item. 15 1.3 REFERENCES [NOT USED] 16 1.4 ADMINISTRATIVE REQUIREMENTS 17 A. Work Covered by Contract Documents 18 1. Work is to include furnishing all labor, materials, and equipment, and performing 19 all Work necessary for this construction project as detailed in the Drawings and 20 Specifications. 21 B. Subsidiary Work 22 1. Any and all Work specifically governed by documentary requirements for the 23 project, such as conditions imposed by the Drawings or Contract Documents in 24 which no specific item for bid has been provided for in the Proposal and the item is 25 not a typical unit bid item included on the standard bid item list, then the item shall 26 be considered as a subsidiary item of Work, the cost of which shall be included in 27 the price bid in the Proposal for various bid items. 28 C. Use of Premises 29 1. Coordinate uses of premises under direction of the City. 30 2. Assume full responsibility for protection and safekeeping of materials and 31 equipment stored on the Site. 32 3. Use and occupy only portions of the public streets and alleys, or other public places 33 or other rights-of-way as provided for in the ordinances of the City, as shown in the 34 Contract Documents, or as may be specifically authorized in writing by the City. 35 a. A reasonable amount of tools, materials, and equipment for construction 36 purposes may be stored in such space, but no more than is necessary to avoid 37 delay in the construction operations. 38 01 11 00 - 2 DAP SUMMARY OF WORK Page 2 of 3 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – Developer Awarded Projects City Project No. 102824 Revised December 20, 2012 b. Excavated and waste materials shall be stored in such a way as not to interfere 1 with the use of spaces that may be designated to be left free and unobstructed 2 and so as not to inconvenience occupants of adjacent property. 3 c. If the street is occupied by railroad tracks, the Work shall be carried on in such 4 manner as not to interfere with the operation of the railroad. 5 1) All Work shall be in accordance with railroad requirements set forth in 6 Division 0 as well as the railroad permit. 7 D. Work within Easements 8 1. Do not enter upon private property for any purpose without having previously 9 obtained permission from the owner of such property. 10 2. Do not store equipment or material on private property unless and until the 11 specified approval of the property owner has been secured in writing by the 12 Contractor and a copy furnished to the City. 13 3. Unless specifically provided otherwise, clear all rights-of-way or easements of 14 obstructions which must be removed to make possible proper prosecution of the 15 Work as a part of the project construction operations. 16 4. Preserve and use every precaution to prevent damage to, all trees, shrubbery, plants, 17 lawns, fences, culverts, curbing, and all other types of structures or improvements, 18 to all water, sewer, and gas lines, to all conduits, overhead pole lines, or 19 appurtenances thereof, including the construction of temporary fences and to all 20 other public or private property adjacent to the Work. 21 5. Notify the proper representatives of the owners or occupants of the public or private 22 lands of interest in lands which might be affected by the Work. 23 a. Such notice shall be made at least 48 hours in advance of the beginning of the 24 Work. 25 b. Notices shall be applicable to both public and private utility companies and any 26 corporation, company, individual, or other, either as owners or occupants, 27 whose land or interest in land might be affected by the Work. 28 c. Be responsible for all damage or injury to property of any character resulting 29 from any act, omission, neglect, or misconduct in the manner or method or 30 execution of the Work, or at any time due to defective work, material, or 31 equipment. 32 6. Fence 33 a. Restore all fences encountered and removed during construction of the Project 34 to the original or a better than original condition. 35 b. Erect temporary fencing in place of the fencing removed whenever the Work is 36 not in progress and when the site is vacated overnight, and/or at all times to 37 provide site security. 38 c. The cost for all fence work within easements, including removal, temporary 39 closures and replacement, shall be subsidiary to the various items bid in the 40 project proposal, unless a bid item is specifically provided in the proposal. 41 01 11 00 - 3 DAP SUMMARY OF WORK Page 3 of 3 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – Developer Awarded Projects City Project No. 102824 Revised December 20, 2012 1.5 SUBMITTALS [NOT USED] 1 1.6 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS [NOT USED] 2 1.7 CLOSEOUT SUBMITTALS [NOT USED] 3 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 4 1.9 QUALITY ASSURANCE [NOT USED] 5 1.10 DELIVERY, STORAGE, AND HANDLING [NOT USED] 6 1.11 FIELD [SITE] CONDITIONS [NOT USED] 7 1.12 WARRANTY [NOT USED] 8 PART 2 - PRODUCTS [NOT USED] 9 PART 3 - EXECUTION [NOT USED] 10 END OF SECTION 11 12 Revision Log DATE NAME SUMMARY OF CHANGE 13 01 25 00 - 1 DAP SUBSTITUTION PROCEDURES Page 1 of 4 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised August 30, 2013 SECTION 01 25 00 SUBSTITUTION PROCEDURES PART 1 - GENERAL 1.1 SUMMARY A. Section Includes: 1. The procedure for requesting the approval of substitution of a product that is not equivalent to a product which is specified by descriptive or performance criteria or defined by reference to 1 or more of the following: a. Name of manufacturer b. Name of vendor c. Trade name d. Catalog number 2. Substitutions are not "or-equals". B. Deviations from this City of Fort Worth Standard Specification 1. None. C. Related Specification Sections include, but are not necessarily limited to: 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 2. Division 1 – General Requirements 1.2 PRICE AND PAYMENT PROCEDURES A. Measurement and Payment 1. Work associated with this Item is considered subsidiary to the various items bid. No separate payment will be allowed for this Item. 1.3 REFERENCES [NOT USED] 1.4 ADMINISTRATIVE REQUIREMENTS A. Request for Substitution - General 1. Within 30 days after award of Contract (unless noted otherwise), the City will consider formal requests from Contractor for substitution of products in place of those specified. 2. Certain types of equipment and kinds of material are described in Specifications by means of references to names of manufacturers and vendors, trade names, or catalog numbers. a. When this method of specifying is used, it is not intended to exclude from consideration other products bearing other manufacturer's or vendor's names, trade names, or catalog numbers, provided said products are "or-equals," as determined by City. 3. Other types of equipment and kinds of material may be acceptable substitutions under the following conditions: a. Or-equals are unavailable due to strike, discontinued production of products meeting specified requirements, or other factors beyond control of Contractor; or, East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 01 25 00 - 2 DAP SUBSTITUTION PROCEDURES Page 2 of 4 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised August 30, 2013 b. Contractor proposes a cost and/or time reduction incentive to the City. 1.5 SUBMITTALS A. See Request for Substitution Form (attached) B. Procedure for Requesting Substitution 1. Substitution shall be considered only: a. After award of Contract b. Under the conditions stated herein 2. Submit 3 copies of each written request for substitution, including: a. Documentation 1) Complete data substantiating compliance of proposed substitution with Contract Documents 2) Data relating to changes in construction schedule, when a reduction is proposed 3) Data relating to changes in cost b. For products 1) Product identification a) Manufacturer's name b) Telephone number and representative contact name c) Specification Section or Drawing reference of originally specified product, including discrete name or tag number assigned to original product in the Contract Documents 2) Manufacturer's literature clearly marked to show compliance of proposed product with Contract Documents 3) Itemized comparison of original and proposed product addressing product characteristics including, but not necessarily limited to: a) Size b) Composition or materials of construction c) Weight d) Electrical or mechanical requirements 4) Product experience a) Location of past projects utilizing product b) Name and telephone number of persons associated with referenced projects knowledgeable concerning proposed product c) Available field data and reports associated with proposed product 5) Samples a) Provide at request of City. b) Samples become the property of the City. c. For construction methods: 1) Detailed description of proposed method 2) Illustration drawings C. Approval or Rejection 1. Written approval or rejection of substitution given by the City 2. City reserves the right to require proposed product to comply with color and pattern of specified product if necessary to secure design intent. 3. In the event the substitution is approved, if a reduction in cost or time results, it will be documented by Change Order. East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 01 25 00 - 3 DAP SUBSTITUTION PROCEDURES Page 3 of 4 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised August 30, 2013 4. Substitution will be rejected if: a. Submittal is not through the Contractor with his stamp of approval b. Request is not made in accordance with this Specification Section c. In the Developer’s opinion, acceptance will require substantial revision of the original design d. In the City’s or Developer’s opinion, substitution will not perform adequately the function consistent with the design intent 1.6 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS [NOT USED] 1.7 CLOSEOUT SUBMITTALS [NOT USED] 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 1.9 QUALITY ASSURANCE A. In making request for substitution or in using an approved product, the Contractor represents that the Contractor: 1. Has investigated proposed product, and has determined that it is adequate or superior in all respects to that specified, and that it will perform function for which it is intended 2. Will provide same guarantee for substitute item as for product specified 3. Will coordinate installation of accepted substitution into Work, to include building modifications if necessary, making such changes as may be required for Work to be complete in all respects 4. Waives all claims for additional costs related to substitution which subsequently arise 1.10 DELIVERY, STORAGE, AND HANDLING [NOT USED] 1.11 FIELD [SITE] CONDITIONS [NOT USED] 1.12 WARRANTY [NOT USED] PART 2 - PRODUCTS [NOT USED] PART 3 - EXECUTION [NOT USED] END OF SECTION Revision Log DATE NAME SUMMARY OF CHANGE East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 01 25 00 - 4 DAP SUBSTITUTION PROCEDURES Page 4 of 4 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised August 30, 2013 EXHIBIT A REQUEST FOR SUBSTITUTION FORM: TO: PROJECT: DATE: We hereby submit for your consideration the following product instead of the specified item for the above project: SECTION PARAGRAPH SPECIFIED ITEM Proposed Substitution: Reason for Substitution: Include complete information on changes to Drawings and/or Specifications which proposed substitution will require for its proper installation. Fill in Blanks Below: A. Will the undersigned contractor pay for changes to the building design, including engineering and detailing costs caused by the requested substitution? B. What effect does substitution have on other trades? C. Differences between proposed substitution and specified item? D. Differences in product cost or product delivery time? E. Manufacturer's guarantees of the proposed and specified items are: Equal Better (explain on attachment) The undersigned states that the function, appearance and quality are equivalent or superior to the specified item. Submitted By: For Use by City Signature Recommended Recommended as noted Firm Not recommended Received late Address By Date Date Remarks Telephone For Use by City: Approved Rejected City Date East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 01 31 19 - 1 DAP PRECONSTRUCTION MEETING Page 1 of 3 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised August 30, 2013 SECTION 01 31 19 PRECONSTRUCTION MEETING PART 1 - GENERAL 1.1 SUMMARY A. Section Includes: 1. Provisions for the preconstruction meeting to be held prior to the start of Work to clarify construction contract administration procedures B. Deviations from this City of Fort Worth Standard Specification 1. No construction schedule required unless requested by the City. C. Related Specification Sections include, but are not necessarily limited to: 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 2. Division 1 – General Requirements 1.2 PRICE AND PAYMENT PROCEDURES A. Measurement and Payment 1. Work associated with this Item is considered subsidiary to the various items bid. No separate payment will be allowed for this Item. 1.3 REFERENCES [NOT USED] 1.4 ADMINISTRATIVE REQUIREMENTS A. Coordination 1. Attend preconstruction meeting. 2. Representatives of Contractor, subcontractors and suppliers attending meetings shall be qualified and authorized to act on behalf of the entity each represents. 3. Meeting administered by City may be tape recorded. a. If recorded, tapes will be used to prepare minutes and retained by City for future reference. B. Preconstruction Meeting 1. A preconstruction meeting will be held within 14 days after the delivery of the distribution package to the City. a. The meeting will be scheduled and administered by the City. 2. The Project Representative will preside at the meeting, prepare the notes of the meeting and distribute copies of same to all participants who so request by fully completing the attendance form to be circulated at the beginning of the meeting. 3. Attendance shall include: a. Developer and Consultant b. Contractor's project manager c. Contractor's superintendent d. Any subcontractor or supplier representatives whom the Contractor may desire to invite or the City may request East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 01 31 19 - 2 DAP PRECONSTRUCTION MEETING Page 2 of 3 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised August 30, 2013 e. Other City representatives f. Others as appropriate 4. Preliminary Agenda may include: a. Introduction of Project Personnel b. General Description of Project c. Status of right-of-way, utility clearances, easements or other pertinent permits d. Contractor’s work plan and schedule e. Contract Time f. Notice to Proceed g. Construction Staking h. Progress Payments i. Extra Work and Change Order Procedures j. Field Orders k. Disposal Site Letter for Waste Material l. Insurance Renewals m. Payroll Certification n. Material Certifications and Quality Control Testing o. Public Safety and Convenience p. Documentation of Pre-Construction Conditions q. Weekend Work Notification r. Legal Holidays s. Trench Safety Plans t. Confined Space Entry Standards u. Coordination with the City’s representative for operations of existing water systems v. Storm Water Pollution Prevention Plan w. Coordination with other Contractors x. Early Warning System y. Contractor Evaluation z. Special Conditions applicable to the project aa. Damages Claims bb. Submittal Procedures cc. Substitution Procedures dd. Correspondence Routing ee. Record Drawings ff. Temporary construction facilities gg. MBE/SBE procedures hh. Final Acceptance ii. Final Payment jj. Questions or Comments East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 01 31 19 - 3 DAP PRECONSTRUCTION MEETING Page 3 of 3 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised August 30, 2013 1.5 SUBMITTALS [NOT USED] 1.6 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS [NOT USED] 1.7 CLOSEOUT SUBMITTALS [NOT USED] 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 1.9 QUALITY ASSURANCE [NOT USED] 1.10 DELIVERY, STORAGE, AND HANDLING [NOT USED] 1.11 FIELD [SITE] CONDITIONS [NOT USED] 1.12 WARRANTY [NOT USED] PART 2 - PRODUCTS [NOT USED] PART 3 - EXECUTION [NOT USED] END OF SECTION Revision Log DATE NAME SUMMARY OF CHANGE City Project No. 102824 East Parker County Subcourthouse Water & Sewer Main Extensions 01 33 00 - 1 DAP SUBMITTALS Page 1 of 8 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised August 30, 2013 SECTION 01 33 00 DAP SUBMITTALS PART 1 - GENERAL 1.1 SUMMARY A. Section Includes: 1. General methods and requirements of submissions applicable to the following Work-related submittals: a. Shop Drawings b. Product Data (including Standard Product List submittals) c. Samples d. Mock Ups B. Deviations from this City of Fort Worth Standard Specification 1. None. C. Related Specification Sections include, but are not necessarily limited to: 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 2. Division 1 – General Requirements 1.2 PRICE AND PAYMENT PROCEDURES A. Measurement and Payment 1. Work associated with this Item is considered subsidiary to the various items bid. No separate payment will be allowed for this Item. 1.3 REFERENCES [NOT USED] 1.4 ADMINISTRATIVE REQUIREMENTS A. Coordination 1. Notify the City in writing, at the time of submittal, of any deviations in the submittals from the requirements of the Contract Documents. 2. Coordination of Submittal Times a. Prepare, prioritize and transmit each submittal sufficiently in advance of performing the related Work or other applicable activities, or within the time specified in the individual Work Sections, of the Specifications. b. Contractor is responsible such that the installation will not be delayed by processing times including, but not limited to: a) Disapproval and resubmittal (if required) b) Coordination with other submittals c) Testing d) Purchasing e) Fabrication f) Delivery g) Similar sequenced activities c. No extension of time will be authorized because of the Contractor's failure to transmit submittals sufficiently in advance of the Work. East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 01 33 00 - 2 DAP SUBMITTALS Page 2 of 8 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised August 30, 2013 d. Make submittals promptly in accordance with approved schedule, and in such sequence as to cause no delay in the Work or in the work of any other contractor. B. Submittal Numbering 1. When submitting shop drawings or samples, utilize a 9-character submittal cross- reference identification numbering system in the following manner: a. Use the first 6 digits of the applicable Specification Section Number. b. For the next 2 digits number use numbers 01-99 to sequentially number each initial separate item or drawing submitted under each specific Section number. c. Last use a letter, A-Z, indicating the resubmission of the same drawing (i.e. A=2nd submission, B=3rd submission, C=4th submission, etc.). A typical submittal number would be as follows: 03 30 00-08-B 1) 03 30 00 is the Specification Section for Concrete 2) 08 is the eighth initial submittal under this Specification Section 3) B is the third submission (second resubmission) of that particular shop drawing C. Contractor Certification 1. Review shop drawings, product data and samples, including those by subcontractors, prior to submission to determine and verify the following: a. Field measurements b. Field construction criteria c. Catalog numbers and similar data d. Conformance with the Contract Documents 2. Provide each shop drawing, sample and product data submitted by the Contractor with a Certification Statement affixed including: a. The Contractor's Company name b. Signature of submittal reviewer c. Certification Statement 1) “By this submittal, I hereby represent that I have determined and verified field measurements, field construction criteria, materials, dimensions, catalog numbers and similar data and I have checked and coordinated each item with other applicable approved shop drawings." D. Submittal Format 1. Fold shop drawings larger than 8 ½ inches x 11 inches to 8 ½ inches x 11inches. 2. Bind shop drawings and product data sheets together. 3. Order a. Cover Sheet 1) Description of Packet 2) Contractor Certification b. List of items / Table of Contents c. Product Data /Shop Drawings/Samples /Calculations E. Submittal Content 1. The date of submission and the dates of any previous submissions East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 01 33 00 - 3 DAP SUBMITTALS Page 3 of 8 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised August 30, 2013 2. The Project title and number 3. Contractor identification 4. The names of: a. Contractor b. Supplier c. Manufacturer 5. Identification of the product, with the Specification Section number, page and paragraph(s) 6. Field dimensions, clearly identified as such 7. Relation to adjacent or critical features of the Work or materials 8. Applicable standards, such as ASTM or Federal Specification numbers 9. Identification by highlighting of deviations from Contract Documents 10. Identification by highlighting of revisions on resubmittals 11. An 8-inch x 3-inch blank space for Contractor and City stamps F. Shop Drawings 1. As specified in individual Work Sections includes, but is not necessarily limited to: a. Custom-prepared data such as fabrication and erection/installation (working) drawings b. Scheduled information c. Setting diagrams d. Actual shopwork manufacturing instructions e. Custom templates f. Special wiring diagrams g. Coordination drawings h. Individual system or equipment inspection and test reports including: 1) Performance curves and certifications i. As applicable to the Work 2. Details a. Relation of the various parts to the main members and lines of the structure b. Where correct fabrication of the Work depends upon field measurements 1) Provide such measurements and note on the drawings prior to submitting for approval. G. Product Data 1. For submittals of product data for products included on the City’s Standard Product List, clearly identify each item selected for use on the Project. 2. For submittals of product data for products not included on the City’s Standard Product List, submittal data may include, but is not necessarily limited to: a. Standard prepared data for manufactured products (sometimes referred to as catalog data) 1) Such as the manufacturer's product specification and installation instructions 2) Availability of colors and patterns 3) Manufacturer's printed statements of compliances and applicability 4) Roughing-in diagrams and templates 5) Catalog cuts 6) Product photographs East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 01 33 00 - 4 DAP SUBMITTALS Page 4 of 8 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised August 30, 2013 7) Standard wiring diagrams 8) Printed performance curves and operational-range diagrams 9) Production or quality control inspection and test reports and certifications 10) Mill reports 11) Product operating and maintenance instructions and recommended spare-parts listing and printed product warranties 12) As applicable to the Work H. Samples 1. As specified in individual Sections, include, but are not necessarily limited to: a. Physical examples of the Work such as: 1) Sections of manufactured or fabricated Work 2) Small cuts or containers of materials 3) Complete units of repetitively used products color/texture/pattern swatches and range sets 4) Specimens for coordination of visual effect 5) Graphic symbols and units of Work to be used by the City for independent inspection and testing, as applicable to the Work I. Do not start Work requiring a shop drawing, sample or product data nor any material to be fabricated or installed prior to the approval or qualified approval of such item. 1. Fabrication performed, materials purchased or on-site construction accomplished which does not conform to approved shop drawings and data is at the Contractor's risk. 2. The City will not be liable for any expense or delay due to corrections or remedies required to accomplish conformity. 3. Complete project Work, materials, fabrication, and installations in conformance with approved shop drawings, applicable samples, and product data. J. Submittal Distribution 1. Electronic Distribution a. Confirm development of Project directory for electronic submittals to be uploaded to City’s Buzzsaw site, or another external FTP site approved by the City. b. Shop Drawings 1) Upload submittal to designated project directory and notify appropriate City representatives via email of submittal posting. 2) Hard Copies a) 3 copies for all submittals b) If Contractor requires more than 1 hard copy of Shop Drawings returned, Contractor shall submit more than the number of copies listed above. c. Product Data 1) Upload submittal to designated project directory and notify appropriate City representatives via email of submittal posting. 2) Hard Copies a) 3 copies for all submittals d. Samples 1) Distributed to the Project Representative 2. Hard Copy Distribution (if required in lieu of electronic distribution) East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 01 33 00 - 5 DAP SUBMITTALS Page 5 of 8 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised August 30, 2013 a. Shop Drawings 1) Distributed to the City 2) Copies a) 8 copies for mechanical submittals b) 7 copies for all other submittals c) If Contractor requires more than 3 copies of Shop Drawings returned, Contractor shall submit more than the number of copies listed above. b. Product Data 1) Distributed to the City 2) Copies a) 4 copies c. Samples 1) Distributed to the Project Representative 2) Copies a) Submit the number stated in the respective Specification Sections. 3. Distribute reproductions of approved shop drawings and copies of approved product data and samples, where required, to the job site file and elsewhere as directed by the City. a. Provide number of copies as directed by the City but not exceeding the number previously specified. K. Submittal Review 1. The review of shop drawings, data and samples will be for general conformance with the design concept and Contract Documents. This is not to be construed as: a. Permitting any departure from the Contract requirements b. Relieving the Contractor of responsibility for any errors, including details, dimensions, and materials c. Approving departures from details furnished by the City, except as otherwise provided herein 2. The review and approval of shop drawings, samples or product data by the City does not relieve the Contractor from his/her responsibility with regard to the fulfillment of the terms of the Contract. a. All risks of error and omission are assumed by the Contractor, and the City will have no responsibility therefore. 3. The Contractor remains responsible for details and accuracy, for coordinating the Work with all other associated work and trades, for selecting fabrication processes, for techniques of assembly and for performing Work in a safe manner. 4. If the shop drawings, data or samples as submitted describe variations and show a departure from the Contract requirements which City finds to be in the interest of the City and to be so minor as not to involve a change in Contract Price or time for performance, the City may return the reviewed drawings without noting an exception. 5. Submittals will be returned to the Contractor under 1 of the following codes: a. Code 1 1) "NO EXCEPTIONS TAKEN" is assigned when there are no notations or comments on the submittal. a) When returned under this code the Contractor may release the equipment and/or material for manufacture. b. Code 2 East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 01 33 00 - 6 DAP SUBMITTALS Page 6 of 8 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised August 30, 2013 1) "EXCEPTIONS NOTED". This code is assigned when a confirmation of the notations and comments IS NOT required by the Contractor. a) The Contractor may release the equipment or material for manufacture; however, all notations and comments must be incorporated into the final product. c. Code 3 1) "EXCEPTIONS NOTED/RESUBMIT". This combination of codes is assigned when notations and comments are extensive enough to require a resubmittal of the package. a) The Contractor may release the equipment or material for manufacture; however, all notations and comments must be incorporated into the final product. b) This resubmittal is to address all comments, omissions and non-conforming items that were noted. c) Resubmittal is to be received by the City within 15 Calendar Days of the date of the City's transmittal requiring the resubmittal. d. Code 4 1) "NOT APPROVED" is assigned when the submittal does not meet the intent of the Contract Documents. a) The Contractor must resubmit the entire package revised to bring the submittal into conformance. b) It may be necessary to resubmit using a different manufacturer/vendor to meet the Contract Documents. 6. Resubmittals a. Handled in the same manner as first submittals 1) Corrections other than requested by the City 2) Marked with revision triangle or other similar method a) At Contractor’s risk if not marked b. Submittals for each item will be reviewed no more than twice at the City’s expense. 1) All subsequent reviews will be performed at times convenient to the City and at the Contractor's expense, based on the City's or City Representative’s then prevailing rates. 2) Provide Contractor reimbursement to the City within 30 Calendar Days for all such fees invoiced by the City. c. The need for more than 1 resubmission or any other delay in obtaining City's review of submittals, will not entitle the Contractor to an extension of Contract Time. 7. Partial Submittals a. City reserves the right to not review submittals deemed partial, at the City’s discretion. b. Submittals deemed by the City to be not complete will be returned to the Contractor, and will be considered "Not Approved" until resubmitted. c. The City may at its option provide a list or mark the submittal directing the Contractor to the areas that are incomplete. 8. If the Contractor considers any correction indicated on the shop drawings to constitute a change to the Contract Documents, then written notice must be provided thereof to the Developer at least 7 Calendar Days prior to release for manufacture. East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 01 33 00 - 7 DAP SUBMITTALS Page 7 of 8 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised August 30, 2013 9. When the shop drawings have been completed to the satisfaction of the City, the Contractor may carry out the construction in accordance therewith and no further changes therein except upon written instructions from the City. 10. Each submittal, appropriately coded, will be returned within 30 Calendar Days following receipt of submittal by the City. L. Mock ups 1. Mock Up units as specified in individual Sections, include, but are not necessarily limited to, complete units of the standard of acceptance for that type of Work to be used on the Project. Remove at the completion of the Work or when directed. M. Qualifications 1. If specifically required in other Sections of these Specifications, submit a P.E. Certification for each item required. N. Request for Information (RFI) 1. Contractor Request for additional information a. Clarification or interpretation of the contract documents b. When the Contractor believes there is a conflict between Contract Documents c. When the Contractor believes there is a conflict between the Drawings and Specifications 1) Identify the conflict and request clarification 2. Sufficient information shall be attached to permit a written response without further information. 1.5 SUBMITTALS [NOT USED] 1.6 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS [NOT USED] 1.7 CLOSEOUT SUBMITTALS [NOT USED] 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 1.9 QUALITY ASSURANCE [NOT USED] 1.10 DELIVERY, STORAGE, AND HANDLING [NOT USED] 1.11 FIELD [SITE] CONDITIONS [NOT USED] 1.12 WARRANTY [NOT USED] East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 01 33 00 - 8 DAP SUBMITTALS Page 8 of 8 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised August 30, 2013 PART 2 - PRODUCTS [NOT USED] PART 3 - EXECUTION [NOT USED] END OF SECTION Revision Log DATE NAME SUMMARY OF CHANGE 12/20/2012 D. Johnson 1.4.K.8. Working Days modified to Calendar Days East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 01 35 13 - 1 DAP SPECIAL PROJECT PROCEDURES Page 1 of 7 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – Developer Awarded Projects City Project No. 102824 Revised August 30, 2013 SECTION 01 35 13 1 SPECIAL PROJECT PROCEDURES 2 PART 1 - GENERAL 3 1.1 SUMMARY 4 A. Section Includes: 5 1. The procedures for special project circumstances that includes, but is not limited to: 6 a. Coordination with the Texas Department of Transportation 7 b. Work near High Voltage Lines 8 c. Confined Space Entry Program 9 d. Air Pollution Watch Days 10 e. Use of Explosives, Drop Weight, Etc. 11 f. Water Department Notification 12 g. Public Notification Prior to Beginning Construction 13 h. Coordination with United States Army Corps of Engineers 14 i. Coordination within Railroad permits areas 15 j. Dust Control 16 k. Employee Parking 17 l. 18 B. Deviations from this City of Fort Worth Standard Specification 19 1. None. 20 C. Related Specification Sections include, but are not necessarily limited to: 21 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 22 2. Division 1 – General Requirements 23 3. Section 33 12 25 – Connection to Existing Water Mains 24 25 1.2 REFERENCES 26 A. Reference Standards 27 1. Reference standards cited in this Specification refer to the current reference 28 standard published at the time of the latest revision date logged at the end of this 29 Specification, unless a date is specifically cited. 30 2. Health and Safety Code, Title 9. Safety, Subtitle A. Public Safety, Chapter 752. 31 High Voltage Overhead Lines. 32 3. North Central Texas Council of Governments (NCTCOG) – Clean Construction 33 Specification 34 1.3 ADMINISTRATIVE REQUIREMENTS 35 A. Coordination with the Texas Department of Transportation 36 1. When work in the right-of-way which is under the jurisdiction of the Texas 37 Department of Transportation (TxDOT): 38 01 35 13 - 2 DAP SPECIAL PROJECT PROCEDURES Page 2 of 7 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – Developer Awarded Projects City Project No. 102824 Revised August 30, 2013 a. Notify the Texas Department of Transportation prior to commencing any work 1 therein in accordance with the provisions of the permit 2 b. All work performed in the TxDOT right-of-way shall be performed in 3 compliance with and subject to approval from the Texas Department of 4 Transportation 5 B. Work near High Voltage Lines 6 1. Regulatory Requirements 7 a. All Work near High Voltage Lines (more than 600 volts measured between 8 conductors or between a conductor and the ground) shall be in accordance with 9 Health and Safety Code, Title 9, Subtitle A, Chapter 752. 10 2. Warning sign 11 a. Provide sign of sufficient size meeting all OSHA requirements. 12 3. Equipment operating within 10 feet of high voltage lines will require the following 13 safety features 14 a. Insulating cage-type of guard about the boom or arm 15 b. Insulator links on the lift hook connections for back hoes or dippers 16 c. Equipment must meet the safety requirements as set forth by OSHA and the 17 safety requirements of the owner of the high voltage lines 18 4. Work within 6 feet of high voltage electric lines 19 a. Notification shall be given to: 20 1) The power company (example: ONCOR) 21 a) Maintain an accurate log of all such calls to power company and record 22 action taken in each case. 23 b. Coordination with power company 24 1) After notification coordinate with the power company to: 25 a) Erect temporary mechanical barriers, de-energize the lines, or raise or 26 lower the lines 27 c. No personnel may work within 6 feet of a high voltage line before the above 28 requirements have been met. 29 C. Confined Space Entry Program 30 1. Provide and follow approved Confined Space Entry Program in accordance with 31 OSHA requirements. 32 2. Confined Spaces include: 33 a. Manholes 34 b. All other confined spaces in accordance with OSHA’s Permit Required for 35 Confined Spaces 36 D. Use of Explosives, Drop Weight, Etc. 37 1. When Contract Documents permit on the project the following will apply: 38 a. Public Notification 39 1) Submit notice to City and proof of adequate insurance coverage, 24 hours 40 prior to commencing. 41 2) Minimum 24 hour public notification in accordance with Section 01 31 13 42 E. Water Department Coordination 43 01 35 13 - 3 DAP SPECIAL PROJECT PROCEDURES Page 3 of 7 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – Developer Awarded Projects City Project No. 102824 Revised August 30, 2013 1. During the construction of this project, it will be necessary to deactivate, for a 1 period of time, existing lines. The Contractor shall be required to coordinate with 2 the Water Department to determine the best times for deactivating and activating 3 those lines. 4 2. Coordinate any event that will require connecting to or the operation of an existing 5 City water line system with the City’s representative. 6 a. Coordination shall be in accordance with Section 33 12 25. 7 b. If needed, obtain a hydrant water meter from the Water Department for use 8 during the life of named project. 9 c. In the event that a water valve on an existing live system be turned off and on 10 to accommodate the construction of the project is required, coordinate this 11 activity through the appropriate City representative. 12 1) Do not operate water line valves of existing water system. 13 a) Failure to comply will render the Contractor in violation of Texas Penal 14 Code Title 7, Chapter 28.03 (Criminal Mischief) and the Contractor 15 will be prosecuted to the full extent of the law. 16 b) In addition, the Contractor will assume all liabilities and 17 responsibilities as a result of these actions. 18 F. Public Notification Prior to Beginning Construction 19 1. Prior to beginning construction on any block in the project, on a block by block 20 basis, prepare and deliver a notice or flyer of the pending construction to the front 21 door of each residence or business that will be impacted by construction. The notice 22 shall be prepared as follows: 23 a. Post notice or flyer 7 days prior to beginning any construction activity on each 24 block in the project area. 25 1) Prepare flyer on the Contractor’s letterhead and include the following 26 information: 27 a) Name of Project 28 b) City Project No (CPN) 29 c) Scope of Project (i.e. type of construction activity) 30 d) Actual construction duration within the block 31 e) Name of the contractor’s foreman and phone number 32 f) Name of the City’s inspector and phone number 33 g) City’s after-hours phone number 34 2) A sample of the ‘pre-construction notification’ flyer is attached as Exhibit 35 A. 36 3) Submit schedule showing the construction start and finish time for each 37 block of the project to the inspector. 38 4) Deliver flyer to the City Inspector for review prior to distribution. 39 b. No construction will be allowed to begin on any block until the flyer is 40 delivered to all residents of the block. 41 G. Public Notification of Temporary Water Service Interruption during Construction 42 1. In the event it becomes necessary to temporarily shut down water service to 43 residents or businesses during construction, prepare and deliver a notice or flyer of 44 the pending interruption to the front door of each affected resident. 45 2. Prepared notice as follows: 46 01 35 13 - 4 DAP SPECIAL PROJECT PROCEDURES Page 4 of 7 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – Developer Awarded Projects City Project No. 102824 Revised August 30, 2013 a. The notification or flyer shall be posted 24 hours prior to the temporary 1 interruption. 2 b. Prepare flyer on the contractor’s letterhead and include the following 3 information: 4 1) Name of the project 5 2) City Project Number 6 3) Date of the interruption of service 7 4) Period the interruption will take place 8 5) Name of the contractor’s foreman and phone number 9 6) Name of the City’s inspector and phone number 10 c. A sample of the temporary water service interruption notification is attached as 11 Exhibit B. 12 d. Deliver a copy of the temporary interruption notification to the City inspector 13 for review prior to being distributed. 14 e. No interruption of water service can occur until the flyer has been delivered to 15 all affected residents and businesses. 16 f. Electronic versions of the sample flyers can be obtained from the Project 17 Construction Inspector. 18 H. Coordination with United States Army Corps of Engineers (USACE) 19 1. At locations in the Project where construction activities occur in areas where 20 USACE permits are required, meet all requirements set forth in each designated 21 permit. 22 I. Coordination within Railroad Permit Areas 23 1. At locations in the project where construction activities occur in areas where 24 railroad permits are required, meet all requirements set forth in each designated 25 railroad permit. This includes, but is not limited to, provisions for: 26 a. Flagmen 27 b. Inspectors 28 c. Safety training 29 d. Additional insurance 30 e. Insurance certificates 31 f. Other employees required to protect the right-of-way and property of the 32 Railroad Company from damage arising out of and/or from the construction of 33 the project. Proper utility clearance procedures shall be used in accordance 34 with the permit guidelines. 35 2. Obtain any supplemental information needed to comply with the railroad’s 36 requirements. 37 J. Dust Control 38 1. Use acceptable measures to control dust at the Site. 39 a. If water is used to control dust, capture and properly dispose of waste water. 40 b. If wet saw cutting is performed, capture and properly dispose of slurry. 41 K. Employee Parking 42 1. Provide parking for employees at locations approved by the City. 43 01 35 13 - 5 DAP SPECIAL PROJECT PROCEDURES Page 5 of 7 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – Developer Awarded Projects City Project No. 102824 Revised August 30, 2013 1.4 SUBMITTALS [NOT USED] 1 1.5 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS [NOT USED] 2 1.6 CLOSEOUT SUBMITTALS [NOT USED] 3 1.7 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 4 1.8 QUALITY ASSURANCE [NOT USED] 5 1.9 DELIVERY, STORAGE, AND HANDLING [NOT USED] 6 1.10 FIELD [SITE] CONDITIONS [NOT USED] 7 1.11 WARRANTY [NOT USED] 8 PART 2 - PRODUCTS [NOT USED] 9 PART 3 - EXECUTION [NOT USED] 10 END OF SECTION 11 12 Revision Log DATE NAME SUMMARY OF CHANGE 8/31/2012 D. Johnson 1.3.B – Added requirement of compliance with Health and Safety Code, Title 9. Safety, Subtitle A. Public Safety, Chapter 752. High Voltage Overhead Lines. 13 01 35 13 - 6 DAP SPECIAL PROJECT PROCEDURES Page 6 of 7 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – Developer Awarded Projects City Project No. 102824 Revised August 30, 2013 EXHIBIT A 1 (To be printed on Contractor’s Letterhead) 2 3 4 5 Date: 6 7 CPN No.: 8 Project Name: 9 Mapsco Location: 10 Limits of Construction: 11 12 13 14 15 16 THIS IS TO INFORM YOU THAT UNDER A CONTRACT WITH THE CITY OF FORT 17 WORTH, OUR COMPANY WILL WORK ON UTILITY LINES ON OR AROUND YOUR 18 PROPERTY. 19 20 CONSTRUCTION WILL BEGIN APPROXIMATELY SEVEN DAYS FROM THE DATE 21 OF THIS NOTICE. 22 23 IF YOU HAVE QUESTIONS ABOUT ACCESS, SECURITY, SAFETY OR ANY OTHER 24 ISSUE, PLEASE CALL: 25 26 27 Mr. <CONTRACTOR’S SUPERINTENDENT> AT <TELEPHONE NO.> 28 29 OR 30 31 Mr. <CITY INSPECTOR> AT < TELEPHONE NO.> 32 33 AFTER 4:30 PM OR ON WEEKENDS, PLEASE CALL (817) 392 8306 34 35 PLEASE KEEP THIS FLYER HANDY WHEN YOU CALL 36 37 01 35 13 - 7 DAP SPECIAL PROJECT PROCEDURES Page 7 of 7 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – Developer Awarded Projects City Project No. 102824 Revised August 30, 2013 EXHIBIT B 1 2 3 4 01 45 23 DAP TESTING AND INSPECTION SERVICES Page 1 of 2 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised March 20, 2020 SECTION 01 45 23 TESTING AND INSPECTION SERVICES PART 1 - GENERAL 1.1 SUMMARY A. Section Includes: 1. Testing and inspection services procedures and coordination B. Deviations from this City of Fort Worth Standard Specification 1. None. C. Related Specification Sections include, but are not necessarily limited to: 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 2. Division 1 – General Requirements 1.2 PRICE AND PAYMENT PROCEDURES A. Measurement and Payment 1. Work associated with this Item is considered subsidiary to the various Items bid. No separate payment will be allowed for this Item. a. Contractor is responsible for performing, coordinating, and payment of all Quality Control testing. b. City is responsible for performing and payment for first set of Quality Assurance testing. 1) If the first Quality Assurance test performed by the City fails, the Contractor is responsible for payment of subsequent Quality Assurance testing until a passing test occurs. a) Final acceptance will not be issued by City until all required payments for testing by Contractor have been paid in full. 1.3 REFERENCES [NOT USED] 1.4 ADMINISTRATIVE REQUIREMENTS A. Testing 1. Complete testing in accordance with the Contract Documents. 2. Coordination a. When testing is required to be performed by the City, notify City, sufficiently in advance, when testing is needed. b. When testing is required to be completed by the Contractor, notify City, sufficiently in advance, that testing will be performed. 3. Distribution of Testing Reports a. Electronic Distribution 1) Confirm development of Project directory for electronic submittals to be uploaded to the City’s document management system, or another form of distribution approved by the City. East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 01 45 23 DAP TESTING AND INSPECTION SERVICES Page 2 of 2 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised March 20, 2020 2) Upload test reports to designated project directory and notify appropriate City representatives via email of submittal posting. 3) Hard Copies a) 1 copy for all submittals submitted to the Project Representative b. Hard Copy Distribution (if required in lieu of electronic distribution) 1) Tests performed by City a) Distribute 1 hard copy to the Contractor 2) Tests performed by the Contractor a) Distribute 3 hard copies to City’s Project Representative 4. Provide City’s Project Representative with trip tickets for each delivered load of Concrete or Lime material including the following information: a. Name of pit b. Date of delivery c. Material delivered B. Inspection 1. Inspection or lack of inspection does not relieve the Contractor from obligation to perform work in accordance with the Contract Documents. 1.5 SUBMITTALS [NOT USED] 1.6 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS [NOT USED] 1.7 CLOSEOUT SUBMITTALS [NOT USED] 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 1.9 QUALITY ASSURANCE [NOT USED] 1.10 DELIVERY, STORAGE, AND HANDLING [NOT USED] 1.11 FIELD [SITE] CONDITIONS [NOT USED] 1.12 WARRANTY [NOT USED] PART 2 - PRODUCTS [NOT USED] PART 3 - EXECUTION [NOT USED] END OF SECTION Revision Log DATE NAME SUMMARY OF CHANGE 03/20/2020 D.V. Magaña Removed reference to Buzzsaw and noted that electronic submittals be uploaded through the City’s document management system. City Project No. 102824 East Parker County Subcourthouse Water & Sewer Main Extensions 01 50 00 - 1 DAP TEMPORARY FACILITIES AND CONTROLS Page 1 of 4 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised JULY 1, 2011 SECTION 01 50 00 TEMPORARY FACILITIES AND CONTROLS PART 1 - GENERAL 1.1 SUMMARY A. Section Includes: 1. Provide temporary facilities and controls needed for the Work including, but not necessarily limited to: a. Temporary utilities b. Sanitary facilities c. Storage Sheds and Buildings d. Dust control e. Temporary fencing of the construction site B. Deviations from this City of Fort Worth Standard Specification 1. None. C. Related Specification Sections include, but are not necessarily limited to: 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 2. Division 1 – General Requirements 1.2 PRICE AND PAYMENT PROCEDURES A. Measurement and Payment 1. Work associated with this Item is considered subsidiary to the various Items bid. No separate payment will be allowed for this Item. 1.3 REFERENCES [NOT USED] 1.4 ADMINISTRATIVE REQUIREMENTS A. Temporary Utilities 1. Obtaining Temporary Service a. Make arrangements with utility service companies for temporary services. b. Abide by rules and regulations of utility service companies or authorities having jurisdiction. c. Be responsible for utility service costs until Work is approved for Final Acceptance. 1) Included are fuel, power, light, heat and other utility services necessary for execution, completion, testing and initial operation of Work. 2. Water a. Contractor to provide water required for and in connection with Work to be performed and for specified tests of piping, equipment, devices or other use as required for the completion of the Work. b. Provide and maintain adequate supply of potable water for domestic consumption by Contractor personnel and City’s Project Representatives. c. Coordination 1) Contact City 1 week before water for construction is desired East Parker County Subcourthouse Water & Sewer Main Extensions East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 01 50 00 - 2 DAP TEMPORARY FACILITIES AND CONTROLS Page 2 of 4 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised JULY 1, 2011 d. Contractor Payment for Construction Water 1) Obtain construction water meter from City for payment as billed by City’s established rates. 3. Electricity and Lighting a. Provide and pay for electric powered service as required for Work, including testing of Work. 1) Provide power for lighting, operation of equipment, or other use. b. Electric power service includes temporary power service or generator to maintain operations during scheduled shutdown. 4. Telephone a. Provide emergency telephone service at Site for use by Contractor personnel and others performing work or furnishing services at Site. 5. Temporary Heat and Ventilation a. Provide temporary heat as necessary for protection or completion of Work. b. Provide temporary heat and ventilation to assure safe working conditions. B. Sanitary Facilities 1. Provide and maintain sanitary facilities for persons on Site. a. Comply with regulations of State and local departments of health. 2. Enforce use of sanitary facilities by construction personnel at job site. a. Enclose and anchor sanitary facilities. b. No discharge will be allowed from these facilities. c. Collect and store sewage and waste so as not to cause nuisance or health problem. d. Haul sewage and waste off-site at no less than weekly intervals and properly dispose in accordance with applicable regulation. 3. Locate facilities near Work Site and keep clean and maintained throughout Project. 4. Remove facilities at completion of Project C. Storage Sheds and Buildings 1. Provide adequately ventilated, watertight, weatherproof storage facilities with floor above ground level for materials and equipment susceptible to weather damage. 2. Storage of materials not susceptible to weather damage may be on blocks off ground. 3. Store materials in a neat and orderly manner. a. Place materials and equipment to permit easy access for identification, inspection and inventory. 4. Equip building with lockable doors and lighting, and provide electrical service for equipment space heaters and heating or ventilation as necessary to provide storage environments acceptable to specified manufacturers. 5. Fill and grade site for temporary structures to provide drainage away from temporary and existing buildings. 6. Remove building from site prior to Final Acceptance. D. Temporary Fencing 1. Provide and maintain for the duration or construction when required in contract documents E. Dust Control East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 01 50 00 - 3 DAP TEMPORARY FACILITIES AND CONTROLS Page 3 of 4 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised JULY 1, 2011 1. Contractor is responsible for maintaining dust control through the duration of the project. a. Contractor remains on-call at all times b. Must respond in a timely manner F. Temporary Protection of Construction 1. Contractor or subcontractors are responsible for protecting Work from damage due to weather. 1.5 SUBMITTALS [NOT USED] 1.6 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS [NOT USED] 1.7 CLOSEOUT SUBMITTALS [NOT USED] 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 1.9 QUALITY ASSURANCE [NOT USED] 1.10 DELIVERY, STORAGE, AND HANDLING [NOT USED] 1.11 FIELD [SITE] CONDITIONS [NOT USED] 1.12 WARRANTY [NOT USED] PART 2 - PRODUCTS [NOT USED] PART 3 - EXECUTION [NOT USED] 3.1 INSTALLERS [NOT USED] 3.2 EXAMINATION [NOT USED] 3.3 PREPARATION [NOT USED] 3.4 INSTALLATION A. Temporary Facilities 1. Maintain all temporary facilities for duration of construction activities as needed. 3.5 [REPAIR] / [RESTORATION] 3.6 RE-INSTALLATION 3.7 FIELD [OR] SITE QUALITY CONTROL [NOT USED] 3.8 SYSTEM STARTUP [NOT USED] 3.9 ADJUSTING [NOT USED] 3.10 CLEANING [NOT USED] 3.11 CLOSEOUT ACTIVITIES A. Temporary Facilities East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 01 50 00 - 4 DAP TEMPORARY FACILITIES AND CONTROLS Page 4 of 4 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised JULY 1, 2011 1. Remove all temporary facilities and restore area after completion of the Work, to a condition equal to or better than prior to start of Work. 3.12 PROTECTION [NOT USED] 3.13 MAINTENANCE [NOT USED] 3.14 ATTACHMENTS [NOT USED] END OF SECTION Revision Log DATE NAME SUMMARY OF CHANGE East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 01 57 13 - 1 DAP STORM WATER POLLUTION PREVENTION Page 1 of 3 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised July 1, 2011 SECTION 01 57 13 STORM WATER POLLUTION PREVENTION PART 1 - GENERAL 1.1 SUMMARY A. Section Includes: 1. Procedures for Storm Water Pollution Prevention Plans B. Deviations from this City of Fort Worth Standard Specification 1. None. C. Related Specification Sections include, but are not necessarily limited to: 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 2. Division 1 – General Requirements 3. Section 31 25 00 – Erosion and Sediment Control 1.2 PRICE AND PAYMENT PROCEDURES A. Measurement and Payment 1. Construction Activities resulting in less than 1 acre of disturbance a. Work associated with this Item is considered subsidiary to the various Items bid. No separate payment will be allowed for this Item. 2. Construction Activities resulting in greater than 1 acre of disturbance a. Measurement and Payment shall be in accordance with Section 31 25 00. 1.3 REFERENCES A. Abbreviations and Acronyms 1. Notice of Intent: NOI 2. Notice of Termination: NOT 3. Storm Water Pollution Prevention Plan: SWPPP 4. Texas Commission on Environmental Quality: TCEQ 5. Notice of Change: NOC A. Reference Standards 1. Reference standards cited in this Specification refer to the current reference standard published at the time of the latest revision date logged at the end of this Specification, unless a date is specifically cited. 2. Integrated Storm Management (iSWM) Technical Manual for Construction Controls 1.4 ADMINISTRATIVE REQUIREMENTS A. General 1. Contractor is responsible for resolution and payment of any fines issued associated with compliance to Stormwater Pollution Prevention Plan. East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 01 57 13 - 2 DAP STORM WATER POLLUTION PREVENTION Page 2 of 3 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised July 1, 2011 B. Construction Activities resulting in: 1. Less than 1 acre of disturbance a. Provide erosion and sediment control in accordance with Section 31 25 00 and Drawings. 2. 1 to less than 5 acres of disturbance a. Texas Pollutant Discharge Elimination System (TPDES) General Construction Permit is required b. Complete SWPPP in accordance with TCEQ requirements 1) TCEQ Small Construction Site Notice Required under general permit TXR150000 a) Sign and post at job site b) Prior to Preconstruction Meeting, send 1 copy to City Department of Transportation and Public Works, Environmental Division, (817) 392- 6088. 2) Provide erosion and sediment control in accordance with: a) Section 31 25 00 b) The Drawings c) TXR150000 General Permit d) SWPPP e) TCEQ requirements 3. 5 acres or more of Disturbance a. Texas Pollutant Discharge Elimination System (TPDES) General Construction Permit is required b. Complete SWPPP in accordance with TCEQ requirements 1) Prepare a TCEQ NOI form and submit to TCEQ along with required fee a) Sign and post at job site b) Send copy to City Department of Transportation and Public Works, Environmental Division, (817) 392-6088. 2) TCEQ Notice of Change required if making changes or updates to NOI 3) Provide erosion and sediment control in accordance with: a) Section 31 25 00 b) The Drawings c) TXR150000 General Permit d) SWPPP e) TCEQ requirements 4) Once the project has been completed and all the closeout requirements of TCEQ have been met a TCEQ Notice of Termination can be submitted. a) Send copy to City Department of Transportation and Public Works, Environmental Division, (817) 392-6088. 1.5 SUBMITTALS A. SWPPP 1. Submit in accordance with Section 01 33 00, except as stated herein. a. Prior to the Preconstruction Meeting, submit a draft copy of SWPPP to the City as follows: 1) 1 copy to the City Project Manager a) City Project Manager will forward to the City Department of Transportation and Public Works, Environmental Division for review City Project No. 102824 East Parker County Subcourthouse Water & Sewer Main Extensions 01 57 13 - 3 DAP STORM WATER POLLUTION PREVENTION Page 3 of 3 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised July 1, 2011 B. Modified SWPPP 1. If the SWPPP is revised during construction, resubmit modified SWPPP to the City in accordance with Section 01 33 00. 1.6 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS [NOT USED] 1.7 CLOSEOUT SUBMITTALS [NOT USED] 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 1.9 QUALITY ASSURANCE [NOT USED] 1.10 DELIVERY, STORAGE, AND HANDLING [NOT USED] 1.11 FIELD [SITE] CONDITIONS [NOT USED] 1.12 WARRANTY [NOT USED] PART 2 - PRODUCTS [NOT USED] PART 3 - EXECUTION [NOT USED] END OF SECTION Revision Log DATE NAME SUMMARY OF CHANGE City Project No. 102824 East Parker County Subcourthouse Water & Sewer Main Extensions 01 60 00 DAP PRODUCT REQUIREMENTS Page 1 of 2 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised March 20, 2020 SECTION 01 60 00 PRODUCT REQUIREMENTS PART 1 - GENERAL 1.1 SUMMARY A. Section Includes: 1. References for Product Requirements and City Standard Products List B. Deviations from this City of Fort Worth Standard Specification 1. None. C. Related Specification Sections include, but are not necessarily limited to: 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 2. Division 1 – General Requirements 1.2 PRICE AND PAYMENT PROCEDURES [NOT USED] 1.3 REFERENCES [NOT USED] 1.4 ADMINISTRATIVE REQUIREMENTS A list of City approved products for use is available through the City’s website at: https://apps.fortworthtexas.gov/ProjectResources/ and following the directory path: 02 - Construction Documents\Standard Products List A. Only products specifically included on City’s Standard Product List in these Contract Documents shall be allowed for use on the Project. 1. Any subsequently approved products will only be allowed for use upon specific approval by the City. B. Any specific product requirements in the Contract Documents supersede similar products included on the City’s Standard Product List. 1. The City reserves the right to not allow products to be used for certain projects even though the product is listed on the City’s Standard Product List. C. Although a specific product is included on City’s Standard Product List, not all products from that manufacturer are approved for use, including but not limited to, that manufacturer’s standard product. D. See Section 01 33 00 for submittal requirements of Product Data included on City’s Standard Product List. 1.5 SUBMITTALS [NOT USED] 1.6 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS [NOT USED] 1.7 CLOSEOUT SUBMITTALS [NOT USED] 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 1.9 QUALITY ASSURANCE [NOT USED] East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 01 60 00 DAP PRODUCT REQUIREMENTS Page 2 of 2 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised March 20, 2020 1.10 DELIVERY, STORAGE, AND HANDLING [NOT USED] 1.11 FIELD [SITE] CONDITIONS [NOT USED] 1.12 WARRANTY [NOT USED] PART 2 - PRODUCTS [NOT USED] PART 3 - EXECUTION [NOT USED] END OF SECTION Revision Log DATE NAME SUMMARY OF CHANGE 10/12/12 D. Johnson Modified Location of City’s Standard Product List 4/7/2014 M.Domenech Revised for DAP application 03/20/2020 D.V. Magaña Removed reference to Buzzsaw and noted that the City approved products list is accessible through the City’s website. East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 01 66 00 - 1 DAP PRODUCT STORAGE AND HANDLING REQUIREMENTS Page 1 of 4 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised April 7, 2014 SECTION 01 66 00 PRODUCT STORAGE AND HANDLING REQUIREMENTS PART 1 - GENERAL 1.1 SUMMARY A. Section Includes: 1. Scheduling of product delivery 2. Packaging of products for delivery 3. Protection of products against damage from: a. Handling b. Exposure to elements or harsh environments B. Deviations from this City of Fort Worth Standard Specification 1. None. C. Related Specification Sections include, but are not necessarily limited to: 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 2. Division 1 – General Requirements 1.2 PRICE AND PAYMENT PROCEDURES A. Measurement and Payment 1. Work associated with this Item is considered subsidiary to the various Items bid. No separate payment will be allowed for this Item. 1.3 REFERENCES [NOT USED] 1.4 ADMINISTRATIVE REQUIREMENTS [NOT USED] 1.5 SUBMITTALS [NOT USED] 1.6 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS [NOT USED] 1.7 CLOSEOUT SUBMITTALS [NOT USED] 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 1.9 QUALITY ASSURANCE [NOT USED] 1.10 DELIVERY AND HANDLING A. Delivery Requirements 1. Schedule delivery of products or equipment as required to allow timely installation and to avoid prolonged storage. 2. Provide appropriate personnel and equipment to receive deliveries. 3. Delivery trucks will not be permitted to wait extended periods of time on the Site for personnel or equipment to receive the delivery. City Project No. 102824 East Parker County Subcourthouse Water & Sewer Main Extensions 01 66 00 - 2 DAP PRODUCT STORAGE AND HANDLING REQUIREMENTS Page 2 of 4 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised April 7, 2014 4. Deliver products or equipment in manufacturer's original unbroken cartons or other containers designed and constructed to protect the contents from physical or environmental damage. 5. Clearly and fully mark and identify as to manufacturer, item and installation location. 6. Provide manufacturer's instructions for storage and handling. B. Handling Requirements 1. Handle products or equipment in accordance with these Contract Documents and manufacturer’s recommendations and instructions. C. Storage Requirements 1. Store materials in accordance with manufacturer’s recommendations and requirements of these Specifications. 2. Make necessary provisions for safe storage of materials and equipment. a. Place loose soil materials and materials to be incorporated into Work to prevent damage to any part of Work or existing facilities and to maintain free access at all times to all parts of Work and to utility service company installations in vicinity of Work. 3. Keep materials and equipment neatly and compactly stored in locations that will cause minimum inconvenience to other contractors, public travel, adjoining owners, tenants and occupants. a. Arrange storage to provide easy access for inspection. 4. Restrict storage to areas available on construction site for storage of material and equipment as shown on Drawings, or approved by City’s Project Representative. 5. Provide off-site storage and protection when on-site storage is not adequate. a. Provide addresses of and access to off-site storage locations for inspection by City’s Project Representative. 6. Do not use lawns, grass plots or other private property for storage purposes without written permission of owner or other person in possession or control of premises. 7. Store in manufacturers’ unopened containers. 8. Neatly, safely and compactly stack materials delivered and stored along line of Work to avoid inconvenience and damage to property owners and general public and maintain at least 3 feet from fire hydrant. 9. Keep public and private driveways and street crossings open. 10. Repair or replace damaged lawns, sidewalks, streets or other improvements to satisfaction of City’s Project Representative. a. Total length which materials may be distributed along route of construction at one time is 1,000 linear feet, unless otherwise approved in writing by City’s Project Representative. City Project No. 102824 East Parker County Subcourthouse Water & Sewer Main Extensions 01 66 00 - 3 DAP PRODUCT STORAGE AND HANDLING REQUIREMENTS Page 3 of 4 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised April 7, 2014 1.11 FIELD [SITE] CONDITIONS [NOT USED] 1.12 WARRANTY [NOT USED] PART 2 - PRODUCTS [NOT USED] PART 3 - EXECUTION 3.1 INSTALLERS [NOT USED] 3.2 EXAMINATION [NOT USED] 3.3 PREPARATION [NOT USED] 3.4 ERECTION [NOT USED] 3.5 REPAIR / RESTORATION [NOT USED] 3.6 RE-INSTALLATION [NOT USED] 3.7 FIELD [OR] SITE QUALITY CONTROL A. Tests and Inspections 1. Inspect all products or equipment delivered to the site prior to unloading. B. Non-Conforming Work 1. Reject all products or equipment that are damaged, used or in any other way unsatisfactory for use on the project. 3.8 SYSTEM STARTUP [NOT USED] 3.9 ADJUSTING [NOT USED] 3.10 CLEANING [NOT USED] 3.11 CLOSEOUT ACTIVITIES [NOT USED] 3.12 PROTECTION A. Protect all products or equipment in accordance with manufacturer's written directions. B. Store products or equipment in location to avoid physical damage to items while in storage. C. Protect equipment from exposure to elements and keep thoroughly dry if required by the manufacturer. 3.13 MAINTENANCE [NOT USED] 3.14 ATTACHMENTS [NOT USED] END OF SECTION East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 01 66 00 - 4 DAP PRODUCT STORAGE AND HANDLING REQUIREMENTS Page 4 of 4 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised April 7, 2014 Revision Log DATE NAME SUMMARY OF CHANGE 4/7/2014 M.Domenech Revised for DAP application East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 01 74 23 - 1 DAP CLEANING Page 1 of 4 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised April 7, 2014 SECTION 01 74 23 CLEANING PART 1 - GENERAL 1.1 SUMMARY A. Section Includes: 1. Intermediate and final cleaning for Work not including special cleaning of closed systems specified elsewhere B. Deviations from this City of Fort Worth Standard Specification 1. None. C. Related Specification Sections include, but are not necessarily limited to: 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 2. Division 1 – General Requirements 3. Section 32 92 13 – Hydro-Mulching, Seeding and Sodding 1.2 PRICE AND PAYMENT PROCEDURES A. Measurement and Payment 1. Work associated with this Item is considered subsidiary to the various Items bid. No separate payment will be allowed for this Item. 1.3 REFERENCES [NOT USED] 1.4 ADMINISTRATIVE REQUIREMENTS A. Scheduling 1. Schedule cleaning operations so that dust and other contaminants disturbed by cleaning process will not fall on newly painted surfaces. 2. Schedule final cleaning upon completion of Work and immediately prior to final inspection. 1.5 SUBMITTALS [NOT USED] 1.6 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS [NOT USED] 1.7 CLOSEOUT SUBMITTALS [NOT USED] 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 1.9 QUALITY ASSURANCE [NOT USED] 1.10 STORAGE, AND HANDLING A. Storage and Handling Requirements 1. Store cleaning products and cleaning wastes in containers specifically designed for those materials. East Parker County Subcourthouse Water & Sewer Main Extensions City Project No.102824 01 74 23 - 2 DAP CLEANING Page 2 of 4 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised April 7, 2014 1.11 FIELD [SITE] CONDITIONS [NOT USED] 1.12 WARRANTY [NOT USED] PART 2 - PRODUCTS 2.1 OWNER-FURNISHED [OR] OWNER-SUPPLIEDPRODUCTS [NOT USED] 2.2 MATERIALS A. Cleaning Agents 1. Compatible with surface being cleaned 2. New and uncontaminated 3. For manufactured surfaces a. Material recommended by manufacturer 2.3 ACCESSORIES [NOT USED] 2.4 SOURCE QUALITY CONTROL [NOT USED] PART 3 - EXECUTION 3.1 INSTALLERS [NOT USED] 3.2 EXAMINATION [NOT USED] 3.3 PREPARATION [NOT USED] 3.4 APPLICATION [NOT USED] 3.5 REPAIR / RESTORATION [NOT USED] 3.6 RE-INSTALLATION [NOT USED] 3.7 FIELD [OR] SITE QUALITY CONTROL [NOT USED] 3.8 SYSTEM STARTUP [NOT USED] 3.9 ADJUSTING [NOT USED] 3.10 CLEANING A. General 1. Prevent accumulation of wastes that create hazardous conditions. 2. Conduct cleaning and disposal operations to comply with laws and safety orders of governing authorities. 3. Do not dispose of volatile wastes such as mineral spirits, oil or paint thinner in storm or sanitary drains or sewers. 4. Dispose of degradable debris at an approved solid waste disposal site. 5. Dispose of nondegradable debris at an approved solid waste disposal site or in an alternate manner approved by City and regulatory agencies. East Parker County Subcourthouse Water & Sewer Main Extensions City Project No.102824 01 74 23 - 3 DAP CLEANING Page 3 of 4 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised April 7, 2014 6. Handle materials in a controlled manner with as few handlings as possible. 7. Thoroughly clean, sweep, wash and polish all Work and equipment associated with this project. 8. Remove all signs of temporary construction and activities incidental to construction of required permanent Work. 9. If project is not cleaned to the satisfaction of the City, the City reserves the right to have the cleaning completed at the expense of the Contractor. 10. Do not burn on-site. B. Intermediate Cleaning during Construction 1. Keep Work areas clean so as not to hinder health, safety or convenience of personnel in existing facility operations. 2. At maximum weekly intervals, dispose of waste materials, debris and rubbish. 3. Confine construction debris daily in strategically located container(s): a. Cover to prevent blowing by wind b. Store debris away from construction or operational activities c. Haul from site at a minimum of once per week 4. Vacuum clean interior areas when ready to receive finish painting. a. Continue vacuum cleaning on an as-needed basis, until Final Acceptance. 5. Prior to storm events, thoroughly clean site of all loose or unsecured items, which may become airborne or transported by flowing water during the storm. C. Exterior (Site or Right of Way) Final Cleaning 1. Remove trash and debris containers from site. a. Re-seed areas disturbed by location of trash and debris containers in accordance with Section 32 92 13. 2. Sweep roadway to remove all rocks, pieces of asphalt, concrete or any other object that may hinder or disrupt the flow of traffic along the roadway. 3. Clean any interior areas including, but not limited to, vaults, manholes, structures, junction boxes and inlets. 4. If no longer required for maintenance of erosion facilities, and upon approval by City, remove erosion control from site. 5. Clean signs, lights, signals, etc. 3.11 CLOSEOUT ACTIVITIES [NOT USED] 3.12 PROTECTION [NOT USED] 3.13 MAINTENANCE [NOT USED] 3.14 ATTACHMENTS [NOT USED] East Parker County Subcourthouse Water & Sewer Main Extensions City Project No.102824 01 74 23 - 4 DAP CLEANING Page 4 of 4 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised April 7, 2014 END OF SECTION Revision Log DATE NAME SUMMARY OF CHANGE 4/7/2014 M.Domenech Revised for DAP application East Parker County Subcourthouse Water & Sewer Main Extensions City Project No.102824 01 77 19 - 1 DAP CLOSEOUT REQUIREMENTS Page 1 of 3 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised April 7, 2014 SECTION 01 77 19 CLOSEOUT REQUIREMENTS PART 1 - GENERAL 1.1 SUMMARY A. Section Includes: 1. The procedure for closing out a contract B. Deviations from this City of Fort Worth Standard Specification 1. None. C. Related Specification Sections include, but are not necessarily limited to: 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 2. Division 1 – General Requirements 1.2 PRICE AND PAYMENT PROCEDURES A. Measurement and Payment 1. Work associated with this Item is considered subsidiary to the various Items bid. No separate payment will be allowed for this Item. 1.3 REFERENCES [NOT USED] 1.4 ADMINISTRATIVE REQUIREMENTS A. Guarantees, Bonds and Affidavits 1. No application for final payment will be accepted until all guarantees, bonds, certificates, licenses and affidavits required for Work or equipment as specified are satisfactorily filed with the City. B. Release of Liens or Claims 1. No application for final payment will be accepted until satisfactory evidence of release of liens has been submitted to the City. 1.5 SUBMITTALS A. Submit all required documentation to City’s Project Representative. East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 01 77 19 - 2 DAP CLOSEOUT REQUIREMENTS Page 2 of 3 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised April 7, 2014 1.6 INFORMATIONAL SUBMITTALS [NOT USED] 1.7 CLOSEOUT SUBMITTALS [NOT USED] PART 2 - PRODUCTS [NOT USED] PART 3 - EXECUTION 3.1 INSTALLERS [NOT USED] 3.2 EXAMINATION [NOT USED] 3.3 PREPARATION [NOT USED] 3.4 CLOSEOUT PROCEDURE A. Prior to requesting Final Inspection, submit: 1. Project Record Documents in accordance with Section 01 78 39 2. Operation and Maintenance Data, if required, in accordance with Section 01 78 23 B. Prior to requesting Final Inspection, perform final cleaning in accordance with Section 01 74 23. C. Final Inspection 1. After final cleaning, provide notice to the City Project Representative that the Work is completed. a. The City will make an initial Final Inspection with the Contractor present. b. Upon completion of this inspection, the City will notify the Contractor, in writing within 10 business days, of any particulars in which this inspection reveals that the Work is defective or incomplete. 2. Upon receiving written notice from the City, immediately undertake the Work required to remedy deficiencies and complete the Work to the satisfaction of the City. 3. Upon completion of Work associated with the items listed in the City's written notice, inform the City, that the required Work has been completed. Upon receipt of this notice, the City, in the presence of the Contractor, will make a subsequent Final Inspection of the project. 4. Provide all special accessories required to place each item of equipment in full operation. These special accessory items include, but are not limited to: a. Specified spare parts b. Adequate oil and grease as required for the first lubrication of the equipment c. Initial fill up of all chemical tanks and fuel tanks d. Light bulbs e. Fuses f. Vault keys g. Handwheels h. Other expendable items as required for initial start-up and operation of all equipment D. Notice of Project Completion East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 01 77 19 - 3 DAP CLOSEOUT REQUIREMENTS Page 3 of 3 CITY OF FORT WORTH [Insert Project Name] STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS [Insert Project Number] Revised April 7, 2014 1. Once the City Project Representative finds the Work subsequent to Final Inspection to be satisfactory, the City will issue a Notice of Project Completion (Green Sheet). E. Supporting Documentation 1. Coordinate with the City Project Representative to complete the following additional forms: a. Final Payment Request b. Statement of Contract Time c. Affidavit of Payment and Release of Liens d. Consent of Surety to Final Payment e. Pipe Report (if required) f. Contractor’s Evaluation of City g. Performance Evaluation of Contractor F. Letter of Final Acceptance 1. Upon review and acceptance of Notice of Project Completion and Supporting Documentation, in accordance with General Conditions, City will issue Letter of Final Acceptance and release the Final Payment Request for payment. 3.5 REPAIR / RESTORATION [NOT USED] 3.6 RE-INSTALLATION [NOT USED] 3.7 FIELD [OR] SITE QUALITY CONTROL [NOT USED] 3.8 SYSTEM STARTUP [NOT USED] 3.9 ADJUSTING [NOT USED] 3.10 CLEANING [NOT USED] 3.11 CLOSEOUT ACTIVITIES [NOT USED] 3.12 PROTECTION [NOT USED] 3.13 MAINTENANCE [NOT USED] 3.14 ATTACHMENTS [NOT USED] END OF SECTION Revision Log DATE NAME SUMMARY OF CHANGE 4/7/2014 M.Domenech Revised for DAP application East Parker County Subcourthouse Water & Sewer Main Extensions City Project No. 102824 CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS City Project No. 102824 Revised July 1, 2011 APPENDIX GC-4.01 Availability of Lands GC-4.02 Subsurface and Physical Conditions GC-4.04 Underground Facilities GC-4.06 Hazardous Environmental Condition at Site GC-6.06.D Minority and Women Owned Business Enterprise Compliance GC-6.07 Wage Rates GC-6.09 Permits and Utilities GC-6.24 Nondiscrimination GR-01 60 00 Product Requirements CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS City Project No. 102824 Revised July 1, 2011 GC-4.01 Availability of Lands ���� � ���� ����:������.������ ��:�:��� ��:��.�:��� �:����� �.��:�.��� �������� � � �������� ������ ��. . . .. . . . ... .......... ... .. ... ... .... . .. .. . . .. . . �:���� � ����:� . ���� ��:���� .������. �� � ��:��:� ��� � ����:� ������ �� �:���. �������� ����� �������.�.::.. �����: � ��� �� ���� � :�: �� � E�� E I�I E�1T T��� I�� ��: � � .... ... ... .. ..... ... ... .. . . ...... :�.�:��` � �� � � � � �� � � .�� � ��� .� �.�� �� � �� . ...... ... ..... ... ...... .. . ....... .... ..... . ..���..�� �����..�`�.���.. ............. ............. .............. .............. . .. . . ................. ... ... ... ........ ...... .. . . ��:� � ���� :��:�: � �`�.�: � � �� � ���� �: �: �� � �� �:� :�� �'��� � � � �.��: � ��:� � . � � �:�� . �'�����.��� �����'�� '��'��'�'�'� '�! �������� �'����:��k . . . . . . . . . . . . .. . . . . . . . . . . . � . .... .. ... .. . . . . .. .. ... � .... . . . . . .. q. � . . . �.��.��. . . .* ..�...�. ��� � � �� � A �� ��� .������.�� ��.�� �� ����� ��� ��:�:�:�.�:�a.�� �.���..����� ,. ��� ������� ��������� . . .. . .. .. . ..... .. ... .. ... ... . ..... .. ... ..... ..... � � �� ��:�� � � . ��.� �� �� �� � � � �� � �� ������. ��� � �� � ��� �� �'����.� �'�� �� ���� .. . . . . . . . ����� � �.� �.��� �.: �� � ��� �.� �:�� �����::��.���. �.��: ��:�:� � ����� � � �: �:�:�:�:�:� �:� �� ��:���� �`����:�.� .��� � .¢. . . . . . . .. . . .. .. . . . ... . . .. ..... . . .. . . . .. .. . .. .. .... . .� . . ... . ..... .. :.:.. .:.:.:.......:...: . . . . . . , � ���#� � � �� : ��`��`���.���`�; �� � ���: .�:� �`�� � � :� �`:�:���:, . ����� �.� �� �: � :� � �� . . . �r T j� iY * 4• r� *• � ����•�•� � � �����•��M ■� ••���������� ���F�F��� ����iR•���•� ����•���� ��• �.� �������� i ��� ���� ��.��. . . . . .����.���� . .�.��. �•■.■�.�.�.����.� ��.�.�.��.��.�.��. �.■.■.� . ... . � �� ���.�� � �� ����.�.� ���.■ . ■��.� �•� � � � � �.■ ■� �•! ■ � . . . . . . . ... . . . . . . . . . . . . ... . .. .. . . . . . . �.��� � �����������; � �� �� �. .���.;. . �� � r��.. :E:�.E �� � �� ����� � ��� ���} ���� .�� � ����..�:� ..�. ������.. .�:�� ��������� ������; . . ' .: . . . . . .T . . . . . . . . * . ��.����.� �����.�.�.��.� •.�. '.����• r.'..•���•��� �.�.�����.� ����•� .��.� ���.�� � ���.� ��� �����.� � ����.�.� �. ��.� . . . . ����'���•� ��'�'�'��•� '��� �•���' ����� ����•����� �'� ����'���� ���� �'�'� •��•��� �'������'� ������ ��� � i i • �• � �� � � �•����•� � � �� �•� �•i � � � � �.�# ��. �•�•�� � � •�•��� �•� � . �•� � � �• . . •� � � Y� � � � � � � � �� � � � � � � �•� •�� � � � � � ��•� � � � � ������ T r �� � � �� I � �■ ���I�.� ��� � . . ... ... . . �E ����ti' �'F �/ �'� �� ��� ����� � ��: ���:�.��:���� � ������������ ����� ���� � ��� � ��.�.�.��� �� � � ��:�:�� � ���������:���:���:� ������ �� � � ���:: �:��� ���: ���: ��: �� ��. ���������� .� ��. � �� ��� k M . . ���� �t����` .����� ���1 ��������l� ������������������.; 4 . . . . Y�� � � ��•����.�� � � � .� ��,��.�� � �.� �.��.�.�.��.�� y. . . . � �'�•�' ��'� �•� � • ��•�'�������•�� �' � ��'���•� � � � � �'r ��� �'���� � ��'� �����'� ��� � ������ 1' �'�'� ����� ��� ������ ��� � � ���� ��������� � ��:��: �� ��I ���� � �f � . .. . .�.:... . . . � .. . . .... . .. � �.� �� ��� �.� ��� � ���:� ��������� �� �� � � �� � � ., ��� ���: .� ����� ������������� . � �� � �. �� . � � � �:� �� �: . ��� ���� � ����.. � � ���: � . .. . .. . . � �.. � . . . .z . . . . . . S � � �� ��� � � � � � ��� ����� ��� �� � .����� � �� �:�� � ����. �� � : ��� � � . ���. . ��:�� �� � � � �. � �.� : . ..�� � �� � � � � . .. . . .. . ' . � .� � � � ������ � � � � � ���� ��� � ��. �� �. � �� � ��� ������:�:� ��� � � �:����:�� � � � ��� ����. � ��� �� � � . .� �. � � � � ��� .. � ���� �� � : ����� .. . . . �� . ��. � . . . . �. . * . � . �� ��� � � � � � � � �:�� �. � �� �� :����.� � �� ���� �� ����. �� � �� �� � ���� ��: ��� � . �� ��.�:�. ��� �� � �. � . ���� ������� . �� . . . .� � .� � � ���.��.��� �� � �� � � . . . . . .. � . . � . . . .. . . ............ . ..�..�. � . � . �� �.�:� �: ��:� ��: . ���� �� � � � ���� :��..�.. . :�: �.� �� r� � � � �� ��:����� � �� �.� ����.� � �� r� � �� i � � � � � � � �� � �. � �: ���.���� � ... � . � � � . . .� � . . . . . .. . . . .. . . . . . � �.������.��� .�:� : �� �: � ��� .� � � � � � � � � . .������� � ����� � �:�� �� � � � � ������ � �� ���� � � �� � �� .� � � �. : � ��. ������� ��� �. � � � � .. . . ..� .. . . . �.���:� � ��� � � ��� �� � � � � ��� � � � � �� � �:�. � . � :� ���������� �����:�� � �.� . . �� �:�� � � : �.� . : : . �.� � � �� � �:. � �:�. � � � � .�. �� ����� �� � ��� . . . � � �� �� � �� � .���� ���� �� � �� �� �� ��� �� .� � ���� �: ���� ���� � ��� ����� ��� � : �.� � �:� � �. ��� .� ���.� � � � .� ����� � �� .. . . . . . ... . � � .��.. � : . ... . . .. . . . : . � ��� � �� � � . �. � �������� �� �� � ��� �� -� �� ���:�� � �������. ��. �����.��� � � . ��� � .��.�.�� �: � � �� ��� � � ��� . � . ����� . : � � . : . .. � �` '* . . : .: . ��. . ..�� . .. . . � �'°� ' ' � .�� �� �� � � ����. ��� �� � ��a�� � ��� �� ��.. . .��� ���.�� ��� � �� �� ���.� �������� ���Q ' ���������.� ?�.� � �� .�. . . . . . . *� . � � _ . . ���. ��� � � � �..� �� �� �� � � � ������ � ��� �� ��� ���� � � .� �� �.� ����:��� �.� � � � ��� . � � �� � ���.�.� . � � � �� ��� �. �� � r�. � . ���� .. ... ... ...... . � � . . . .. .. � . . � � � ��.�� � ��:�.�� �� � ��� ���:���.� �: � �:�� ��� � : ��� � �� ��:� �� � � � � �� ������ �� ��� ��.: :� ��� ���� � � .. �� � � ���� �� �� � ���. . �� � . � � � .. . . .. ... . . . �� ������ � �� � ���� �� �� ��� � � ��� ��: � � � ��� � � � � � ��:���� ��.�� � � ��� �� ��: � � �������� � � � � �� � �� . ���:� �.�� �� � �. . ���� � . � .� � . . . . � �� . . . . . :. .. . . . . . .� ���� �����.� �� ��� �� � ��� �� � ��� ��� ��� �:� � . ��:��� � ���� ��.��� � �.� ����� � � �� �: � � ���. �. � � �:� � ��� . �� � ��� �� . � � �� � �.�� �� . . . . . � � � . � � � ��� ���� �� ��� �� � � �: �.��� �.�� �� ��� �.�: �� � �� � �� .� � ��.� ���� �� ��:� ����.� .. � . . . . . . . .. . . . .. .. . .... . . . . � �� : . . � .� :���� ��: � � �: �� : � ���:� ����� � � �:��� ����:� ��:�� � : ���� � � ��:�. � �� ������: � ����� . . ��� ���. ��� � ��� � � �� . . � . . � • �... . : ... . � � �� � �� � �� � ����. ��� � �� . �� � � � ��� � � � � .� �� � �:��� ��: � � � ����� � � �: � ����� . : � . .�:�������.�. .� � � �� :�� � .�� � � �. . . . .� � . :. . . . : . .� . . . � �� .. .. . . . . � _ � �� � ���� �� � � �.�� � �� ����� ���� � ��:�� �: ��������� �� �.� � � ���� � ��� ��. ��. � � ��.�� � � � �� �� ���� �: � �.� �.�� � � �� � � �� .� . . . . � .. . . : .. .. � . . . ..... . .. . ... . . . ... ������� � �: ����.� �� ������� ����� ��� ��� �. � ���.� �:� � . ��� ��� � � � � �:��� � ��� ��:��� � � �. �� ���� �. � �� � � �.����.�.�. �� .. .� . � . . . .. � �� � � � � ��� � � � ����� �. � � � � � � :�����:��� . � �� . . . : .� � ���� � � � �.���:� � � � � �.����� ���� �� �� ����� ��� � � �� ��� �� ���.� � � .� .� �.�.� � �� . . . . . . . � . �. � � � . ... � . .. � � ��� � .� � � � . . . :� �: ��:� ������. �� . . . .. .. . .. . . ������ �� ��� �� ����� �� .. . . � � ����. .� ��� ��� � � � � � �:��� .���� � ���:� � � ��. � � � ����� � �:�.� �� � �� } � � � . � � . ��: ���� ������� � �. ���: � �� �.� � � �������� � � � ���� . ������� . . . . . . . . . � � ��������l� ���� �` ��� � �� ������� �:��. ���, �:���� � . . ���'�s ���.���`:��� {. . ��� � � ���� ��������� � ��:��: �� ��I ���� � �f � � � � � . �:��� �. ������ � � ��� � �� �� � � ���� � �� . . . . . � � :��: �����:� . �� � � �� ���� �� �� . . � . � . . .� �� � � � �� � �R. � � � .� � �� .���� �� ��. � . . �. �� ����� �.��� �.��: ����� ����� a .�� � ���� � �.� � :������:� � ��� � � . . . � ��.# . . .� � . . ��� ������ ����.� . . . ... . ..... .... ... ... � . � . : ... � �� �� r�t� �I � r� � �� r� � r� t � i �� ��� � �`����: .. . . . .. . . �����. ����: � � ���� �� .� � ��� �� � .� � �..��:� � � �� �������# �����f�� {� � �. - a . � � �.�������� . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . � �� � . .. . ... . . . . �: . . . . � . � : . . . � � � � �� � � ���� � � ���� ��� �� � �������I��� I''�� � I � �1��� �I"��� ��� I f�� ��� ��� �����-��-���� �� ��� �� : : � � � .��� ���.� � � ������ ����.�� �� �� � � � �.��. :� �. . ...... � � ����������.������� . . .�: ..... .... .. ........ . . . . . � . � .. �� � � . : . � . � :. � �.. . � . � � �� � ��������� � �� ���� � ���� � �� �� . ���� � ��� �.�� ����� � : ����� � � ��.� � . �� . �� �������� . ��� �� � � .� . � � . . . .. � �� .. �.*� ��. ���:� ��. �� �����. ���: .�� ��: �� . � ��: �� �� ���� ������� . . �� . . ..... ... � ��� � ��� � � �� .. . . ���������� � ������ � � �. . � . �� .. . � . . .. .�. �... . . .... ..... .. .......... . . � �� �� �:��: � ����� ��� ��� ������ ..�� . . � : �� � ���� .� ������ � ���� ����: . � . � :. � � �� �� ��� � ���� �� :���: ��� ������� . . . .� � . .. � . . . ... .. . . . � � � ���������� �� � . � �����. ��� � �� � �. ��� ���� � .������� �. r � � � �:��� ����� ��� �� � � ���� ��� �� �: ���� � . � # ���������� ��� :��� ����� ��� ���� ��:�� ����: �. � ����`�� ��� �� �������: �,�.. ��� ���� :�� ��.�.��� . � � �.� . . . .. . ... ... . .. . . . .i . • �.:� ���� ��:���. �� ���� �� ��� �� ���`� .�.�.�.�� �. ��� . . ._.. . . � .. ���. �� ... �� . . . ..� � .�� . Fh { .h•'�+� . . � . �y . �. . . �x. �F � xx # � � �` :,,� � �� �...:�� . �� . i ' � �. x. .� • {�. � . � ... • ... . . .....:•.: :::�:�:�:.:::x•:•:•.::•.:.:.x . ... ......%'.'.' . . ..... ..... . ' ... . ... . ..� ...:.k :....... . ::. .:.:.:.':'.'.kk.:. .:... . . . . ' :.:.... %:.:.'::::.:.'.:.. . . . . ... .......:.h .. ... ... . . ... ... {•: :.:...... . ...::%k:.....%'.:.:.:.'.'. . . ... ... . . ....'.%.�.�.�. :.:... . ... . . . . .. ... . . . . . ..... . . ...�. ......f.... ......... ..... ..�...:.:�:�. .. ... . .. . ........ . ... ...........x. .......... . . . ........� � .. . .... :. ..... .....:.:.:....:.:.:...:.::...... . ...... ......... ..... . . : "' h %:.::::7C:.::7C':::�Ck':' ':'.' . . ...... . . . . ' . . . . . .. . . k k..' x:k :: . . . . . . ............. . . . . . . . . . . ... . . ......... . .+C ................. . . { . . . . :. ' ' .. . . {." { . . .... . . . ... : .. .. .. ... . . . k r , , • . { . . :��' .: .:. .' :.. ..... .. '. : :. V'. ::.:. .:. : ... . .. .'.k .: /. :.. ..'{ : y • ' .:. . ... . {• .�C" �. :: {. : . .' � { { . .. . S .. . r. .r ... . . . A . ... .. .. . . . . . . . . . .. .:. :. . .�:.• . . . .' '. . � . . . .• '. .' . . . . . . . . . � .... . . �• . . i <:: � •.. ' .�. .•.' . <. x < .. . .�.�' . �.x'� ' ... � . . � ��. : . . . . ' . . { .. .. . , . . . .. . r..,� :. .:.• .: • • .: . _. ,. . � . . . . . . . . .. • . . . .. .r }...' . . < v... : < <.•. .. . . ... {:: { ':k .. . . } :. . ...• . .. : { • . . . { { : : . . . ':x ... . . . . . . . .... . •... .. . . .. . . . . . . . . . : ... .. . . . . . . : . . . . ., r .,., . .:.... ,,.. . ... . .. . .... ... '+C' . .... ... . . � . k : ... % .. ... \h . . .. . . •.. :' { .k • ' . . . ... ..... \ .' .. r .y.. • ..... ... . ... . . ' . +y : . % y . . . . . . . . . . .. ....: �C . ..... . . . .. ....... . . . ._ . . .... . . . .. .X:. :. .'.1 X : .'.X'... ' . . . .:' '. . 'k '' ' ... . ... ... .. {% . .:. . {:. .. . . . .... � . . y ; �• � . . . . . . ' . .% ... . ..Y .. . . � . • • , . ' . ' . :.. .' .h '.' . . . '. . .. . . . . . :: ': . . . . . { • . .'. '... . . . . . . ... ... .: '. . .'.: .. r .�: :. :. :.: {: � .' . . : . . •� { ' .. . : .:: ..k . . . . .. . . :' . . . .' .:. . . . { . . ' . . � . ti .. . . . h: : . . ' .' . . .. . . .... .:. : '. ' : . . : ' : .� .' '... Y . ... . . . . M1 . .. . ..... . . . .. . . . . . . . . . . . . .� .'.'. : . .. . . :.:. : .' . ' : . . . '. . . y . . . ... ......X . ..... . . . : .' .' : 'l ' ' ... . . ..' . .' '. .' '. . . .'. '. : +C ' �. . . . . . . . . .........'.'JC.�C... .....+C'. . .% .... . . .: . .. .. . . . . k . . . . . . . ... . . . ... . . ... ...:.:::.:. . . .:.. {:. : ' JC .: J... '.1 {. : . . . . . .. . ...:... .'. .:. .. ....':' .'. . . . .:.k:.7C:::.:.:.::::'.'.":.': . . . ' . . x . . . . . . ... : : : : :�C ::':'::':':':..... : . { • • : ; ' ' ... ....... . .AC.v+C':' { • . { . . .'.'. . . . . . . . . . ' .:. .'... ...:�C:: :�C.. . . .... .. . . . . . . . . . . . . ... . .......%:.'.:.:.::%:::.'.:.:.': . . . ::I :. . .... .......... . . . ... .... ... . . . . . . . . ... ... ....... . ... .. . . : h .:...:.:.+C'.:.'.�C':'.' .'.:.:.:.:.%:::.:::.:.'.'::.:.h+C'.'.:::.::. . . . . . .. ... ... . . . . ....... ... . . ....... . .�... . }':..:.:.'. .%:.:::.:.7C ..:.:::::.:.. .:.:.:. ..... :::%.. .'%.k'.%. . . . . ���� �R�� Y Y �� ��•�� �� � ����.` i � � ��• ���: ����� � � �. � f . . � . ;y .� . . . � . � . � . .f.. . � . . , � .. �.. .. .� � ..� . .. x . 'o-"� ... ,c . . h ��� �� � ..k� .� � ..x , � . . . .' . . .. . .. ■ � . . . . . . . . : � . . . . . . . . . . . . � �� ��F� .. .. ..... . � : �� ��� � � � �� � � �.��� �� ��� � . . ��� : � .��� . � . . . . �� A� :.x � ..� . . . � �+a.�ok� ����� ��� �F�;�;:: ������������ ���� ��������� � ��:��: �� ��I ���� � �f � �����:� ����� ����� :� �`� �'���� ���:�:� ��� � �: �� � � . . � � � . .. . . . ... . .. ..: ... � . . . . . � � ��� ��� � �:� . ����� �: �..� ���:� ��� �:� .� ����� �� �:� � .�.� � �.���� � � � � � �� � �: ��� � ��� � . �� � � . : . � � �� � �� �� ��� � ���� �� . � � . . .. . ����� ���k� . � �. �:����� � ���. . � ���� ����� �.�:� � ������ �� � . . . . � . � � ... . . . . . . ... . . . . .. . . �� � �i r��t�r . �� �:� �� ��:���. �� ��� �. ����� � �������� ��: .� � �� �. ��� � � � �� � �.��� ���:�.� .... . .. .. ... . �n� _ ................ . . .� . .. . ... � � : ����:��.�� �� ��� �� �:�� � � ��� �� ��� ��� ��:���� ��� �� � � ��� ��� �� ���� � � � �.� �. � ��� � ���� �� � ��� ��. � . � ��� � � � � . �� �. : � ���� � � � . �.. . � � .. ...�.. . .. .. ...... � . . . ...... . .. . . .. . �� � � ��� �. ���� �� ���� � � � ��� � ������� � �.�� � ����� ��� � ����� ��� �� �� � � ��� � �� .. . : ..�. � � . ���� ��� .���� �� ��� � . � . . .. . . � F. . . ..:.. . . . . � . . . � �: � ��� � ��� �:��: � � � �. � � �.� � � � ��. �.�.��:��� � ��� ������ ������ � �: � � �.��� ���� �.�� . �� � . �� .� .�� �.� �������:. � � . � . �:�� � � � � . . �� ��� �',4 f�l �r�h .. �., �� �� •4 . �. �� � . .�. � . :�� �� . ��:�. ��� ������� �������� ��. � � ����. � � �� � � �. ��.�� � � ��� � �� . � � . . . . . � �. ��: � � ������� ��L���� �� ��t���� ��� � t� ���T� �F T���� ����r� � .�. � ��1 ����� �I� ��r��. ��� . ���. ��, ���� �� ��� r , � � �� �. � ' � �� �� �� �Ax.....x.� . .� �: � � � .:f� � . x. . � ���� �i�it� I I� �i� n�� �� �i�� r�� . . �� ���� r II �- .�.��.�t�: ��� �I .�3.�� �I �:3�:�� ���'��' . ��� . .. .��������� ���� �.��� ���� ������ .������ �� ������� � ..� . . � ��� � ���� � � ��� ��� ������ � ��, ��������� ���F�� �� I�. ��.:x � �� � � � � �� ��I�I��T ���i� ��������� � ��:��: �� ��I ���� � �f � ��� �NIT�� �E�1� � ��T�RI��� ���E1�I�1�TT ���. l���i��� �T�l���� �� �'I' 11TT�1�I��1� �� � R ���71�T�, T��i� BEI�I� � �.���� ��r� tr��t �� lan� I���t�� ir� th� �,J. I�I��I�r-�� �ur���� ���tr��t IV u m��r ���� ��rl��r ���r�t�� T��a�� �aid �,���� ��r� tr��t �� i r�� � ��r�i �r� �f #h� r�r�� i r���� �f a �� I I�� ���. ��� � �r� #��c# �f I� r� � c� r������ t� F1�F�I1� H�L�I�I��� I �I�.� �� � ��� #h�r��f fil�� f�r� r���r� ir� ��r��� ��� r�� �I��I�'� Ir���rur���� IV � r���r ���4������ �f�i�i�l �ubli� ����r��� P�rl��r ���r�t�� T����� ��i� ������ ��r� �ra �t ��i n� rr��r� �� rti�u I� rl� � ���ri ��� �� th� r�r� �t�� � n� �� u n �� a� ��I I ���: ���I�IEIV�IN� �� � T���� ��p��r���� �# T��������ti�r� �lu�i��� �n�r�ur���� f�u�� �I����i��ft�� ��f����� t� �� � r����r��nt f� u n�� at th � n�r#��rl� �n� �f ����n� r�I i� I���#e� �� t�� i n#er���ti �r� �f t�� r� ��th ri�ht-�f���� I i r� e�f �I � I�e�th �r-F��� ��� � ���ir�� � ���i��l� v�i�t� ���li� �i�l�t-�f-���� �rit� ��� ���t �i��t-�f-��� li r�� �� F��r��� ���� ���ir�� � ���i��l� �i�t� �u�li� ri�l��-��-��� �I�� �r���rr� �� F���1 t� I�I��I��� Hi�h��� IV�. �����# ���r�n �hi�l� �r� �I� r�ir�� r� r��r�urr��r�� f�ur�� �� �I�� ����I��rl� �r�� �f ��i� ��rr��r �li� ���r� ���t� ����1'��" E���� �1.�� f��t� THEIV�E �V�rth �1��'��" 1���t� �I�r�� th� ��i� �a�t �i��#-�f-�a� lir��� ��.�� f��#� TH EIV�E �I � r�l� �����'��" E���� � ��� �ti r�� tl�� �� i� �i�l��-��-��� I i ��� ��� � � r�� ������ #I�� �� i� ���. ��� � ��� t���� � r�� � I��� � I i � � ��r��r��i�ul�r t� �h� ��i� ���t ri��t-��-��� lir��� 1��.1� ���# t� �h� �IIVT �F �E�I�IIVIIV�; TH�N�� ��r��ir��ir�� ���r �r�� ��r��� �I�� ��i� ���.��� ��r� �r�� �I�� f�l I��ir�� ���r��� �r�� � i�t�����: IV �rth � ���' ��" 1���t� ��. �� f���� IV �r-t� �����' ��" E���� ��� �� ����� ��uth ����'��" E��t� ��.�� ���t� ���tl� �����' ��" ���t� ���� �� f��� �� tl�� ���� � r���r� I i r�� �� � �� I I�� �.���� � �r� �r�� �� r������ �� �� rl�� r ��� r���� �� �h � ���� th�r��� �il�� ��r ����r� ir� In�trur��nt �lur�n ��r �����5���� ��i�i�l �u�lic F��c�r��* ��rl��� ���r�t�* T��a�� TH EIV�E ����I� �����'��" 1I�����# � I�r�� �I�� �� �� �r��� �r���r-� I i r��� ��.�� f���� THEIV�E IV�rt� �����'��" ���t� �����#i rr� t�� ��i� ���t �r����#� lir�� �r�� ��r�r �r�� ��r��� t�� ��i� ���.��� ��r� tr���� ������ f��t �� �h� ��I�IT �F �E�I�I�II�I�� TI�� I��r�ir� ����� ����ri ��� t���:t �� I�r�� ��r�t�ir�� � ��r��ut�� �r�� �f �*���� ��r�� ������5 ��u�r� f��� �f I�r��� r���� �� I���, TI�� ��� ri r��� r��i��� I����i r�� ���� � r� r�f���r���� t� th� T��c�� ��� r� i r��t� ���t� r� �f ����� T���� IV �r�h ��ntr� I��r�� ������� � r�� �r� ����� �r� �h� �l�r#� �rr��ri��n ��t�rr� �� ����� ���� ��j���r�er��. I Eri� �. ����r��r, � ���i���r�� ���f���i�n�l ��r�� �ur-�����r ir� �h� ����� �f T��€��, �� h�r��� ����� �I��� �I�� f�r���ir�� ����r���i�r� ���u��t�l� ��t� �ut t�� r�r�t�� �r�� ���r��� ����ri�ti�r� ��tl�� ����r��r�t tr��t ����ri��� I����ir�� Eri � �� ����r� ��� �� L� ����r�� r � ����i�t��� I r��. T���� ���i�t��ti�r� I��� ���� TB �L� Fi rrr� �1�. 1������� ������ . . * �� � .� ' r�r� �. . �■** � � . . � � �� .. � . . . . . . . . . .:o�'c � �� � .��•.*. � ��� � � � � ���� �� � �.� � � �. � �•� �� * � � . ...............�.�.�.�.*** ��� � �. ����u�� ++++++++���������������+++ � . � . ��� � . , ��ii��� �� �� � �, � � � � �t� � ���� � ������i�� ����� � F �F'� H�1�i�, �i�. � ���� � �� � �p�n�r � �i���1��, �n�., ��� ��� �1�� ��t� 1�, ��1��, T� ���� - P'H. �1�-���-�4�� - ����n�r��p�n�r�ur���.��m - ��i ����� ��� � � ���� ��������� � ��:��: �� ��I ���� � �f � ��r►. �+ ���i�ir���� �� ���f��� �. ���� v�. ��� �. ��� �.��� � � � � � � � �� �� � � ��� ��� � � . � � � �� � ��� �� ���������� ���� ��. �� ��. � I � �� �; � ��'�. � �� � � � � ���� �� ��������� L� � � � � � � � 1 � � I � �1 � 1 �.�� ��, �, � �•�,����� � � ����� � � � �.�. �. � ��� 1 � � �� ����: ���.�������� �f�������� ���� �r �a �� �� ��a � �� � ��� �� �r �a �r �a � ' L� ���� �� � ����� �� �� �� ������� ������� ���������� ���� ��� �.�� ��������������___�_ ������'��" E � ���. � �' I � � — � ������� ������ ���������������� �I ��#��'��"1� � ���. � 1' -� I � �j � �� � � ��� ���������� � � �� ������� I �� � � �x ��� ��� � ������� ��. ���� V�. �2� �. � �, �.�.�, �. �. � �������. �. F�1��. � �x��A� ��f� � ��. ���, I � ������� ��+ ���. ��� ��� � �� ��� LI�IE T�#�LE hl�. DIF�E�TI�N DI�T. L1 IV�1 ���'��'"�I� �1.�' L� �I�����'��"E 1 ��.�I'1' L:� IV�1 ���'�'"� ��.�' L� �I�����'�"E ��.�' L� �4�°��'��" E � 1. ��' ����� �� � ����� � �, �.� #�.�. �-� � I I �� �X. ���' ���#� ��������� � ���� ���l�� ��� ������� �� � �� �� �� � � � �� � ���� THE �EAl�IfV�� �H�1I�N HEF�E�N �E F�EFEF�Ef��E� T� THE TE� �� �I�DI N�TE S1��TE �I �F �1 ��� TE� �I�F�TH �EI1ITF�AL ���I E ����, �I� �E B� E� � �I THE N �F�TH �IEF�! �I ��TU �JI �F 'I ��, �1 � �4D�JUST�IENT. �R�4REi�T'1�: �YFti+1� i�+OLDM�S, �, - �i��� �.P.�.P.�7 �I�REF�� A�RF�4��, f�. �F �4 �ALLED �.� A�E� ��EED� -.,. -- :�:�:�:�::�:::�.�.:.�.�.�:�.�.�.�.�.�.�.�.�.�:�:����::::: ��� H�fi� �TRE��' �!�l�E '?��� ��1ZE��� T�� ��� ��� �� ��� ���� ��.����i��J��J���Y���.�J� T��L� Fr1�1�! ��. � �,i�-�r���:' �, k � L� , , , - ' •, — ' � .�� �_7 � � � ~ r �; � F-' . �� � �� r � ��� ��� ; �7 - � !, :,� ,. : � - , - ����~��_'r - � ��� ��' �I��HI� ��LE I�I FEET �'� _ ��! ����� �� � �� �� � � �� �� � � ����� � � �� � � � � � � � � � r ��� �� ��. . �,�, . �` �',{ � � � r������ � .•�� � �. � � * � �, � . . • • • r ■ ■ i i • • • ■ � ■ ■ ■ ■ ■ ■ � � � ■ ■ ■ ■ EF�i� �. ���FF� ...+......+..... �......... . . :� . ��� .,,�= .. ���� ��. �� � F�'� ��''+�� . ��� ��.���-rs��u� r� ��r� ��a� �� �. ���F� �H��� �: �. ��F� ���� J�������� � �� '�� � ��. � �� � ������������ �������� �� � �A ������� ������� ����������� ���� ��� �.��� �.�.#�.�. �. �. � � � � � � � � � � � � ���°���"E � ���.1 �' ���������������������������� �� ��� �� ������������������������������� �I�����'��'� � ���.� �' � �A���� � ������ �4 ���� #������� ���: �� �. ���. �'I��, ��������� ������ ��� ����� ����� �� � ����� �x �' � � �� �������r� �. ���: �.��:��� �+�.�.�, �. _ �.�. � LI�IE T��LE �1�. �IF�E�TI�hI �I�T. L� ���� 1 �'��"�1� � �. ��' J � � ����� ��� ���: � � ��� _ ���� ���� ��, �. ����� �.�.�.�.�. � � � � � � � �� � ' � � � ���� w���� ���� �.�, �� ,�� �. � L ? .�� ��F� �� L,�..�f��1� � r.� i �•'4:•� ,� �.. - � L�� ��� -_ ,- � �• ' , , T !# � r I �'•.� 4 � �� � -I - �� ^� ,�, - ,;;� ` L, , � ��� ��� �I�H I� ���LE I hl FEET � R � ��' ��� ������� �� � �� �� �� � � � �� � ���� THE �EAl�IfV�� �H�1I�N HEF�E�N �E F�EFEF�Ef��E� T� THE TE� �� �I�DI N�TE S1��TE �I �F �1 ��� TE� �I�F�TH �EI1ITF�AL ���I E ����, �I� �E B� E� � �I THE N �F�TH �IEF�! �I ��TU �JI �F 'I ��, �1 � �4D�JUST�IENT. �R�4REi�T'1�: �YFti+1� i�+OLDM�S, �, - �i��� �.P.�.P.�7 ��������� � ��:��: �� ��I ���� � �f � ��#��� �� � � ��� ����� � ���� �I�REF�� A�RF�4��, f�. �F �4 �ALLED �.� A�E� ��EED� -.,, -- :�:�:�:�::�:::�.�.:.�.�.�:�.�.�.�.�.�.�.�.�.�:�:����::::: ��� H�fi� �TRE��' �!�l�E '?��� ��1ZE��� T�� ��� ��� �� ��� ���� 1�1��1�.����i��J��J���Y���.�J� T��L� Fr1�1�! ��. � �� ��� � �� � .+�•�*. ��••��� T���•�� ��'+�� � `' � . � . . ...,.. .,..,.....,.. . ...,,, E��� ���E� ....... ......... �.... � ,� ��� . �+ ' �- i ..� . � ��`.' ��. .� � ��-'_�� � ��.� � �r � �� � Es�r.� ��a� �� �. ���F� �H��� �: �. ��F� ���� J�������� � �� '�� � ��. � �� � ��� � � ���� ��������� � ��:��: �� ��I ���� � �f � �FFI�I�L ���LI� F�E��F��� � � � � � � ��������� ���������� ��:��:�� �� F��: ���.�� Lil� ���I�I�, ��ur�t� �I�r� ��r��r ���r�t�, T���� E��EI�IEIVT CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS City Project No. 102824 Revised July 1, 2011 GC-4.02 Subsurface and Physical Conditions *(27(&+1,&$/(1*,1((5,1*678'< 3$5.(5&2817<($6768%&2857+286( 2/':($7+(5)25'52$' :($7+(5)25'7(;$6  3UHVHQWHG7R %DLUG+DPSWRQ %URZQ,QF  6HSWHPEHU                      352-(&712  Phone (817) 284-9400 Fax (817) 589-9993 Metro (817) 589-9992 CCMMJJ ENGINEERING, INC. 7636 Pebble Drive Fort Worth, Texas 76118 www.cmjengr.com 6HSWHPEHU 5HSRUW1R %DLUG+DPSWRQ %URZQ,QF 0DUWLQ'ULYH6XLWH :HDWKHUIRUG7H[DV $WWQ0U6KDQQRQ/1DYH3(&)0  *(27(&+1,&$/(1*,1((5,1*678'< 3$5.(5&2817<($6768%&2857+286( 2/':($7+(5)25'52$' :($7+(5)25'7(;$6   'HDU0U1DYH  6XEPLWWHGKHUHDUHWKHUHVXOWVRIDJHRWHFKQLFDOHQJLQHHULQJVWXG\IRUWKHUHIHUHQFHGSURMHFW7KLV VWXG\ZDVSHUIRUPHGLQJHQHUDODFFRUGDQFHZLWKRXU3URSRVDO1RGDWHG$SULO 7KHJHRWHFKQLFDOVHUYLFHVZHUHDXWKRUL]HGE\+RQ-XGJH3DW'HHQRQ-XO\ (QJLQHHULQJ DQDO\VHV DQG UHFRPPHQGDWLRQV DUH FRQWDLQHG LQ WKH WH[W VHFWLRQ RI WKH UHSRUW 5HVXOWVRIRXUILHOGDQGODERUDWRU\VHUYLFHVDUHLQFOXGHGLQWKHDSSHQGL[RIWKHUHSRUW:HZRXOG DSSUHFLDWH WKH RSSRUWXQLW\ WR EH FRQVLGHUHG IRU SURYLGLQJ WKH PDWHULDOV HQJLQHHULQJ DQG JHRWHFKQLFDOREVHUYDWLRQVHUYLFHVGXULQJWKHFRQVWUXFWLRQSKDVHRIWKLVSURMHFW :HDSSUHFLDWHWKHRSSRUWXQLW\WREHRIVHUYLFHWR%DLUG+DPSWRQ %URZQ,QF3OHDVHFRQWDFWXV LI\RXKDYHDQ\TXHVWLRQVRULIZHPD\EHRIIXUWKHUVHUYLFHDWWKLVWLPH 5HVSHFWIXOO\VXEPLWWHG CMJ ENGINEERING, INC. TEXAS FIRM REGISTRATION NO. F-9177 0DKVD+HGD\DWL3K'3(0DWWKHZ.DPPHUGLHQHU3( *HRWHFKQLFDO(QJLQHHU 3URMHFW(QJLQHHU 7H[DV1R7H[DV1R FRSLHVVXEPLWWHG0U6KDQQRQ/1DYH3(&)0%DLUG+DPSWRQDQG%URZQ,QF PDLODQGHPDLO    7$%/(2)&217(176 3DJH ,1752'8&7,21 ),(/'(;3/25$7,21$1'/$%25$725<7(67,1* 68%685)$&(&21',7,216 (;,67,1*),//6 )281'$7,215(&200(1'$7,216 ,17(5,25)/2256/$%6$1'(;7(5,25)/$7:25. (;3$16,9(62,/&216,'(5$7,216 ($57+:25. 3$9(0(176 &216758&7,212%6(59$7,216 5(3257&/2685(   $33(1',;$ 3ODWH 3ODQRI%RULQJV$ 8QLILHG6RLO&ODVVLILFDWLRQ$ .H\WR&ODVVLILFDWLRQDQG6\PEROV$ /RJVRI%RULQJV$±$ )UHH6ZHOO7HVW5HVXOWV$      5HSRUW1RCMJ ENGINEERING, INC.  ,1752'8&7,21  3URMHFW'HVFULSWLRQ 7KH SURMHFW DV FXUUHQWO\ SODQQHG FRQVLVWV RI D VLQJOHVWRU\ VXE FRXUWKRXVH EXLOGLQJ DORQJ ZLWK DVVRFLDWHGSDYHPHQWDQGGULYHVRQDVLWHORFDWHGRII2OG:HDWKHUIRUG5RDGDSSUR[LPDWHO\ IHHWHDVWRI)DUPHU5RDGLQ:HDWKHUIRUG7H[DV7KHSURMHFWZLOOEHFRQVWUXFWHGLQWZRSKDVHV ZLWK3KDVH2QHFRQVLVWLQJRIDQVTXDUHIRRWEXLOGLQJ3KDVH7ZRH[SDQGVWKHEXLOGLQJ QRUWKZDUGDGGLQJVTXDUHIHHWWRWKHEXLOGLQJ1REDVHPHQWVDUHSODQQHGDQGVWUXFWXUDO ORDGVDUHDQWLFLSDWHGWREHUHODWLYHO\OLJKW3ODWH$3ODQRI%RULQJVSUHVHQWVWKHDSSUR[LPDWH ORFDWLRQVRIWKHH[SORUDWLRQERULQJV*UDGLQJSODQVZHUHQRWDYDLODEOHDWWKHWLPHRIWKLVVWXG\ %DVHGRQRXUFRQYHUVDWLRQZLWKWKH&OLHQWZHXQGHUVWDQGWKHILQLVKHGJUDGHZLOOEHVLWXDWHGQHDU WKHH[LVWLQJVLWHWRSRJUDSK\ZLWKILOOVRIOHVVWKDQIHHWUHTXLUHGWRUDLVHWKHJUDGH   3XUSRVHDQG6FRSH 7KHSXUSRVHRIWKLVJHRWHFKQLFDOHQJLQHHULQJVWXG\KDVEHHQWRGHWHUPLQHWKHJHQHUDOVXEVXUIDFH FRQGLWLRQVHYDOXDWHWKHHQJLQHHULQJFKDUDFWHULVWLFVRIWKHVXEVXUIDFHPDWHULDOVHQFRXQWHUHGDQG GHYHORSUHFRPPHQGDWLRQVIRUWKHW\SHRUW\SHVRIIRXQGDWLRQVVXLWDEOHIRUWKHSURMHFW  7RDFFRPSOLVKLWVLQWHQGHGSXUSRVHVWKHVWXG\KDVEHHQFRQGXFWHGLQWKHIROORZLQJSKDVHV   GULOOLQJVDPSOHERULQJVWRGHWHUPLQHWKHJHQHUDOVXEVXUIDFHFRQGLWLRQVDQGWRREWDLQVDPSOHVIRU WHVWLQJ  SHUIRUPLQJODERUDWRU\WHVWVRQDSSURSULDWHVDPSOHVWRGHWHUPLQHSHUWLQHQWHQJLQHHULQJ SURSHUWLHVRIWKHVXEVXUIDFHPDWHULDOVDQG  SHUIRUPLQJHQJLQHHULQJDQDO\VHVXVLQJWKHILHOG DQGODERUDWRU\GDWDWRGHYHORSJHRWHFKQLFDOUHFRPPHQGDWLRQVIRUWKHSURSRVHGFRQVWUXFWLRQ  7KH GHVLJQ LV FXUUHQWO\ LQ SURJUHVV DQG WKH ORFDWLRQV DQGRU HOHYDWLRQV RI WKH VWUXFWXUH FRXOG FKDQJH  2QFH WKH ILQDO GHVLJQ LV QHDU FRPSOHWLRQ SHUFHQW WR SHUFHQW VWDJH  LW LV UHFRPPHQGHGWKDW&0-(QJLQHHULQJ,QFEHUHWDLQHGWRUHYLHZWKRVHSRUWLRQVRIWKHFRQVWUXFWLRQ GRFXPHQWVSHUWDLQLQJWRWKHJHRWHFKQLFDOUHFRPPHQGDWLRQVDVDPHDQVWRGHWHUPLQHWKDWRXU UHFRPPHQGDWLRQVKDYHEHHQLQWHUSUHWHGDVLQWHQGHG   5HSRUW)RUPDW 7KH WH[W RI WKH UHSRUW LV FRQWDLQHG LQ 6HFWLRQV  WKURXJK  $OO SODWHV DQG ODUJH WDEOHV DUH FRQWDLQHGLQ$SSHQGL[$7KHDOSKDQXPHULFSODWHDQGWDEOHQXPEHUVLGHQWLI\WKHDSSHQGL[LQ    5HSRUW1RCMJ ENGINEERING, INC.  ZKLFKWKH\DSSHDU6PDOOWDEOHVRIOHVVWKDQRQHSDJHLQOHQJWKPD\DSSHDULQWKHERG\RIWKHWH[W DQGDUHQXPEHUHGDFFRUGLQJWRWKHVHFWLRQLQZKLFKWKH\RFFXU  8QLWVXVHGLQWKHUHSRUWDUHEDVHGRQWKH(QJOLVKV\VWHPDQGPD\LQFOXGHWRQVSHUVTXDUHIRRW WVI NLSV NLS SRXQGV NLSVSHUVTXDUHIRRW NVI SRXQGVSHUVTXDUHIRRW SVI SRXQGV SHUFXELFIRRW SFI DQGSRXQGVSHUVTXDUHLQFK SVL   ),(/'(;3/25$7,21$1'/$%25$725<7(67,1*  )LHOG([SORUDWLRQ 6XEVXUIDFH PDWHULDOV DW WKH SURMHFW VLWH ZHUH H[SORUHG E\ VL[   YHUWLFDO VRLO ERULQJV XVLQJ FRQWLQXRXVIOLJKWDXJHUVDWWKHDSSUR[LPDWHORFDWLRQVVKRZQRQWKH3ODQRI%RULQJV3ODWH$7KH ERULQJORJVDUHLQFOXGHGRQ3ODWHV$WKURXJK$DQGNH\VWRFODVVLILFDWLRQVDQGV\PEROVXVHG RQWKHORJVDUHSURYLGHGRQ3ODWHV$DQG$  8QGLVWXUEHG VDPSOHV RI FRKHVLYH VRLOV ZHUH REWDLQHG ZLWK QRPLQDO LQFK GLDPHWHU WKLQZDOOHG 6KHOE\ WXEHVDPSOHUVDWWKHORFDWLRQVVKRZQRQWKHORJVRIERULQJV7KH6KHOE\WXEHVDPSOHU FRQVLVWVRIDWKLQZDOOHGVWHHOWXEHZLWKDVKDUSFXWWLQJHGJHFRQQHFWHGWRDKHDGHTXLSSHGZLWKD EDOOYDOYHWKUHDGHGIRUURGFRQQHFWLRQ7KHWXEHLVSXVKHGLQWRWKHVRLOE\WKHK\GUDXOLFSXOOGRZQ RIWKHGULOOLQJULJ7KHVRLOVSHFLPHQVZHUHH[WUXGHGIURPWKHWXEHLQWKHILHOGORJJHGWHVWHGIRU FRQVLVWHQF\ZLWKDKDQGSHQHWURPHWHUVHDOHGDQGSDFNDJHGWROLPLWORVVRIPRLVWXUH  7KH FRQVLVWHQF\ RI FRKHVLYH VRLO VDPSOHV ZDV HYDOXDWHG LQ WKH ILHOG XVLQJ D FDOLEUDWHG KDQG SHQHWURPHWHU,QWKLVWHVWDLQFKGLDPHWHUSLVWRQLVSXVKHGLQWRWKHUHODWLYHO\XQGLVWXUEHG VDPSOHDWDFRQVWDQWUDWHWRDGHSWKRILQFK7KHUHVXOWVRIWKHVHWHVWVLQWVIDUHWDEXODWHGDW UHVSHFWLYHVDPSOHGHSWKVRQWKHORJV:KHQWKHFDSDFLW\RIWKHSHQHWURPHWHULVH[FHHGHGWKH YDOXHLVWDEXODWHGDV  7RHYDOXDWHWKHUHODWLYHGHQVLW\DQGFRQVLVWHQF\RIWKHKDUGHUIRUPDWLRQVDPRGLILHGYHUVLRQRIWKH 7H[DV &RQH 3HQHWUDWLRQ WHVW ZDV SHUIRUPHG DW VHOHFWHG ORFDWLRQV  7H[DV 'HSDUWPHQW RI 7UDQVSRUWDWLRQ 7['27 7HVW0HWKRG7H[(VSHFLILHVGULYLQJDLQFKGLDPHWHUFRQHZLWKD SRXQGKDPPHUIUHHO\IDOOLQJLQFKHV7KLVUHVXOWVLQIRRWSRXQGVRIHQHUJ\IRUHDFK EORZ7KLVPHWKRGZDVPRGLILHGE\XWLOL]LQJDSRXQGKDPPHUIUHHO\IDOOLQJLQFKHV7KLV UHVXOWV LQ  IRRWSRXQGV RI HQHUJ\ IRU HDFK KDPPHU EORZ  ,QUHODWLYHO\ VRIW PDWHULDOV WKH    5HSRUW1RCMJ ENGINEERING, INC.  SHQHWURPHWHUFRQHLVGULYHQIRRWDQGWKHQXPEHURIEORZVUHTXLUHGIRUHDFKLQFKSHQHWUDWLRQLV WDEXODWHGDWUHVSHFWLYHWHVWGHSWKVDVEORZVSHULQFKHVRQWKHORJ,QKDUGPDWHULDOV URFNRU URFNOLNH WKHSHQHWURPHWHUFRQHLVGULYHQZLWKWKHUHVXOWLQJSHQHWUDWLRQVLQLQFKHVUHFRUGHGIRU WKHILUVWDQGVHFRQGEORZVDWRWDORIEORZV7KHSHQHWUDWLRQIRUWKHWRWDOEORZVLV UHFRUGHGDWWKHUHVSHFWLYHWHVWLQJGHSWKVRQWKHERULQJORJV   /DERUDWRU\7HVWLQJ /DERUDWRU\ VRLO WHVWV ZHUH SHUIRUPHG RQ VHOHFWHG UHSUHVHQWDWLYH VDPSOHV UHFRYHUHG IURP WKH ERULQJV,QDGGLWLRQWRWKHFODVVLILFDWLRQWHVWV OLTXLGOLPLWVDQGSODVWLFOLPLWV PRLVWXUHFRQWHQWXQLW ZHLJKWDQGXQFRQILQHGFRPSUHVVLYHVWUHQJWKWHVWVZHUHSHUIRUPHG5HVXOWVRIWKHODERUDWRU\WHVWV FRQGXFWHGIRUWKLVSURMHFWDUHLQFOXGHGRQWKHERULQJORJV  6ZHOOWHVWVZHUHSHUIRUPHGRQVSHFLPHQVIURPVHOHFWHGVDPSOHVRIWKHFOD\V7KHVHWHVWVZHUH SHUIRUPHGWRKHOSLQHYDOXDWLQJWKHVZHOOSRWHQWLDORIQHDUVXUIDFHVRLOVLQWKHDUHDRIWKHSURSRVHG EXLOGLQJ7KHUHVXOWVRIWKHVZHOOWHVWVDUHSUHVHQWHGRQ3ODWH$  7KH DERYH ODERUDWRU\ WHVWV ZHUH SHUIRUPHG LQ JHQHUDO DFFRUGDQFH ZLWK DSSOLFDEOH $670 SURFHGXUHVRUJHQHUDOO\DFFHSWHGSUDFWLFH  68%685)$&(&21',7,216  6RLODQG5RFN&RQGLWLRQV 6SHFLILFW\SHVDQGGHSWKVRIVXEVXUIDFHVWUDWDHQFRXQWHUHGDWWKHERULQJORFDWLRQVDUHVKRZQRQ WKH ERULQJ ORJV LQ $SSHQGL[ $  7KH JHQHUDOL]HG VXEVXUIDFH VWUDWLJUDSKLHV HQFRXQWHUHG LQ WKH ERULQJVDUHGLVFXVVHGEHORZ1RWHWKDWGHSWKVRQWKHERULQJVUHIHUWRWKHGHSWKIURPWKHH[LVWLQJ JUDGHRUJURXQGVXUIDFHSUHVHQWDWWKHWLPHRIWKHLQYHVWLJDWLRQDQGWKHERXQGDULHVEHWZHHQWKH YDULRXVVRLOW\SHVDUHDSSUR[LPDWH  6XEVXUIDFHFRQGLWLRQVHQFRXQWHUHGLQWKHEXLOGLQJERULQJV %%DQG% JHQHUDOO\FRQVLVWHG RIFOD\VRLOVH[WHQGLQJWRGHSWKVYDU\LQJIURPIHHWWRIHHWEHORZWKHH[LVWLQJJURXQGVXUIDFH XQGHUODLQE\OLPHVWRQHH[WHQGLQJWRWKHIRRWWHUPLQDWLRQGHSWKRIWKHERULQJV&OD\VRLOVZHUH HQFRXQWHUHGDWWKHVXUIDFHLQ%RULQJV%%DQG%DQGH[WHQGHGWRWKHIRRWWHUPLQDWLRQ GHSWKRIWKHERULQJV$ERXWLQFKHVRIJUDYHOZDVHQFRXQWHUHGDERYHWKHFOD\VRLOVLQ%RULQJ% 7KH XSSHU IRRW RI FOD\ VRLOV HQFRXQWHUHG LQ %RULQJV % DQG % DQG WKH JUDYHO PDWHULDO    5HSRUW1RCMJ ENGINEERING, INC.  HQFRXQWHUHGLQ%RULQJ%ZHUHYLVXDOO\FODVVLILHGDVILOOPDWHULDO1DWXUDOVRLOVFRQVLVWRIGDUN EURZQEURZQOLJKWEURZQDQGWDQFOD\VRLOVZLWKFDOFDUHRXVQRGXOHVFDOFDUHRXVGHSRVLWVDQG RFFDVLRQDOOLPHVWRQHIUDJPHQWV7KHHQFRXQWHUHGOLPHVWRQHFRQVLVWHGRIWDQOLPHVWRQHZLWKFOD\ VHDPVDQGOD\HUVDQGRUOLJKWJUD\OLPHVWRQH  7KHFOD\VHQFRXQWHUHGLQWKHERULQJVKDGWHVWHG/LTXLG/LPLWV // UDQJLQJIURPWRZLWK 3ODVWLFLW\,QGLFHV 3, UDQJLQJIURPWRDQGDUHFODVVLILHGDV&/DQG&+E\WKH86&67KH YDULRXVFOD\H\VRLOVZHUHJHQHUDOO\VWLIIWRKDUG VRLOEDVLV LQFRQVLVWHQF\ZLWKSRFNHWSHQHWURPHWHU UHDGLQJV RI  WR RYHU  WVI  7HVWHG XQLW ZHLJKW YDOXHV UDQJHG IURP  WR  SFI DQG XQFRQILQHGFRPSUHVVLYHVWUHQJWKVYDULHGIURPWRSVI  7KH HQFRXQWHUHG OLPHVWRQH LV PRGHUDWHO\ KDUG WR YHU\ KDUG URFN EDVLV  ZLWK 7H[DV &RQH SHQHWURPHWHU 7+' YDOXHVRIòWRôLQFKHVRISHQHWUDWLRQSHUEORZV  7KH$WWHUEHUJ/LPLWVWHVWVLQGLFDWHWKHFOD\VHQFRXQWHUHGDWWKLVVLWHDUHPRGHUDWHO\WRKLJKO\DFWLYH ZLWKUHVSHFWWRPRLVWXUHLQGXFHGYROXPHFKDQJHV$FWLYHFOD\VFDQH[SHULHQFHYROXPHFKDQJHV H[SDQVLRQ RU FRQWUDFWLRQ  ZLWK IOXFWXDWLRQV LQ WKHLU PRLVWXUHFRQWHQW  5HVXOWV RI VZHOO WHVWLQJ LQGLFDWH D KLJK SRWHQWLDO IRU PRLVWXUH LQGXFHG YROXPH FKDQJH IURP SUHVHQW LQVLWX PRLVWXUH FRQGLWLRQV   *URXQG:DWHU2EVHUYDWLRQV 7KHERULQJVZHUHGULOOHGXVLQJFRQWLQXRXVIOLJKWDXJHUVWRREVHUYHJURXQGZDWHUVHHSDJHGXULQJ GULOOLQJ*URXQGZDWHUVHHSDJHZDVQRWHQFRXQWHUHGGXULQJGULOOLQJDQGDOOERULQJVZHUHGU\DW FRPSOHWLRQRIGULOOLQJRSHUDWLRQV  )OXFWXDWLRQV RI WKH JURXQGZDWHU OHYHO FDQ RFFXU GXH WR VHDVRQDO YDULDWLRQV LQ WKH DPRXQW RI UDLQIDOO VLWH WRSRJUDSK\ DQG UXQRII K\GUDXOLF FRQGXFWLYLW\ RI VRLO VWUDWD DQG RWKHU IDFWRUV QRW HYLGHQWDWWKHWLPHWKHERULQJVZHUHSHUIRUPHG'XULQJZHWSHULRGVRIWKH\HDUVHHSDJHFDQRFFXU LQ MRLQWV LQ WKH FOD\V DWRS RU ZLWKLQ WKH WDQ OLPHVWRQHV 7KHSRVVLELOLW\ RI JURXQGZDWHU OHYHO IOXFWXDWLRQV VKRXOG EH FRQVLGHUHG ZKHQ GHYHORSLQJ WKH GHVLJQ DQG FRQVWUXFWLRQ SODQV IRU WKH SURMHFW     5HSRUW1RCMJ ENGINEERING, INC.  (;,67,1*),//6 )LOO PDWHULDO ZDV HQFRXQWHUHG WR D GHSWK RI DERXW  IRRW EHORZWKHH[LVWLQJ JURXQG VXUIDFH LQ %RULQJV  DQG  DQG FRQWDLQHG VRPH FRQVWUXFWLRQ GHEULV  $OWKRXJK QRW HQFRXQWHUHG LQ WKH UHPDLQLQJERULQJVILOOPDWHULDOPD\EHSUHVHQWRQRWKHUSRUWLRQVRIWKHVLWH8QFRQWUROOHGILOOLV JHQHUDOO\QRWFRQVLGHUHGVXLWDEOHIRUVXSSRUWRIIRXQGDWLRQV:HH[SHFWWKHILOOPDWHULDOZLWKLQWKH EXLOGLQJ SDG ZLOO EH UHPRYHG DQG UHSODFHG ZLWK PRLVWXUH FRQGLWLRQV VRLOV GXULQJ VXEJUDGH LPSURYHPHQWDVUHFRPPHQGHGLQ6HFWLRQRIWKLVUHSRUW$Q\ILOOUHPDLQLQJEHORZWKHGHSWKRI PRLVWXUHFRQGLWLRQLQJPXVWEHUHPRYHGDQGUHFRPSDFWHGLQDFFRUGDQFHZLWKUHFRPPHQGDWLRQV SURYLGHGLQ6HFWLRQRIWKLVUHSRUW  )281'$7,215(&200(1'$7,216  *HQHUDO)RXQGDWLRQ&RQVLGHUDWLRQV 7ZRLQGHSHQGHQWGHVLJQFULWHULDPXVWEHVDWLVILHGLQWKHVHOHFWLRQRIWKHW\SHRIIRXQGDWLRQWR VXSSRUWWKHSURSRVHGVWUXFWXUH)LUVWWKHXOWLPDWHEHDULQJFDSDFLW\UHGXFHGE\DVXIILFLHQWIDFWRU RI VDIHW\ PXVW QRW EH H[FHHGHG E\ WKH EHDULQJ SUHVVXUH WUDQVIHUUHG WR WKH IRXQGDWLRQ VRLOV 6HFRQGGXHWRFRQVROLGDWLRQRUH[SDQVLRQRIWKHXQGHUO\LQJVRLOVGXULQJWKHRSHUDWLQJOLIHRIWKH VWUXFWXUHWRWDODQGGLIIHUHQWLDOYHUWLFDOPRYHPHQWVPXVWEHZLWKLQWROHUDEOHOLPLWV7KHIRXQGDWLRQV IRUWKHSURSRVHGVWUXFWXUHVDUHGLVFXVVHGEHORZ  7KH PRLVWXUH LQGXFHG YROXPH FKDQJHV DVVRFLDWHG ZLWK WKH PRGHUDWHO\ WR KLJKO\ DFWLYH FOD\V SUHVHQWDWWKLVVLWHLQGLFDWHWKDWVKDOORZRUQHDUVXUIDFHIRRWLQJVFRXOGEHVXEMHFWWRGLIIHUHQWLDO PRYHPHQWVRIDSRWHQWLDOO\GHWULPHQWDOPDJQLWXGH7KHPRVWSRVLWLYHIRXQGDWLRQV\VWHPIRUWKH SURSRVHG VWUXFWXUH ZRXOG EH VLWXDWHG EHORZ WKH ]RQH RI PRVW VLJQLILFDQW VHDVRQDO PRLVWXUH YDULDWLRQV$GHHSIRXQGDWLRQV\VWHPWUDQVIHUULQJFROXPQORDGVWRWKHWDQRUOLJKWJUD\OLPHVWRQHLV FRQVLGHUHGWKHPRVWSRVLWLYHIRXQGDWLRQV\VWHP   6WUDLJKW6KDIW'HVLJQ3DUDPHWHUV 5HFRPPHQGDWLRQVDQGSDUDPHWHUVIRUWKHGHVLJQRIFDVWLQSODFHVWUDLJKWVKDIWGULOOHGSLHUVDUH RXWOLQHGEHORZ6SHFLILFUHFRPPHQGDWLRQVIRUWKHFRQVWUXFWLRQDQGLQVWDOODWLRQRIWKHGULOOHGSLHUV DUHLQFOXGHGLQWKHIROORZLQJVHFWLRQDQGVKDOOEHIROORZHGGXULQJFRQVWUXFWLRQ      5HSRUW1RCMJ ENGINEERING, INC.  %HDULQJ6WUDWXP 7DQ/,0(6721(ZLWKFOD\VHDPVDQGOD\HUVRU/LJKW *UD\/,0(6721(ZLWKVKDOHVHDPV 'HSWKRI%HDULQJ6WUDWXP %HWZHHQDQGIHHWEHORZH[LVWLQJJUDGHV 5HTXLUHG3HQHWUDWLRQ'HSWK $OO SLHUV VKRXOG SHQHWUDWH LQWR WKH EHDULQJ VWUDWXP D PLQLPXPRIIHHWRURQHSLHUGLDPHWHUZKLFKHYHULV JUHDWHU  'HHSHU SHQHWUDWLRQV PD\ EH UHTXLUHG WR GHYHORSDGGLWLRQDOVNLQIULFWLRQDQGRUXSOLIWUHVLVWDQFH $OORZDEOH(QG%HDULQJ&DSDFLW\ SVI $OORZDEOH6NLQ)ULFWLRQ $SSOLFDEOHEHORZDPLQLPXPSHQHWUDWLRQRIIHHWLQWR JUD\ OLPHVWRQH  SVI IRU FRPSUHVVLYH ORDGV DQG SVIIRUWHQVLOHORDGV$OOVNLQIULFWLRQVKRXOGEH XVHG RQ WKDW SDUW RI WKH VKDIW EHORZ DQ\ WHPSRUDU\ FDVLQJ  7KH XSSHU  IHHW RI VKDIW LQ FRQWDFW ZLWK OLPHVWRQHVKRXOGEHQHJOHFWHG 7KHDERYHYDOXHVFRQWDLQDVDIHW\IDFWRURIWKUHH  6NLQIULFWLRQLVDSSOLFDEOHIRUWKDWSRUWLRQRI WKHVKDIWHPEHGGHGLQWKHWDQRUJUD\OLPHVWRQHEHORZDQ\WHPSRUDU\FDVLQJ3HQHWUDWLRQVJUHDWHU WKDQ WKH PLQLPXP SHQHWUDWLRQ PD\ EH UHTXLUHG WR GHYHORS DGGLWLRQDO VNLQ IULFWLRQ DQGRU XSOLIW UHVLVWDQFH  'ULOOHG VKDIWV VKRXOG H[WHQG WKURXJK DQ\ ZHDWKHUHG OLPHVWRQH RU FOD\ VHDPV DQG OD\HUVDQGEHDULQFRPSHWHQWWDQRUOLJKWJUD\OLPHVWRQH  ,Q RUGHU WR GHYHORS IXOO ORDG FDUU\LQJ FDSDFLW\ LQ VNLQ IULFWLRQ DGMDFHQW VKDIWV VKRXOG KDYH D PLQLPXPFHQWHUWRFHQWHUVSDFLQJRIWLPHVWKHGLDPHWHURIWKHODUJHUVKDIW&ORVHUVSDFLQJPD\ UHTXLUHVRPHUHGXFWLRQVLQVNLQIULFWLRQDQGRUFKDQJHVLQLQVWDOODWLRQVHTXHQFHV&ORVHO\VSDFHG VKDIWVVKRXOGEHH[DPLQHGRQDFDVHE\FDVHEDVLV$VDJHQHUDOJXLGHWKHGHVLJQVNLQIULFWLRQ ZLOOYDU\OLQHDUO\IURPWKHIXOOYDOXHDWDVSDFLQJRIGLDPHWHUVWRSHUFHQWRIWKHGHVLJQYDOXHDW GLDPHWHU  6HWWOHPHQWVIRUSURSHUO\LQVWDOOHGDQGFRQVWUXFWHGVWUDLJKWVKDIWVLQWKHOLPHVWRQHZLOOEHSULPDULO\ HODVWLFDQGDUHHVWLPDWHGWREHRQHLQFKRUOHVV  Soil Induced Uplift Loads 7KHGULOOHGVKDIWVFRXOGH[SHULHQFHWHQVLOHORDGVDVDUHVXOWRISRVWFRQVWUXFWLRQKHDYHLQWKHVLWH VRLOV  7KH PDJQLWXGH RI WKHVH ORDGV YDULHV ZLWK WKH VKDIW GLDPHWHU VRLO SDUDPHWHUV DQG SDUWLFXODUO\WKHLQVLWXPRLVWXUHOHYHOVDWWKHWLPHRIFRQVWUXFWLRQ)RUGHVLJQSXUSRVHVDQXSOLIW ORDGRISVIRYHUWKHXSSHUIHHWRIWKHVKDIWLQFRQWDFWZLWKFOD\VRLOVLVHVWLPDWHG7KLV ORDGPXVWEHUHVLVWHGE\WKHGHDGORDGRQWKHVKDIWFRQWLQXRXVYHUWLFDOUHLQIRUFLQJVWHHOLQWKH    5HSRUW1RCMJ ENGINEERING, INC.  VKDIWDQGDVKDIWDGKHVLRQGHYHORSHGZLWKLQWKHEHDULQJVWUDWD,QRUGHUWRDLGLQWKHVWUXFWXUDO GHVLJQRIWKHUHLQIRUFHPHQWPLQLPXPUHLQIRUFLQJVKRXOGEHHTXDOWRSHUFHQWRIWKHVKDIWDUHD  Drilled Shaft Construction Considerations 'ULOOHGSLHUFRQVWUXFWLRQVKRXOGEHPRQLWRUHGE\DUHSUHVHQWDWLYHRIWKHJHRWHFKQLFDOHQJLQHHUWR REVHUYHDPRQJRWKHUWKLQJVWKHIROORZLQJLWHPV  x ,GHQWLILFDWLRQRIEHDULQJPDWHULDO x $GHTXDWHSHQHWUDWLRQRIWKHVKDIWH[FDYDWLRQLQWRWKHEHDULQJOD\HU x 7KHEDVHDQGVLGHVRIWKHVKDIWH[FDYDWLRQDUHFOHDQRIORRVHFXWWLQJV x ,IVHHSDJHLVHQFRXQWHUHGZKHWKHULWLVRIVXIILFLHQWDPRXQWWRUHTXLUHWKHXVHRIWHPSRUDU\ VWHHOFDVLQJ,IFDVLQJLVQHHGHGLWLVLPSRUWDQWWKDWWKHILHOGUHSUHVHQWDWLYHREVHUYHWKDWD KLJKKHDGRISODVWLFFRQFUHWHLVDOZD\VPDLQWDLQHGZLWKLQWKHFDVLQJGXULQJWKHLUH[WUDFWLRQ WRSUHYHQWWKHLQIORZRIZDWHU  6KDIW H[FDYDWLRQV VKRXOG EH PDLQWDLQHG LQ WKH GU\  3UHFDXWLRQV VKRXOG EH WDNHQ GXULQJ WKH SODFHPHQWRIUHLQIRUFLQJVWHHODQGFRQFUHWHWRSUHYHQWORRVHH[FDYDWHGVRLOIURPIDOOLQJLQWRWKH H[FDYDWLRQ  &RQFUHWH VKRXOG EH SODFHG DV VRRQ DV SUDFWLFDO DIWHU FRPSOHWLRQ RI WKH GULOOLQJ FOHDQLQJDQGREVHUYDWLRQ([FDYDWLRQIRUDGULOOHGSLHUVKRXOGEHILOOHGZLWKFRQFUHWHEHIRUHWKH HQG RI WKH ZRUNGD\ RU VRRQHU LI UHTXLUHG WR SUHYHQW GHWHULRUDWLRQ RI WKH EHDULQJ PDWHULDO 3URORQJHG H[SRVXUH RU LQXQGDWLRQ RI WKH EHDULQJ VXUIDFH ZLWK ZDWHU ZLOO UHVXOW LQ FKDQJHV LQ VWUHQJWKDQGFRPSUHVVLELOLW\FKDUDFWHULVWLFV,IGHOD\VRFFXUWKHGULOOHGSLHUH[FDYDWLRQVKRXOGEH GHHSHQHGDVQHFHVVDU\DQGFOHDQHGLQRUGHUWRSURYLGHDIUHVKEHDULQJVXUIDFH  7KHFRQFUHWHVKRXOGKDYHDVOXPSRILQFKHVSOXVRUPLQXVLQFK7KHFRQFUHWHVKRXOGEH SODFHGLQDPDQQHUWRSUHYHQWWKHFRQFUHWHIURPVWULNLQJWKHUHLQIRUFLQJFDJHRUWKHVLGHVRIWKH H[FDYDWLRQ&RQFUHWHVKRXOGEHWUHPLHGWRWKHERWWRPRIWKHH[FDYDWLRQWRFRQWUROWKHPD[LPXP IUHHIDOORIWKHSODVWLFFRQFUHWHWROHVVWKDQIHHWRUIRFXVFRQFUHWHEHWZHHQUHLQIRUFLQJWRSUHYHQW VHJUHJDWLRQ  $GULOOLQJULJRIVXIILFLHQWVL]HDQGZHLJKWZLOOEHQHFHVVDU\IRUGULOOLQJDQGRUFRULQJWKURXJKWKH KDUGOD\HUVWRUHDFKWKHGHVLUHGEHDULQJVWUDWXPDQGDFKLHYHWKHUHTXLUHGSHQHWUDWLRQ,WVKRXOG EHDQWLFLSDWHGWKDWYHU\KDUGWRH[WUHPHO\]RQHVFDQEHSUHVHQWLQWKHWDQDQGJUD\OLPHVWRQHV 7KHYHU\KDUGWRH[WUHPHO\KDUGOD\HUVFDQFRPSOLFDWHSLHUGULOOLQJRSHUDWLRQV    5HSRUW1RCMJ ENGINEERING, INC.  ,Q DGGLWLRQ WR WKH DERYH JXLGHOLQHV WKH VSHFLILFDWLRQV IURP WKH $VVRFLDWLRQ RI 'ULOOHG 6KDIW &RQWUDFWRUV,QF6WDQGDUGVDQG6SHFLILFDWLRQVIRUWKH)RXQGDWLRQ'ULOOLQJ,QGXVWU\DV5HYLVHG RURWKHUUHFRJQL]HGVSHFLILFDWLRQVIRUSURSHULQVWDOODWLRQRIGULOOHGVKDIWIRXQGDWLRQV\VWHPV VKRXOGEHIROORZHG  Grade Beams $OOJUDGHEHDPVVKRXOGEHVXSSRUWHGE\WKHGULOOHGVKDIWV$PLQLPXPLQFKYRLGVSDFHVKRXOG EHSURYLGHGEHQHDWKDOOJUDGHEHDPVWRSUHYHQWFRQWDFWZLWKWKHVZHOOLQJFOD\VRLOV7KLVYRLGZLOO VHUYHWRPLQLPL]HGLVWUHVVUHVXOWLQJIURPVZHOOSUHVVXUHVJHQHUDWHGE\WKHFOD\V  *UDGHEHDPVPD\EHFDVWRQFDUGERDUGFDUWRQIRUPVRUIRUPHGDERYHJUDGH,IFDUGERDUGFDUWRQ IRUPVDUHXVHGFDUHVKRXOGEHWDNHQWRQRWFUXVKWKHFDUWRQIRUPVRUDOORZWKHFDUWRQIRUPVWR EHFRPHZHWSULRUWRRUGXULQJFRQFUHWHSODFHPHQWRSHUDWLRQV$VRLOUHWDLQHUVKRXOGEHSURYLGHGWR KHOSSUHYHQWLQILOOLQJRIWKLVYRLG  %DFNILOODJDLQVWWKHH[WHULRUIDFHRIJUDGHEHDPVRUSDQHOVVKRXOGEHSURSHUO\FRPSDFWHGRQVLWH FOD\V  &RPSDFWLRQ VKRXOG EH D PLQLPXP RI  SHUFHQW RI $670 ' DW D PLQLPXP RI  SHUFHQWDJHSRLQWVDERYHWKHRSWLPXPPRLVWXUHFRQWHQWGHWHUPLQHGE\WKDWWHVW7KLVFOD\ILOOLV LQWHQGHGWRUHGXFHVXUIDFHZDWHULQILOWUDWLRQEHQHDWKWKHVWUXFWXUH  ,17(5,25)/2256/$%6$1'(;7(5,25)/$7:25.  3RWHQWLDO9HUWLFDO0RYHPHQWV /LJKWO\ORDGHGIORRUVODEVSODFHGRQJUDGHZLOOEHVXEMHFWWRPRYHPHQWDVDUHVXOWRIPRLVWXUH LQGXFHGYROXPHFKDQJHVLQWKHPRGHUDWHO\WRKLJKO\DFWLYHFOD\V7KHFOD\VH[SDQG KHDYH ZLWK LQFUHDVHVLQPRLVWXUHDQGFRQWUDFW VKULQN ZLWKGHFUHDVHVLQPRLVWXUH7KHPRYHPHQWW\SLFDOO\ RFFXUVDVSRVWFRQVWUXFWLRQKHDYH7KHSRWHQWLDOPDJQLWXGHRIWKHPRLVWXUHLQGXFHGPRYHPHQWVLV UDWKHULQGHWHUPLQDWH,WLVLQIOXHQFHGE\WKHVRLOSURSHUWLHVRYHUEXUGHQSUHVVXUHVDQGWRDJUHDW H[WHQW E\ VRLO PRLVWXUH OHYHOV DW WKH WLPH RI FRQVWUXFWLRQ  7KH JUHDWHVW SRWHQWLDO IRU SRVW FRQVWUXFWLRQPRYHPHQWRFFXUVZKHQWKHVRLOVDUHLQDGU\FRQGLWLRQDWWKHWLPHRIFRQVWUXFWLRQ %DVHGRQWKHFRQGLWLRQVHQFRXQWHUHGLQWKHERULQJVSRWHQWLDOPRLVWXUHLQGXFHGPRYHPHQWVDUH HVWLPDWHGWREHRQWKHRUGHURIòLQFKHVIRUVRLOVLQDGU\FRQGLWLRQ6RLOPRYHPHQWVVLJQLILFDQWO\ ODUJHU WKDQ HVWLPDWHG FRXOG RFFXU GXH WR LQDGHTXDWH VLWH JUDGLQJ SRRU GUDLQDJH SRQGLQJ RI UDLQIDOODQGRUOHDNLQJSLSHOLQHV    5HSRUW1RCMJ ENGINEERING, INC.   6WUXFWXUDOO\6XVSHQGHG)ORRU6ODE 7KHPRVWSRVLWLYHPHWKRGRISUHYHQWLQJVODEGLVWUHVVGXHWRVZHOOLQJVRLOVLVWRVWUXFWXUDOO\VXVSHQG WKH LQWHULRU VODE  'XH WR WKH H[SDQVLRQ SRWHQWLDO RI WKH VLWHFOD\V ZH UHFRPPHQG WKDW WKH VXVSHQGHGIORRUVODEEHFRQVWUXFWHGRQFDUWRQIRUPVZLWKDPLQLPXPLQFKYRLGVSDFHRUFUDZO VSDFH  &DUHVKRXOGEHWDNHQWRDVVXUHWKDWWKHYRLGER[HVDUHQRWDOORZHGWREHFRPHZHWRUFUXVKHGSULRU WRRUGXULQJFRQFUHWHSODFHPHQWDQGILQLVKLQJRSHUDWLRQV&RUUXJDWHGVWHHOSODFHGRQWKHWRSRI WKHFDUWRQIRUPVFRXOGEHXVHGWRUHGXFHWKHULVNRIFUXVKLQJRIWKHFDUWRQIRUPVGXULQJFRQFUHWH SODFHPHQW DQG ILQLVKLQJ RSHUDWLRQV $V D TXDOLW\ FRQWURO PHDVXUH GXULQJ FRQVWUXFWLRQ DFWXDO FRQFUHWHTXDQWLWLHVSODFHGVKRXOGEHFKHFNHGDJDLQVWDQWLFLSDWHGTXDQWLWLHV6LJQLILFDQWFRQFUHWH RYHUDJHZRXOGEHDQHDUO\LQGLFDWLRQRIDFROODSVHGYRLG  :KHUHDFUDZOVSDFHLVXWLOL]HGSURYLVLRQVVKRXOGEHPDGHWRSURYLGHGUDLQDJHIURPXQGHUWKH EXLOGLQJ9HQWLODWLRQRIWKHYRLGEHORZWKHIORRUVVKRXOGEHSURYLGHGLIKLJKKXPLGLW\FDQFDXVH SUREOHPVZLWKIORRUWLOHDGKHVLYHV  9HKLFOHRUSHGHVWULDQUDPSVOHDGLQJXSWRWKHEXLOGLQJVKRXOGEHVWUXFWXUDOO\FRQQHFWHGWRWKH EXLOGLQJJUDGHEHDPVWRDYRLGDEUXSWGLIIHUHQWLDOPRYHPHQWEHWZHHQWKHEXLOGLQJVODEDQGWKH UDPSV7UDQVLWLRQLQJGHWDLOVZLOOEHUHTXLUHGDWWKHSRLQWVZKHUHUDPSVFRQQHFWZLWKSDYLQJDQG VODERQJUDGHHOHPHQWV,QDGGLWLRQUDPSVODEVVKRXOGEHFRQVWUXFWHGVRWKDWVORSHVVXIILFLHQWIRU HIIHFWLYHGUDLQDJHRIVXUIDFHZDWHUDUHVWLOOSURYLGHGDIWHUSRWHQWLDOGLIIHUHQWLDOPRYHPHQWV   *URXQG6XSSRUWHG)ORRU6ODEVDQG([WHULRU)ODWZRUN ,QFRQMXQFWLRQZLWKGULOOHGVKDIWVLQWHULRUVODEVDQGRUH[WHULRUIODWZRUNFDQEHSODFHGRQDSUHSDUHG VXEJUDGH  6ODERQJUDGH FRQVWUXFWLRQ VKRXOG RQO\ EH FRQVLGHUHG LI VODE PRYHPHQW FDQ EH WROHUDWHG  7KH OHYHO RI DFFHSWDEOH PRYHPHQW YDULHV ZLWK WKH XVHU EXW PHWKRGV DUH QRUPDOO\ VHOHFWHGZLWKWKHJRDORIOLPLWLQJVODEPRYHPHQWVWRDERXWRQHLQFK5HGXFWLRQVLQDQWLFLSDWHG PRYHPHQWVFDQEHDFKLHYHGE\XVLQJPHWKRGVGHYHORSHGLQWKLVDUHDWRUHGXFHRQJUDGHVODE PRYHPHQWV  7KH PRUH FRPPRQO\ XVHG PHWKRGV FRQVLVW RI SODFLQJ QRQH[SDQVLYH VHOHFW ILOO EHQHDWKWKHVODEDQGPRLVWXUHFRQGLWLRQLQJWKHVRLOV7KHXVHRIWKHVHPHWKRGVZLOOQRWHOLPLQDWH WKHULVNRIXQDFFHSWDEOHPRYHPHQWV     5HSRUW1RCMJ ENGINEERING, INC.  5HDGHUV VKRXOG XQGHUVWDQG WKDW D JURXQGVXSSRUWHG IORRU VODE DQG IODWZRUN FDQ KHDYH FRQVLGHUDEO\ LI SODFHG RQ GU\ H[SDQVLYH FOD\V  %DVHG RQ WKH FRQGLWLRQV HQFRXQWHUHG LQ WKH ERULQJV WKH LQVWDOODWLRQ RI D IRRW FDS RI QRQH[SDQVLYH VHOHFW ILOO RYHU  IHHW RI PRLVWXUH FRQGLWLRQHGFOD\VVKRXOGUHGXFHSRWHQWLDOPRYHPHQWVWRDERXWLQFK,WLVQRWUHTXLUHGWRRYHU H[FDYDWH OLPHVWRQH WR LQVWDOO WKH UHFRPPHQGHG WKLFNQHVV RI PRLVWXUH FRQGLWLRQHG VRLOV 0HFKDQLFDOO\UHZRUNLQJWKHFOD\VDVGLVFXVVHGEHORZLVWKHUHFRPPHQGHGPHWKRGRIPRLVWXUH FRQGLWLRQLQJ6ODEVQRWFDSDEOHRIWROHUDWLQJPRYHPHQWVKRXOGEHVWUXFWXUDOO\VXVSHQGHG7KHVH UHFRPPHQGDWLRQVVKRXOGEHUHYLHZHGRQFHDJUDGLQJSODQLVILQDOL]HG  Strong consideration should be given to extending the moisture conditioning process beyond the building line to include entrances, sidewalks, flatwork, porticos, or other areas sensitive to movement. Non-expansive fill, however, should not extend past the limits of an impermeable surface, such as building pad or immediately adjacent pavement due to increased chance of providing a conduit for water to infiltrate into the building pad.  6RLO WUHDWPHQWV SUHVHQWHG LQ WKLV VHFWLRQ DUH UHIHUHQFHG DV DQDOWHUQDWLYH WR WKH XVH RI D VWUXFWXUDOO\VXVSHQGHGIORRUVODE7KHRZQHUPXVWIXOO\XQGHUVWDQGWKDWLIWKHIORRUVODELVSODFHG RQJUDGHVRPHPRYHPHQWDQGUHVXOWDQWFUDFNLQJZLWKLQWKHIORRUDQGLQWHULRUZDOOSDUWLWLRQVPD\ RFFXU7KLVXSZDUGVODEPRYHPHQWDQGFUDFNLQJLVXVXDOO\GLIILFXOWDQGFRVWO\WRUHSDLUDQGPD\ UHTXLUHFRQWLQXHGPDLQWHQDQFHH[SHQVH  ,W VKRXOG EH QRWHG WKHVH PHWKRGV RI WUHDWPHQW DUH SUHVHQWHG DVDQ RSWLRQ IRU WKH RZQHU¶V FRQVLGHUDWLRQ7KHRSWLRQVPD\RUPD\QRWEHSUDFWLFDORUHFRQRPLFDOO\IHDVLEOHGHSHQGLQJRQWKH H[SHFWHGSHUIRUPDQFHRIWKHSURSRVHGVWUXFWXUH7KHRZQHUVKRXOGEHDZDUHWKDWWKLVPHWKRGZLOO QRWSUHYHQWPRYHPHQWRIVRLOVXSSRUWHGIRXQGDWLRQHOHPHQWVDQGFDQRQO\UHGXFHWKHPDJQLWXGH RI WKH PRYHPHQW  3ODFHPHQW RI WKH IORRU VODE RQJUDGH UHSUHVHQWV D FRPSURPLVH EHWZHHQ FRQVWUXFWLRQFRVWDQGULVNRIIORRUGLVWUHVV  $SURSHUO\HQJLQHHUHGDQGFRQVWUXFWHGYDSRUEDUULHUVKRXOGEHSURYLGHGEHQHDWKVODEVRQJUDGH ZKLFKZLOOEHFDUSHWHGRUUHFHLYHPRLVWXUHVHQVLWLYHFRYHULQJVRUDGKHVLYHV  Mechanical Reworking of Near-Surface Clays with 1 foot Select Fill Cap ,QJHQHUDOWKHSURFHGXUHIRUSDGSUHSDUDWLRQRIDJURXQGVXSSRUWHGIORRUVODELQGU\VRLOFRQGLWLRQV LVSHUIRUPHGDVIROORZV    5HSRUW1RCMJ ENGINEERING, INC.   5HPRYH DOO H[LVWLQJ VXUIDFH YHJHWDWLRQ WUHHV DQG DVVRFLDWHG URRW PDWV RUJDQLF WRSVRLO H[LVWLQJILOOFRQVWUXFWLRQGHEULVDQGDQ\RWKHUGHOHWHULRXVPDWHULDO  ([FDYDWHVXUILFLDOFOD\VWRDPLQLPXPRIIHHWEHORZILQLVKHGJUDGHRUWRWKHWRSVXUIDFHRI LQWDFWOLPHVWRQHZKLFKHYHULVHQFRXQWHUHGILUVW6FDULI\WKHH[SRVHGFOD\VXEJUDGH LISUHVHQW  WRDGHSWKRILQFKHVDGMXVWWKHPRLVWXUHDQGFRPSDFWDWDPLQLPXPRISHUFHQWDJHSRLQWV DERYHRSWLPXPPRLVWXUHWREHWZHHQDQGSHUFHQWRI6WDQGDUG3URFWRUGHQVLW\ $670'  2YHUFRPSDFWLRQVKRXOGQRWEHDOORZHG  )LOOSDGWRIHHWEHORZILQDOJUDGHXVLQJVLWHH[FDYDWHG RUVLPLODUFOD\VRLOV&RPSDFWLQ PD[LPXPLQFKORRVHOLIWVDWDPLQLPXPRISHUFHQWDJHSRLQWVDERYHRSWLPXPPRLVWXUHWR EHWZHHQDQGSHUFHQWRI6WDQGDUG3URFWRUGHQVLW\ $670' 2YHUFRPSDFWLRQ VKRXOGQRWEHDOORZHG  &RPSOHWHSDGILOOXVLQJDPLQLPXPRIIHHWRIQRQH[SDQVLYHVHOHFWILOORUSURFHVVHGOLPHVWRQH ZLWKD/LTXLG/LPLWOHVVWKDQDQGD3ODVWLFLW\,QGH[ 3, EHWZHHQDQG7KHVHOHFWILOO VKRXOGEHFRPSDFWHGLQPD[LPXPLQFKORRVHOLIWVDWPLQXVWRSOXVSHUFHQWDJHSRLQWVRI WKHVRLO¶VRSWLPXPPRLVWXUHFRQWHQWDWDPLQLPXPRISHUFHQWRI6WDQGDUG3URFWRUGHQVLW\ $670' 7KHVHOHFWILOOVKRXOGEHSODFHGZLWKLQKRXUVRIFRPSOHWLQJWKHLQVWDOODWLRQRI WKHPRLVWXUHFRQGLWLRQHGVRLOV  (;3$16,9(62,/&216,'(5$7,216  6LWH'UDLQDJH $QLPSRUWDQWIHDWXUHRIWKHSURMHFWLVWRSURYLGHSRVLWLYHGUDLQDJHDZD\IURPWKHSURSRVHGEXLOGLQJ ,IZDWHULVSHUPLWWHGWRVWDQGQH[WWRRUEHORZWKHVWUXFWXUHH[FHVVLYHVRLOPRYHPHQWV KHDYH FDQ RFFXU7KLVFRXOGUHVXOWLQGLIIHUHQWLDOIORRUVODERUIRXQGDWLRQPRYHPHQW  $ ZHOOGHVLJQHG VLWH GUDLQDJH SODQ LV RI XWPRVW LPSRUWDQFH DQGVXUIDFH GUDLQDJH VKRXOG EH SURYLGHGGXULQJFRQVWUXFWLRQDQGPDLQWDLQHGWKURXJKRXWWKHOLIHRIWKHVWUXFWXUH&RQVLGHUDWLRQ VKRXOGEHJLYHQWRWKHGHVLJQDQGORFDWLRQRIJXWWHUGRZQVSRXWVSODQWLQJDUHDVRURWKHUIHDWXUHV ZKLFK ZRXOG SURGXFH PRLVWXUH FRQFHQWUDWLRQ DGMDFHQW WR RU EHQHDWK WKH VWUXFWXUH RU SDYLQJ &RQVLGHUDWLRQVKRXOGEHJLYHQWRWKHXVHRIVHOIFRQWDLQHGZDWHUWLJKWSODQWHUV-RLQWVQH[WWRWKH VWUXFWXUHVKRXOGEHVHDOHGZLWKDIOH[LEOHMRLQWVHDOHUWRSUHYHQWLQILOWUDWLRQRIVXUIDFHZDWHU3URSHU PDLQWHQDQFH VKRXOG LQFOXGH SHULRGLF LQVSHFWLRQ IRU RSHQ MRLQWVDQG FUDFNV DQG UHVHDOLQJ DV QHFHVVDU\  5DLQZDWHUFROOHFWHGE\WKHJXWWHUV\VWHPVKRXOGEHWUDQVSRUWHGE\SLSHWRDVWRUPGUDLQRUWRD SDYHGDUHD,IGRZQVSRXWVGLVFKDUJHQH[WWRWKHVWUXFWXUHRQWRIODWZRUNRUSDYHGDUHDVWKHDUHD VKRXOGEHZDWHUWLJKWLQRUGHUWRHOLPLQDWHLQILOWUDWLRQQH[WWRWKHEXLOGLQJ     5HSRUW1RCMJ ENGINEERING, INC.   $GGLWLRQDO'HVLJQ&RQVLGHUDWLRQV 7KHIROORZLQJLQIRUPDWLRQKDVEHHQDVVLPLODWHGDIWHUH[DPLQDWLRQRIQXPHURXVSURMHFWVFRQVWUXFWHG LQDFWLYHVRLOVWKURXJKRXWWKHDUHD,WLVSUHVHQWHGKHUHIRU\RXUFRQYHQLHQFH,IWKHVHIHDWXUHVDUH LQFRUSRUDWHG LQ WKH RYHUDOO GHVLJQ RI WKH SURMHFW WKH SHUIRUPDQFH RI WKH VWUXFWXUH VKRXOG EH LPSURYHG x 6SHFLDOFRQVLGHUDWLRQVKRXOGEHJLYHQWRFRPSOHWLRQLWHPVRXWVLGHWKHEXLOGLQJDUHDVXFK DV VWDLUV VLGHZDONV VLJQV HWF 7KH\ VKRXOG EH DGHTXDWHO\ GHVLJQHG WR VXVWDLQ WKH SRWHQWLDOYHUWLFDOPRYHPHQWVPHQWLRQHGLQWKHUHSRUW  x 5RRI GUDLQDJH VKRXOG EH FROOHFWHG E\ D V\VWHP RI JXWWHUV DQG GRZQVSRXWV DQG WUDQVPLWWHGDZD\IURPWKHVWUXFWXUHZKHUHWKHZDWHUFDQGUDLQDZD\ZLWKRXWHQWHULQJWKH EXLOGLQJVXEJUDGH  x 6LGHZDONVVKRXOGQRWEHVWUXFWXUDOO\FRQQHFWHGWRWKHEXLOGLQJ7KH\VKRXOGEHVORSHG DZD\IURPWKHEXLOGLQJVRWKDWZDWHUZLOOGUDLQDZD\IURPWKHVWUXFWXUH  x 7KHSDYLQJDQGWKHJHQHUDOJURXQGVXUIDFHVKRXOGEHVORSHGDZD\IURPWKHEXLOGLQJRQ DOOVLGHVVRWKDWZDWHUZLOODOZD\VGUDLQDZD\IURPWKHVWUXFWXUH:DWHUVKRXOGQRWEH DOORZHGWRSRQGQHDUWKHEXLOGLQJDIWHUWKHVODEKDVEHHQSODFHG  x 7UHHVDQGGHHSURRWHGVKUXEVVKRXOGQRWEHXVHGDVODQGVFDSLQJDURXQGWKHVWUXFWXUH SHULPHWHUDVWKHURRWV\VWHPVFDQOHDGWRGHVLFFDWLRQRIWKHVXEJUDGHVRLOV$Q\H[LVWLQJ WUHHV RU WUHHV WR EH SODQWHG VKRXOG EH DW D GLVWDQFH IURP WKH EXLOGLQJ VXFK WKDW WKH EXLOGLQJZLOOQRWIDOOZLWKLQWKHGULSOLQHRIWKHPDWXUHSODQWV XVXDOO\RQHWRRQHDQGRQH KDOIWLPHVWKHPDWXUHKHLJKWRIWKHWUHH ,IH[LVWLQJWUHHUHPRYDOLVQRWDQDFFHSWDEOH RSWLRQ D YHUWLFDO URRW EDUULHU H[WHQGLQJ WR D PLQLPXP GHSWK RI  IHHW VKRXOG EH FRQVWUXFWHGDURXQGWKHSHULPHWHURIWKHIRXQGDWLRQLQSUR[LPLW\WRWKHDUHDGHVFULEHG DERYH  x (YHU\DWWHPSWVKRXOGEHPDGHWROLPLWWKHH[WUHPHZHWWLQJRUGU\LQJRIWKHVXEVXUIDFH VRLOVVLQFHVZHOOLQJDQGVKULQNDJHZLOOUHVXOW6WDQGDUGFRQVWUXFWLRQSUDFWLFHVRISURYLGLQJ JRRGVXUIDFHZDWHUGUDLQDJHVKRXOGEHXVHG$SRVLWLYHVORSHRIWKHJURXQGDZD\IURP WKHIRXQGDWLRQVKRXOGEHSURYLGHGWRFDUU\RIIWKHUXQRIIZDWHUERWKGXULQJDQGDIWHU FRQVWUXFWLRQ  x %DFNILOOIRUXWLOLW\OLQHVRUDORQJWKHSHULPHWHUEHDPVVKRXOGFRQVLVWRIRQVLWHPDWHULDOVR WKDWWKH\ZLOOEHVWDEOH,IWKHEDFNILOOLVWRRGHQVHRUWRRGU\VZHOOLQJPD\IRUPDPRXQG DORQJWKHGLWFKOLQH,IWKHEDFNILOOLVWRRORRVHRUWRRZHWVHWWOHPHQWPD\IRUPDVLQNDORQJ WKHGLWFKOLQH(LWKHUFDVHLVXQGHVLUDEOHVLQFHVHYHUDOLQFKHVRIPRYHPHQWLVSRVVLEOH DQGIORRUFUDFNVDUHOLNHO\WRUHVXOW7KHVRLOVVKRXOGEHSURFHVVHGXVLQJWKHSUHYLRXVO\ GLVFXVVHGFRPSDFWLRQFULWHULD  x 8WLOLW\ OLQH GHWDLOV DQG IL[WXUHV PXVW FRQVLGHU WKH SRWHQWLDOIRU GLIIHUHQWLDO PRYHPHQW EHQHDWK DQ\ SLSLQJ  ,Q FRQMXQFWLRQ ZLWK D VWUXFWXUDO VODE DOOXQGHUJURXQG XWLOLW\ OLQHV VKRXOGEHLVRODWHGIURPH[SDQVLYHFOD\V$VLPLODULQFKYRLGLVUHFRPPHQGHGEHWZHHQ WKHXWLOLW\ERWWRPDQGXQGHUO\LQJFOD\VRLOV7KLVSUHYHQWVWKHXWLOLW\OLQHVIURPXSOLIWLQJLQWR WKHIORRUVODE     5HSRUW1RCMJ ENGINEERING, INC.  ($57+:25.  6LWH3UHSDUDWLRQ 7KHVXEJUDGHVKRXOGEHILUPDQGDEOHWRVXSSRUWWKHFRQVWUXFWLRQHTXLSPHQWZLWKRXWGLVSODFHPHQW 6RIWRU\LHOGLQJVXEJUDGHVKRXOGEHFRUUHFWHGDQGPDGHVWDEOHEHIRUHFRQVWUXFWLRQSURFHHGV7KH VXEJUDGHVKRXOGEHSURRIUROOHGWRGHWHFWVRIWVSRWVZKLFKLIH[LVWVKRXOGEHH[FDYDWHGWRSURYLGH D ILUP DQG RWKHUZLVH VXLWDEOH VXEJUDGH  3URRI UROOLQJ VKRXOG EH SHUIRUPHG XVLQJ D KHDY\ SQHXPDWLF WLUHG UROOHU ORDGHG GXPS WUXFN RU VLPLODU SLHFH RIHTXLSPHQW  7KH SURRI UROOLQJ RSHUDWLRQVVKRXOGEHREVHUYHGE\WKHSURMHFWJHRWHFKQLFDOHQJLQHHURUKLVKHUUHSUHVHQWDWLYH   3ODFHPHQWDQG&RPSDFWLRQ 7KHIROORZLQJUHFRPPHQGDWLRQVSHUWDLQWRJHQHUDOILOOSODFHGRQVLWH)LOOPDWHULDOSODFHGZLWKLQWKH EXLOGLQJSDGVKRXOGFRQIRUPWRWKHPRLVWXUHFRQGLWLRQLQJJXLGHOLQHVSURYLGHGLQ6HFWLRQRIWKLV UHSRUW  )LOOPDWHULDOVKRXOGEHSODFHGLQORRVHOLIWVQRWH[FHHGLQJLQFKHVLQXQFRPSDFWHGWKLFNQHVV7KH XQFRPSDFWHGOLIWWKLFNQHVVVKRXOGEHUHGXFHGWRLQFKHVIRUVWUXFWXUHEDFNILOO]RQHVUHTXLULQJ KDQGRSHUDWHGSRZHUFRPSDFWRUVRUVPDOOVHOISURSHOOHGFRPSDFWRUV7KHILOOPDWHULDOVKRXOGEH XQLIRUPZLWKUHVSHFWWRPDWHULDOW\SHDQGPRLVWXUHFRQWHQW&ORGVDQGFKXQNVRIPDWHULDOVKRXOG EHEURNHQGRZQDQGWKHILOOPDWHULDOPL[HGE\GLVNLQJEODGLQJRUSORZLQJDVQHFHVVDU\VRWKDWD PDWHULDORIXQLIRUPPRLVWXUHDQGGHQVLW\LVREWDLQHGIRUHDFKOLIW:DWHUUHTXLUHGIRUVSULQNOLQJWR EULQJWKHILOOPDWHULDOWRWKHSURSHUPRLVWXUHFRQWHQWVKRXOGEHDSSOLHGHYHQO\WKURXJKHDFKOD\HU  7KHRQVLWHVRLOVDUHVXLWDEOHIRUXVHLQVLWHJUDGLQJ,PSRUWHGJHQHUDOILOOPDWHULDOVKRXOGEHFOHDQ VRLOZLWKD/LTXLG/LPLWOHVVWKDQDQGQRURFNJUHDWHUWKDQLQFKHVLQPD[LPXPGLPHQVLRQ7KH ILOOPDWHULDOVVKRXOGEHIUHHRIYHJHWDWLRQDQGGHEULV  7KHILOOPDWHULDOVKRXOGEHFRPSDFWHGWRDGHQVLW\UDQJLQJIURPWRSHUFHQWRIPD[LPXPGU\ GHQVLW\DVGHWHUPLQHGE\$670'6WDQGDUG3URFWRU,QFRQMXQFWLRQZLWKWKHFRPSDFWLQJ RSHUDWLRQWKHILOOPDWHULDOVKRXOGEHEURXJKWWRWKHSURSHUPRLVWXUHFRQWHQW7KHPRLVWXUHFRQWHQW IRUJHQHUDOHDUWKILOOVKRXOGUDQJHIURPSHUFHQWDJHSRLQWVEHORZRSWLPXPWRSHUFHQWDJHSRLQWV DERYH RSWLPXP  WR    7KHVH UDQJHV RI PRLVWXUH FRQWHQWV DUH JLYHQ DV PD[LPXP UHFRPPHQGHGUDQJHV)RUVRPHVRLOVDQGXQGHUVRPHFRQGLWLRQVWKHFRQWUDFWRUPD\KDYHWR PDLQWDLQ D QDUURZHU UDQJH RI PRLVWXUH FRQWHQW ZLWKLQ WKH UHFRPPHQGHG UDQJH  LQ RUGHU WR FRQVLVWHQWO\DFKLHYHWKHUHFRPPHQGHGGHQVLW\    5HSRUW1RCMJ ENGINEERING, INC.  )LHOGGHQVLW\WHVWVVKRXOGEHWDNHQDVHDFKOLIWRIILOOPDWHULDOLVSODFHG$VDJXLGHRQHILHOG GHQVLW\WHVWSHUOLIWIRUHDFKVTXDUHIHHWRIFRPSDFWHGDUHDLVUHFRPPHQGHG)RUVPDOO DUHDVRUFULWLFDODUHDVWKHIUHTXHQF\RIWHVWLQJPD\QHHGWREHLQFUHDVHGWRRQHWHVWSHU VTXDUHIHHW$PLQLPXPRIWHVWVSHUOLIWVKRXOGEHUHTXLUHG7KHHDUWKZRUNRSHUDWLRQVVKRXOGEH REVHUYHGDQGWHVWHGRQDFRQWLQXLQJEDVLVE\DQH[SHULHQFHGJHRWHFKQLFLDQZRUNLQJLQFRQMXQFWLRQ ZLWKWKHSURMHFWJHRWHFKQLFDOHQJLQHHU  (DFKOLIWVKRXOGEHFRPSDFWHGWHVWHGDQGDSSURYHGEHIRUHDQRWKHUOLIWLVDGGHG7KHSXUSRVHRI WKHILHOGGHQVLW\WHVWVLVWRSURYLGHVRPHLQGLFDWLRQWKDWXQLIRUPDQGDGHTXDWHFRPSDFWLRQLVEHLQJ REWDLQHG7KHDFWXDOTXDOLW\RIWKHILOODVFRPSDFWHGVKRXOGEHWKHUHVSRQVLELOLW\RIWKHFRQWUDFWRU DQGVDWLVIDFWRU\UHVXOWVIURPWKHWHVWVVKRXOGQRWEHFRQVLGHUHGDVDJXDUDQWHHRIWKHTXDOLW\RIWKH FRQWUDFWRU VILOOLQJRSHUDWLRQV  3HUPDQHQWVORSHVDWWKHVLWHVKRXOGEHDVIODWDVSUDFWLFDOWRUHGXFHFUHHSDQGRFFXUUHQFHRI VKDOORZ VOLGHV  7KH IROORZLQJ VORSH DQJOHV DUH UHFRPPHQGHG DVPD[LPXPV  7KH SUHVHQWHG DQJOHVUHIHUWRWKHWRWDOKHLJKWRIDVORSH6LWHLPSURYHPHQWVKRXOGEHPDLQWDLQHGDZD\IURPWKH WRSRIWKHVORSHWRUHGXFHWKHSRVVLELOLW\RIGDPDJHGXHWRFUHHSRUVKDOORZVOLGHV  7$%/(0D[LPXP6ORSH$QJOHV +HLJKW IW  +RUL]RQWDOWR9HUWLFDO ±  ±  ±  !    7UHQFK%DFNILOO 7UHQFKEDFNILOOIRUSLSHOLQHVRURWKHUXWLOLWLHVVKRXOGEHSURSHUO\SODFHGDQGFRPSDFWHG2YHUO\ GHQVHRUGU\EDFNILOOFDQVZHOODQGFUHDWHDPRXQGDORQJWKHFRPSOHWHGWUHQFKOLQH/RRVHRUZHW EDFNILOOFDQVHWWOHDQGIRUPDGHSUHVVLRQDORQJWKHFRPSOHWHGWUHQFKOLQH'LVWUHVVWRRYHUO\LQJ VWUXFWXUHVSDYHPHQWVHWFLVOLNHO\LIKHDYLQJRUVHWWOHPHQWRFFXUV2QVLWHVRLOILOOPDWHULDOLV UHFRPPHQGHGIRUWUHQFKEDFNILOO&DUHVKRXOGEHWDNHQQRWWRXVHIUHHGUDLQLQJJUDQXODUPDWHULDO WRSUHYHQWWKHEDFNILOOHGWUHQFKIURPEHFRPLQJDIUHQFKGUDLQDQGSLSLQJVXUIDFHRUVXEVXUIDFH ZDWHUEHQHDWKVWUXFWXUHVSLSHOLQHVRUSDYHPHQWV,IDKLJKHUFODVVEHGGLQJPDWHULDOLVUHTXLUHG IRUWKHSLSHOLQHVDOHDQFRQFUHWHEHGGLQJZLOOOLPLWZDWHULQWUXVLRQLQWRWKHWUHQFKDQGZLOOQRW    5HSRUW1RCMJ ENGINEERING, INC.  UHTXLUHFRPSDFWLRQDIWHUSODFHPHQW7KHVRLOEDFNILOOVKRXOGEHSODFHGLQDSSUR[LPDWHO\WR LQFKORRVHOLIWV7KHGHQVLW\DQGPRLVWXUHFRQWHQWVKRXOGEHDVUHFRPPHQGHGIRUILOOLQ6HFWLRQ 3ODFHPHQWDQG&RPSDFWLRQRIWKLVUHSRUW$PLQLPXPRIRQHILHOGGHQVLW\WHVWVKRXOGEHWDNHQSHU OLIWIRUHDFKOLQHDUIHHWRIWUHQFKZLWKDPLQLPXPRIWHVWVSHUOLIW   ([FDYDWLRQ 7KHVLGHVORSHVRIH[FDYDWLRQVWKURXJKWKHRYHUEXUGHQVRLOVVKRXOGEHPDGHLQVXFKDPDQQHUWR SURYLGHIRUWKHLUVWDELOLW\GXULQJFRQVWUXFWLRQ([LVWLQJVWUXFWXUHVSLSHOLQHVRURWKHUIDFLOLWLHVZKLFK DUH FRQVWUXFWHG SULRU WR RU GXULQJ WKH FXUUHQWO\ SURSRVHG FRQVWUXFWLRQ DQG ZKLFK UHTXLUH H[FDYDWLRQVKRXOGEHSURWHFWHGIURPORVVRIHQGEHDULQJRUODWHUDOVXSSRUW  7HPSRUDU\FRQVWUXFWLRQVORSHVDQGRUSHUPDQHQWHPEDQNPHQWVORSHVVKRXOGEHSURWHFWHGIURP VXUIDFHUXQRIIZDWHU6LWHJUDGLQJVKRXOGEHGHVLJQHGWRDOORZGUDLQDJHDWSODQQHGDUHDVZKHUH HURVLRQSURWHFWLRQLVSURYLGHGLQVWHDGRIDOORZLQJVXUIDFHZDWHUWRIORZGRZQXQSURWHFWHGVORSHV  7UHQFKVDIHW\UHFRPPHQGDWLRQVDUHEH\RQGWKHVFRSHRIWKLVUHSRUW7KHFRQWUDFWRUPXVWFRPSO\ ZLWKDOODSSOLFDEOHVDIHW\UHJXODWLRQVFRQFHUQLQJWUHQFKVDIHW\DQGH[FDYDWLRQVLQFOXGLQJEXWQRW OLPLWHGWR26+$UHJXODWLRQV   $FFHSWDQFHRI,PSRUWHG)LOO $Q\VRLOLPSRUWHGIURPRIIVLWHVRXUFHVVKRXOGEHWHVWHGIRUFRPSOLDQFHZLWKWKHUHFRPPHQGDWLRQV IRU WKH SDUWLFXODU DSSOLFDWLRQ DQG DSSURYHG E\ WKH SURMHFW JHRWHFKQLFDO HQJLQHHU SULRU WR WKH PDWHULDOVEHLQJXVHG7KHRZQHUVKRXOGDOVRUHTXLUHWKHFRQWUDFWRUWRREWDLQDZULWWHQQRWDUL]HG FHUWLILFDWLRQIURPWKHODQGRZQHURIHDFKSURSRVHGRIIVLWHVRLOERUURZVRXUFHVWDWLQJWKDWWRWKHEHVW RIWKHODQGRZQHU VNQRZOHGJHDQGEHOLHIWKHUHKDVQHYHUEHHQFRQWDPLQDWLRQRIWKHERUURZVRXUFH VLWHZLWKKD]DUGRXVRUWR[LFPDWHULDOV7KHFHUWLILFDWLRQVKRXOGEHIXUQLVKHGWRWKHRZQHUSULRUWR SURFHHGLQJWRIXUQLVKVRLOVWRWKHVLWH6RLOPDWHULDOVGHULYHGIURPWKHH[FDYDWLRQRIXQGHUJURXQG SHWUROHXPVWRUDJHWDQNVVKRXOGQRWEHXVHGDVILOORQWKLVSURMHFW   6RLO&RUURVLRQ3RWHQWLDO 6SHFLILFWHVWLQJIRUVRLOFRUURVLRQSRWHQWLDOZDVQRWLQFOXGHGLQWKHVFRSHRIWKLVVWXG\+RZHYHU EDVHGXSRQSDVWH[SHULHQFHRQRWKHUSURMHFWVLQWKHYLFLQLW\WKHVRLOVDWWKLVVLWHPD\EHFRUURVLYH 6WDQGDUGFRQVWUXFWLRQSUDFWLFHVIRUSURWHFWLQJPHWDOSLSHDQGVLPLODUIDFLOLWLHVLQFRQWDFWZLWKWKHVH VRLOVVKRXOGEHXVHG    5HSRUW1RCMJ ENGINEERING, INC.   (URVLRQDQG6HGLPHQW&RQWURO $OOGLVWXUEHGDUHDVVKRXOGEHSURWHFWHGIURPHURVLRQDQGVHGLPHQWDWLRQGXULQJFRQVWUXFWLRQDQG DOOSHUPDQHQWVORSHVDQGRWKHUDUHDVVXEMHFWWRHURVLRQRUVHGLPHQWDWLRQVKRXOGEHSURYLGHGZLWK SHUPDQHQWHURVLRQDQGVHGLPHQWFRQWUROIDFLOLWLHV$OODSSOLFDEOHRUGLQDQFHVDQGFRGHVUHJDUGLQJ HURVLRQDQGVHGLPHQWFRQWUROVKRXOGEHIROORZHG  3$9(0(176  3DYHPHQW6XEJUDGH3UHSDUDWLRQ 7KHVXUILFLDOVRLOVW\SLFDOO\FRQVLVWHGRIPRGHUDWHO\WRKLJKO\DFWLYHFOD\V7KHVHFOD\VDUHVXEMHFWWR ORVVLQVXSSRUWYDOXHZLWKWKHPRLVWXUHLQFUHDVHVZKLFKRFFXUEHQHDWKSDYHPHQWVHFWLRQV7KH\UHDFW ZLWKK\GUDWHGOLPHZKLFKVHUYHVWRLPSURYHDQGPDLQWDLQWKHLUVXSSRUWYDOXH7UHDWPHQWRIWKHVH VRLOVZLWKK\GUDWHGOLPHZLOOLPSURYHWKHLUVXEJUDGHFKDUDFWHULVWLFVWRVXSSRUWDUHDSDYLQJ  /LPHWUHDWPHQWLVUHFRPPHQGHGIRUDOOVXEJUDGHDUHDVXQGHUODLQE\SODVWLFFOD\VZLWKDSODVWLFLW\ LQGH[RIW\SLFDOO\RUPRUH,QOLHXRIDOLPHVWDELOL]HGVXEJUDGHDIOH[LEOHEDVH 7['27,WHP  7\SH$*UDGHVRUPD\EHVXEVWLWXWHGRQDQHTXDOEDVLV  3ULRUWROLPHVWDELOL]DWLRQWKHVXEJUDGHVKRXOGEHSURRIUROOHGZLWKKHDY\SQHXPDWLFHTXLSPHQW$Q\ VRIWRUSXPSLQJDUHDVVKRXOGEHXQGHUFXWWRDILUPVXEJUDGHDQGSURSHUO\EDFNILOOHGDVGHVFULEHGLQ WKH6HFWLRQ(DUWKZRUN7KHVXEJUDGHVKRXOGEHVFDULILHGWRDPLQLPXPGHSWKRILQFKHVDQG XQLIRUPO\FRPSDFWHGWRDPLQLPXPRISHUFHQWRI6WDQGDUG3URFWRUGHQVLW\ $670' WRPLQXV WRSOXVSHUFHQWDJHSRLQWVRIWKHRSWLPXPPRLVWXUHFRQWHQWGHWHUPLQHGE\WKDWWHVW,WVKRXOGWKHQ EHSURWHFWHGDQGPDLQWDLQHGLQDPRLVWFRQGLWLRQXQWLOWKHSDYHPHQWLVSODFHG  :HUHFRPPHQGDPLQLPXPRISHUFHQWK\GUDWHGOLPHEHXVHGWRPRGLI\WKHFOD\VXEJUDGHVRLOV 7KHHVWLPDWHGDPRXQWRIK\GUDWHGOLPHUHTXLUHGWRVWDELOL]HWKHVXEJUDGHVKRXOGEHRQWKHRUGHURI SRXQGVSHUVTXDUH\DUGIRUDLQFKGHSWKEDVHGRQDVRLOGU\XQLWZHLJKWRISFI7KHK\GUDWHG OLPHVKRXOGEHWKRURXJKO\PL[HGDQGEOHQGHGZLWKWKHXSSHULQFKHVRIWKHFOD\VXEJUDGH 7['27 ,WHP 7KHK\GUDWHGOLPHVKRXOGPHHWWKHUHTXLUHPHQWVRI,WHPLQWKH7H[DV'HSDUWPHQW RI 7UDQVSRUWDWLRQ 7['27  6WDQGDUG 6SHFLILFDWLRQV IRU &RQVWUXFWLRQ RI +LJKZD\V 6WUHHWV DQG %ULGJHV(GLWLRQ/LPHWUHDWPHQWVKRXOGH[WHQGEH\RQGH[SRVHGSDYHPHQWHGJHVWRUHGXFH WKH HIIHFWV RI VKULQNDJH DQG DVVRFLDWHG ORVV RI VXEJUDGH VXSSRUW  &DOFDUHRXV QRGXOHV IHUURXV QRGXOHVDQGOLPHVWRQHIUDJPHQWVLQWKHVXUILFLDOFOD\VFDQFRPSOLFDWHPL[LQJRIWKHVRLODQGOLPH    5HSRUW1RCMJ ENGINEERING, INC.  :HUHFRPPHQGWKDWVXEJUDGHVWDELOL]DWLRQH[WHQGWRDWOHDVWRQHIRRWEH\RQGSDYHPHQWHGJHVWR DLGLQUHGXFLQJSDYHPHQWPRYHPHQWVDQGFUDFNLQJDORQJWKHFXUEOLQHGXHWRVHDVRQDOPRLVWXUH YDULDWLRQV DIWHU FRQVWUXFWLRQ  (DFK FRQVWUXFWLRQ DUHD VKRXOG EH VKDSHG WR DOORZ GUDLQDJH RI VXUIDFHZDWHUGXULQJHDUWKZRUNRSHUDWLRQVDQGVXUIDFHZDWHUVKRXOGEHSXPSHGLPPHGLDWHO\IURP HDFKFRQVWUXFWLRQDUHDDIWHUHDFKUDLQDQGDILUPVXEJUDGHFRQGLWLRQPDLQWDLQHG:DWHUVKRXOGQRW EHDOORZHGWRSRQGLQRUGHUWRSUHYHQWSHUFRODWLRQDQGVXEJUDGHVRIWHQLQJDQGOLPHVKRXOGEH DGGHG WR WKH VXEJUDGH DIWHU UHPRYDO RI DOO VXUIDFH YHJHWDWLRQ DQG GHEULV  6DQG VKRXOG EH VSHFLILFDOO\SURKLELWHGEHQHDWKSDYHPHQWDUHDVVLQFHWKHVHPRUHSRURXVVRLOVFDQDOORZZDWHU LQIORZUHVXOWLQJLQKHDYHDQGVWUHQJWKORVVRIVXEJUDGHVRLOV OLPHVWDELOL]HGVRLOZLOOEHDOORZHGIRU ILQHJUDGLQJ $IWHUILQHJUDGLQJHDFKDUHDLQSUHSDUDWLRQIRUSDYLQJWKHVXEJUDGHVXUIDFHVKRXOG EHOLJKWO\PRLVWHQHGDVQHHGHGDQGUHFRPSDFWHGWRREWDLQDWLJKWQRQ\LHOGLQJVXEJUDGH  6XUIDFHGUDLQDJHLVFULWLFDOWRWKHSHUIRUPDQFHRIWKLVSDYHPHQW:DWHUVKRXOGEHDOORZHGWRH[LW WKHSDYHPHQWVXUIDFHTXLFNO\$OOSDYHPHQWFRQVWUXFWLRQVKRXOGEHSHUIRUPHGLQDFFRUGDQFHZLWK WKHIROORZLQJSURFHGXUHV   3DYHPHQW6HFWLRQV 7KH SURMHFW PD\ LQFOXGH WKH FRQVWUXFWLRQ RI SDUNLQJ ORWV DQGRU GULYHV  $W WKH WLPH RI WKLV LQYHVWLJDWLRQVLWHSDYLQJSODQVRUYHKLFOHWUDIILFVWXGLHVZHUHQRWDYDLODEOH7KHUHIRUHVHYHUDOULJLG SDYHPHQWVHFWLRQVDUHSUHVHQWHGIRUD\HDUGHVLJQOLIHEDVHGRQRXUH[SHULHQFHZLWKVLPLODU IDFLOLWLHVIRU/LJKW'XW\3DUNLQJ$UHDV0HGLXP'XW\3DUNLQJ$UHDVDQG'ULYHVDQG0HGLXPWR +HDY\'XW\'ULYHV,QJHQHUDOWKHVHDUHDVDUHGHILQHGDVIROORZV  /LJKW'XW\3DUNLQJ$UHDVDUHWKRVHORWVDQGGULYHVVXEMHFWHGDOPRVWH[FOXVLYHO\WRSDVVHQJHU FDUVZLWKDQRFFDVLRQDOOLJKWWRPHGLXPGXW\WUXFN WRSHUZHHN   0HGLXP'XW\ 3DUNLQJ $UHDV DQG 'ULYHV DUH WKRVH ORWV VXEMHFWHG WR D YDULHW\ RI OLJKWGXW\ YHKLFOHVWRPHGLXPGXW\YHKLFOHVDQGDQRFFDVLRQDOKHDY\GXW\WUXFNLQFOXGLQJDQNLSILUH WUXFN WRSHUZHHN   0HGLXPWR+HDY\'XW\'ULYHVDUHWKRVHGULYHVVXEMHFWHGWRDYDULHW\RIOLJKWWRKHDY\GXW\ YHKLFOHV7KHVHSDYHPHQWVLQFOXGHDUHDVVXEMHFWWRVLJQLILFDQWWUXFNWUDIILFRUWUDVKYHKLFOHV  :HUHFRPPHQGWKDWULJLGSDYHPHQWVEHXWLOL]HGDWWKLVSURMHFWZKHQHYHUSRVVLEOHVLQFHWKH\WHQG WRSURYLGHEHWWHUORQJWHUPSHUIRUPDQFHZKHQVXEMHFWHGWRVLJQLILFDQWVORZPRYLQJDQGWXUQLQJ WUDIILF     5HSRUW1RCMJ ENGINEERING, INC.  )RU 3RUWODQG FHPHQW FRQFUHWH SDYHPHQW D PLQLPXP WKLFNQHVV RI  LQFKHV RI FRQFUHWH LV UHFRPPHQGHGIRUOLJKWGXW\SDUNLQJDUHDVLQFKHVIRUPHGLXPGXW\SDUNLQJDUHDVDQGGULYHVDQG LQFKHVIRUPHGLXPWRKHDY\GXW\GULYHV  ,IDVSKDOWLFFRQFUHWHSDYHPHQWLVXVHGZHUHFRPPHQGDIXOOGHSWKDVSKDOWLFFRQFUHWHVHFWLRQKDYLQJ DPLQLPXPWRWDOWKLFNQHVVRILQFKHVIRUOLJKWGXW\SDUNLQJDUHDV DQG LQFKHVIRU PHGLXPGXW\ SDUNLQJ DUHDV  $ PLQLPXP VXUIDFH FRXUVH WKLFNQHVV RI  LQFKHVLV UHFRPPHQGHG IRU DVSKDOWLF FRQFUHWHSDYHPHQWV  $&DOLIRUQLD%HDULQJ5DWLRRURWKHUVWUHQJWKWHVWVZHUHQRWSHUIRUPHGEHFDXVHWKH\ZHUHQRWZLWKLQ WKH VFRSH RI RXU VHUYLFHV RQ WKLV SURMHFW  $ VXEJUDGH PRGXOXVRI  SVL ZDV FRQVLGHUHG DSSURSULDWHIRUWKHQHDUVXUIDFHVRLOV,IKHDYLHUYHKLFOHVDUHSODQQHGWKHDERYHFURVVVHFWLRQV FDQ EH FRQILUPHG E\ SHUIRUPLQJ VWUHQJWK WHVWV RQ WKH VXEJUDGH PDWHULDOV RQFH WKH WUDIILF FKDUDFWHULVWLFVDUHHVWDEOLVKHG3HULRGLFPDLQWHQDQFHRISDYHPHQWVWUXFWXUHVQRUPDOO\LPSURYHV WKHGXUDELOLW\RIWKHRYHUDOOSDYHPHQWDQGHQKDQFHVLWVH[SHFWHGOLIH  7KHDERYHVHFWLRQVVKRXOGEHFRQVLGHUHGPLQLPXPSDYHPHQWWKLFNQHVVHVDQGKLJKHUWUDIILFYROXPHV DQG KHDY\ WUXFNV PD\ UHTXLUH WKLFNHU SDYHPHQW VHFWLRQV  $GGLWLRQDO UHFRPPHQGDWLRQV FDQ EH SURYLGHGDIWHUWUDIILFYROXPHVDQGORDGVDUHNQRZQ3HULRGLFPDLQWHQDQFHVKRXOGEHDQWLFLSDWHGIRU PLQLPXPSDYHPHQWWKLFNQHVV7KLVPDLQWHQDQFHVKRXOGFRQVLVWRIVHDOLQJFUDFNVDQGWLPHO\UHSDLURI LVRODWHGGLVWUHVVHGDUHDV   3DYHPHQW0DWHULDO5HTXLUHPHQWV 5HLQIRUFHG 3RUWODQG &HPHQW &RQFUHWH 5HLQIRUFHG 3RUWODQG FHPHQW FRQFUHWH SDYHPHQW VKRXOG FRQVLVWRI3RUWODQGFHPHQWFRQFUHWHKDYLQJDGD\FRPSUHVVLYHVWUHQJWKRIDWOHDVWSVL 7KH PL[ VKRXOG EH GHVLJQHG LQ DFFRUGDQFH ZLWK WKH $&, &RGH XVLQJ  WR  SHUFHQW DLU HQWUDLQPHQW  7KH SDYHPHQW VKRXOG EH DGHTXDWHO\ UHLQIRUFHG ZLWK WHPSHUDWXUH VWHHO DQG DOO FRQVWUXFWLRQMRLQWVRUH[SDQVLRQFRQWUDFWLRQMRLQWVVKRXOGEHSURYLGHGZLWKORDGWUDQVIHUGRZHOV 7KHVSDFLQJRIWKHMRLQWVZLOOGHSHQGSULPDULO\RQWKHW\SHRIVWHHOXVHGLQWKHSDYHPHQW:H UHFRPPHQGXVLQJ1RVWHHOUHEDUVSDFHGDWLQFKHVRQFHQWHULQERWKWKHORQJLWXGLQDODQG WUDQVYHUVHGLUHFWLRQ&RQWUROMRLQWVIRUPHGE\VDZLQJDUHUHFRPPHQGHGHYHU\WRIHHWLQERWK WKHORQJLWXGLQDODQGWUDQVYHUVHGLUHFWLRQ7KHFXWWLQJRIWKHMRLQWVVKRXOGEHSHUIRUPHGDVVRRQDV WKHFRQFUHWHKDV³VHWXS´HQRXJKWRDOORZIRUVDZLQJRSHUDWLRQV     5HSRUW1RCMJ ENGINEERING, INC.  +RW 0L[ $VSKDOWLF &RQFUHWH 6XUIDFH &RXUVH ,WHP  7\SH ' 7H[DV 'HSDUWPHQW RI 7UDQVSRUWDWLRQ6WDQGDUG6SHFLILFDWLRQVIRU&RQVWUXFWLRQDQG0DLQWHQDQFHRI+LJKZD\V6WUHHWV DQG%ULGJHV(GLWLRQ  +RW 0L[ $VSKDOWLF &RQFUHWH %DVH &RXUVH ,WHP  7\SH $ RU %7H[DV 'HSDUWPHQW RI 7UDQVSRUWDWLRQ6WDQGDUG6SHFLILFDWLRQVIRU&RQVWUXFWLRQDQG0DLQWHQDQFHRI+LJKZD\V6WUHHWV DQG%ULGJHV(GLWLRQ  /LPH 6WDELOL]HG 6XEJUDGH  /LPH WUHDWPHQW IRU EDVH FRXUVH URDG PL[   ,WHP  7H[DV 'HSDUWPHQW RI 7UDQVSRUWDWLRQ 6WDQGDUG 6SHFLILFDWLRQV IRU &RQVWUXFWLRQ DQG 0DLQWHQDQFH RI +LJKZD\V6WUHHWVDQG%ULGJHV(GLWLRQ  )OH[LEOH %DVH  &UXVKHG 6WRQH )OH[LEOH %DVH ± ,WHP  7\SH $ *UDGHV  RU  7H[DV 'HSDUWPHQW RI 7UDQVSRUWDWLRQ 6WDQGDUG 6SHFLILFDWLRQV IRU &RQVWUXFWLRQ RI 0DLQWHQDQFH RI +LJKZD\V6WUHHWVDQG%ULGJHV(GLWLRQ   *HQHUDO3DYHPHQW&RQVLGHUDWLRQV 7KHGHVLJQRIWKHSDYHPHQWGUDLQDJHDQGJUDGLQJVKRXOGFRQVLGHUWKHSRWHQWLDOIRUGLIIHUHQWLDO JURXQGPRYHPHQWGXHWRIXWXUHVRLOVZHOOLQJRIXSWRòLQFKHV,QRUGHUWRPLQLPL]HUDLQZDWHU LQILOWUDWLRQWKURXJKWKHSDYHPHQWVXUIDFHDQGWKHUHE\PLQLPL]LQJIXWXUHXSZDUGPRYHPHQWRIWKH SDYHPHQWVODEVDOOFUDFNVDQGMRLQWVLQWKHSDYHPHQWVKRXOGEHVHDOHGRQDURXWLQHEDVLVDIWHU FRQVWUXFWLRQ  3RWHQWLDOGLIIHUHQWLDOJURXQGPRYHPHQWFDQEHUHGXFHGDVGLVFXVVHGLQ6HFWLRQ6KRXOGDQ LQWHUPHGLDWH OHYHO RI PRYHPHQW UHGXFWLRQ EH GHVLUHG FRQWDFW WKLV RIILFH IRU DGGLWLRQDO UHFRPPHQGDWLRQV  &216758&7,212%6(59$7,216 ,QDQ\JHRWHFKQLFDOLQYHVWLJDWLRQWKHGHVLJQUHFRPPHQGDWLRQVDUHEDVHGRQDOLPLWHGDPRXQWRI LQIRUPDWLRQ DERXW WKH VXEVXUIDFH FRQGLWLRQV  ,Q WKH DQDO\VLVWKH JHRWHFKQLFDO HQJLQHHU PXVW DVVXPH WKH VXEVXUIDFH FRQGLWLRQV DUH VLPLODU WR WKH FRQGLWLRQVHQFRXQWHUHG LQ WKH ERULQJV +RZHYHU TXLWH RIWHQ GXULQJ FRQVWUXFWLRQ DQRPDOLHV LQ WKH VXEVXUIDFH FRQGLWLRQV DUH UHYHDOHG 7KHUHIRUHLWLVUHFRPPHQGHGWKDW&0-(QJLQHHULQJ,QFEHUHWDLQHGWRREVHUYHHDUWKZRUNDQG IRXQGDWLRQ LQVWDOODWLRQ DQG SHUIRUP PDWHULDOV HYDOXDWLRQ GXULQJ WKH FRQVWUXFWLRQ SKDVH RI WKH    5HSRUW1RCMJ ENGINEERING, INC.  SURMHFW7KLVHQDEOHVWKHJHRWHFKQLFDOHQJLQHHUWRVWD\DEUHDVWRIWKHSURMHFWDQGWREHUHDGLO\ DYDLODEOHWRHYDOXDWHXQDQWLFLSDWHGFRQGLWLRQVWRFRQGXFWDGGLWLRQDOWHVWVLIUHTXLUHGDQGZKHQ QHFHVVDU\ WR UHFRPPHQG DOWHUQDWLYH VROXWLRQV WR XQDQWLFLSDWHGFRQGLWLRQV  8QWLO WKHVH FRQVWUXFWLRQ SKDVH VHUYLFHV DUH SHUIRUPHG E\ WKH SURMHFW JHRWHFKQLFDO HQJLQHHU WKH UHFRPPHQGDWLRQVFRQWDLQHGLQWKLVUHSRUWRQVXFKLWHPVDVILQDOIRXQGDWLRQEHDULQJHOHYDWLRQV SURSHU VRLO PRLVWXUH FRQGLWLRQ DQG RWKHU VXFK VXEVXUIDFH UHODWHG UHFRPPHQGDWLRQV VKRXOG EH FRQVLGHUHGDVSUHOLPLQDU\  ,WLVSURSRVHGWKDWFRQVWUXFWLRQSKDVHREVHUYDWLRQDQGPDWHULDOVWHVWLQJFRPPHQFHE\WKHSURMHFW JHRWHFKQLFDOHQJLQHHUDWWKHRXWVHWRIWKHSURMHFW([SHULHQFHKDVVKRZQWKDWWKHPRVWVXLWDEOH PHWKRGIRUSURFXULQJWKHVHVHUYLFHVLVIRUWKHRZQHURUWKHRZQHU VGHVLJQHQJLQHHUVWRFRQWUDFW GLUHFWO\ZLWKWKHSURMHFWJHRWHFKQLFDOHQJLQHHU7KLVUHVXOWVLQDFOHDUGLUHFWOLQHRIFRPPXQLFDWLRQ EHWZHHQWKHRZQHUDQGWKHRZQHU VGHVLJQHQJLQHHUVDQGWKHJHRWHFKQLFDOHQJLQHHU   5(3257&/2685( 7KHERULQJORJVVKRZQLQWKLVUHSRUWFRQWDLQLQIRUPDWLRQUHODWHGWRWKHW\SHVRIVRLOHQFRXQWHUHGDW VSHFLILFORFDWLRQVDQGWLPHVDQGVKRZOLQHVGHOLQHDWLQJWKHLQWHUIDFHEHWZHHQWKHVHPDWHULDOV7KH ORJVDOVRFRQWDLQRXUILHOGUHSUHVHQWDWLYH VLQWHUSUHWDWLRQRIFRQGLWLRQVWKDWDUHEHOLHYHGWRH[LVWLQ WKRVHGHSWKLQWHUYDOVEHWZHHQWKHDFWXDOVDPSOHVWDNHQ7KHUHIRUHWKHVHERULQJORJVFRQWDLQERWK IDFWXDODQGLQWHUSUHWLYHLQIRUPDWLRQ/DERUDWRU\VRLOFODVVLILFDWLRQWHVWVZHUHDOVRSHUIRUPHGRQ VDPSOHVIURPVHOHFWHGGHSWKVLQWKHERULQJV7KHUHVXOWVRIWKHVHWHVWVDORQJZLWKYLVXDOPDQXDO SURFHGXUHVZHUHXVHGWRJHQHUDOO\FODVVLI\HDFKVWUDWXP7KHUHIRUHLWVKRXOGEHXQGHUVWRRGWKDW WKHFODVVLILFDWLRQGDWDRQWKHORJVRIERULQJVUHSUHVHQWYLVXDOHVWLPDWHVRIFODVVLILFDWLRQVIRUWKRVH SRUWLRQVRIHDFKVWUDWXPRQZKLFKWKHIXOOUDQJHRIODERUDWRU\VRLOFODVVLILFDWLRQWHVWVZHUHQRW SHUIRUPHG,WLVQRWLPSOLHGWKDWWKHVHORJVDUHUHSUHVHQWDWLYHRIVXEVXUIDFHFRQGLWLRQVDWRWKHU ORFDWLRQVDQGWLPHV  :LWKUHJDUGWRJURXQGZDWHUFRQGLWLRQVWKLVUHSRUWSUHVHQWVGDWDRQJURXQGZDWHUOHYHOVDVWKH\ ZHUHREVHUYHGGXULQJWKHFRXUVHRIWKHILHOGZRUN,QSDUWLFXODUZDWHUOHYHOUHDGLQJVKDYHEHHQ PDGHLQWKHERULQJVDWWKHWLPHVDQGXQGHUFRQGLWLRQVVWDWHGLQWKHWH[WRIWKHUHSRUWDQGRQWKH ERULQJORJV,WVKRXOGEHQRWHGWKDWIOXFWXDWLRQVLQWKHOHYHORIWKHJURXQGZDWHUWDEOHFDQRFFXU ZLWKSDVVDJHRIWLPHGXHWRYDULDWLRQVLQUDLQIDOOWHPSHUDWXUHDQGRWKHUIDFWRUV$OVRWKLVUHSRUW GRHVQRWLQFOXGHTXDQWLWDWLYHLQIRUPDWLRQRQUDWHVRIIORZRIJURXQGZDWHULQWRH[FDYDWLRQVRQ SXPSLQJ FDSDFLWLHV QHFHVVDU\ WR GHZDWHU WKH H[FDYDWLRQV RU RQPHWKRGV RI GHZDWHULQJ    5HSRUW1RCMJ ENGINEERING, INC.  H[FDYDWLRQV8QDQWLFLSDWHGVRLOFRQGLWLRQVDWDFRQVWUXFWLRQVLWHDUHFRPPRQO\HQFRXQWHUHGDQG FDQQRW EH IXOO\ SUHGLFWHG E\ PHUH VRLO VDPSOHV WHVW ERULQJV RU WHVW SLWV  6XFK XQH[SHFWHG FRQGLWLRQVIUHTXHQWO\UHTXLUHWKDWDGGLWLRQDOH[SHQGLWXUHVEHPDGHE\WKHRZQHUWRDWWDLQDSURSHUO\ GHVLJQHG DQG FRQVWUXFWHG SURMHFW  7KHUHIRUH SURYLVLRQ IRU VRPH FRQWLQJHQF\ IXQG LV UHFRPPHQGHGWRDFFRPPRGDWHVXFKSRWHQWLDOH[WUDFRVW  7KH DQDO\VHV FRQFOXVLRQV DQG UHFRPPHQGDWLRQV FRQWDLQHG LQ WKLV UHSRUW DUH EDVHG RQ VLWH FRQGLWLRQVDVWKH\H[LVWHGDWWKHWLPHRIRXUILHOGLQYHVWLJDWLRQDQGIXUWKHURQWKHDVVXPSWLRQWKDW WKHH[SORUDWRU\ERULQJVDUHUHSUHVHQWDWLYHRIWKHVXEVXUIDFHFRQGLWLRQVWKURXJKRXWWKHVLWHWKDWLV WKHVXEVXUIDFHFRQGLWLRQVHYHU\ZKHUHDUHQRWVLJQLILFDQWO\GLIIHUHQWIURPWKRVHGLVFORVHGE\WKH ERULQJVDWWKHWLPHWKH\ZHUHFRPSOHWHG,IGXULQJFRQVWUXFWLRQGLIIHUHQWVXEVXUIDFHFRQGLWLRQV IURPWKRVHHQFRXQWHUHGLQRXUERULQJVDUHREVHUYHGRUDSSHDUWREHSUHVHQWLQH[FDYDWLRQVZH PXVW EH DGYLVHG SURPSWO\ VR WKDW ZH FDQ UHYLHZ WKHVH FRQGLWLRQV DQG UHFRQVLGHU RXU UHFRPPHQGDWLRQVZKHUHQHFHVVDU\,IWKHUHLVDVXEVWDQWLDOODSVHRIWLPHEHWZHHQVXEPLVVLRQRI WKLVUHSRUWDQGWKHVWDUWRIWKHZRUNDWWKHVLWHLIFRQGLWLRQVKDYHFKDQJHGGXHHLWKHUWRQDWXUDO FDXVHVRUWRFRQVWUXFWLRQRSHUDWLRQVDWRUDGMDFHQWWRWKHVLWHRULIVWUXFWXUHORFDWLRQVVWUXFWXUDO ORDGVRUILQLVKJUDGHVDUHFKDQJHGZHXUJHWKDWZHEHSURPSWO\LQIRUPHGDQGUHWDLQHGWRUHYLHZ RXUUHSRUWWRGHWHUPLQHWKHDSSOLFDELOLW\RIWKHFRQFOXVLRQVDQGUHFRPPHQGDWLRQVFRQVLGHULQJWKH FKDQJHGFRQGLWLRQVDQGRUWLPHODSVH  )XUWKHULWLVXUJHGWKDW&0-(QJLQHHULQJ,QFEHUHWDLQHGWRUHYLHZWKRVHSRUWLRQVRIWKHSODQVDQG VSHFLILFDWLRQVIRUWKLVSDUWLFXODUSURMHFWWKDWSHUWDLQWRHDUWKZRUNDQGIRXQGDWLRQVDVDPHDQVWR GHWHUPLQH ZKHWKHU WKH SODQV DQG VSHFLILFDWLRQV DUH FRQVLVWHQW ZLWK WKH UHFRPPHQGDWLRQV FRQWDLQHG LQ WKLV UHSRUW  ,Q DGGLWLRQ ZH DUH DYDLODEOH WR REVHUYH FRQVWUXFWLRQSDUWLFXODUO\WKH FRPSDFWLRQRIVWUXFWXUDOILOORUEDFNILOODQGWKHFRQVWUXFWLRQRIIRXQGDWLRQVDVUHFRPPHQGHGLQWKH UHSRUWDQGVXFKRWKHUILHOGREVHUYDWLRQVDVPLJKWEHQHFHVVDU\  7KHVFRSHRIRXUVHUYLFHVGLGQRWLQFOXGHDQ\HQYLURQPHQWDODVVHVVPHQWRULQYHVWLJDWLRQIRUWKH SUHVHQFHRUDEVHQFHRIZHWODQGVRUKD]DUGRXVRUWR[LFPDWHULDOVLQWKHVRLOVXUIDFHZDWHUJURXQG ZDWHURUDLURQRUEHORZRUDURXQGWKHVLWH  7KLV UHSRUW KDV EHHQ SUHSDUHG IRU XVH LQ GHYHORSLQJ DQ RYHUDOOGHVLJQ FRQFHSW  3DUDJUDSKV VWDWHPHQWVWHVWUHVXOWVERULQJORJVGLDJUDPVHWFVKRXOGQRWEHWDNHQRXWRIFRQWH[WQRUXWLOL]HG ZLWKRXWDNQRZOHGJHDQGDZDUHQHVVRIWKHLULQWHQWZLWKLQWKHRYHUDOOFRQFHSWRIWKLVUHSRUW7KH UHSURGXFWLRQRIWKLVUHSRUWRUDQ\SDUWWKHUHRIVXSSOLHGWRSHUVRQVRWKHUWKDQWKHRZQHUVKRXOG    5HSRUW1RCMJ ENGINEERING, INC.  LQGLFDWHWKDWWKLVVWXG\ZDVPDGHIRUGHVLJQSXUSRVHVRQO\DQGWKDWYHULILFDWLRQRIWKHVXEVXUIDFH FRQGLWLRQVIRUSXUSRVHVRIGHWHUPLQLQJGLIILFXOW\RIH[FDYDWLRQWUDIILFDELOLW\HWFDUHUHVSRQVLELOLWLHV RIWKHFRQWUDFWRU  7KLVUHSRUWKDVEHHQSUHSDUHGIRUWKHH[FOXVLYHXVHRI%DLUG+DPSWRQ %URZQ,QFIRUVSHFLILF DSSOLFDWLRQWRGHVLJQRIWKLVSURMHFW7KHRQO\ZDUUDQW\PDGHE\XVLQFRQQHFWLRQZLWKWKHVHUYLFHV SURYLGHG LV WKDW ZH KDYH XVHG WKDW GHJUHH RI FDUH DQG VNLOO RUGLQDULO\ H[HUFLVHG XQGHU VLPLODU FRQGLWLRQVE\UHSXWDEOHPHPEHUVRIRXUSURIHVVLRQSUDFWLFLQJLQWKHVDPHRUVLPLODUORFDOLW\1R RWKHUZDUUDQW\H[SUHVVHGRULPSOLHGLVPDGHRULQWHQGHG      � ` , � s, � � I� � � ,�.�g � , .• �� r ' ; -:. i -:,�.� � �+ t ��, �� � � � R y r . ' . + � j �,.,� . �. , r r —..�." � � � . . � � A . 1 �• '� � ' �"� .,-, i yi �.' ^ � � r � � i '� � � �� ' � �:� - i:� i � y � - r + � � _�� � �� , � 1 I� � � I � � '� � , w �� t � �; ��� � - , . � �,� � � �.._ 1 ��:. '�'�`�� ' �� �i � �� 1 � � .' � '� � ,� +i �"'L a ' , � ,,•�:.' � � �:.�.�i�'�' `-'" -�� --.�.�, - �- y=-.- rrth� -_ *�r -* � ► .�.�� � �., ,. �.. ' �4„ frt--� I ' .. � � � 4 , ' �� � . �� �-.: . • � +7. Lf,�� • �# . �' ' � �, w . ! i� , �: : ' �•�:,:',� -•. :� i ' ? {� � n � � '—_ � I � I� �_��'�_ ru.iiaF __ __"_"_'____- --___ -_—__ _ _— I ��,,youmas.w ' s� ���� i r ir ' - �I L"-'�/qeu�u.ion " i � Gni � � I I � I _ . � i� � � '-�_� 2 �^� � I � � ll I ' ___' ___ ""___ ___ � � I � I � �L 1I iI , /�� I :I� r ' �MC tHd � �� I�� / � I . I '� � i0 "" j L""". JI � / -_ "� F'__- __ i F_'_� 2Hc 8�900 8,019 S:.� T. zHC — _ E �� I;��E,�,�. I � i _ I__ _ '_ _"" _ • _ _- SQ.FT. p �' '� . t2 :; �2 �, tR 14 aa < �s� I�� I I> , I_' '_"" _" —i C I oan� 2hC �' I i � I Ib I� I I' `-- '`--i � n X\ � � I I� I rl E.�E.�.J � z � JI I I 5'/ R4 HCLAR— _�_ I� � / tC � I6 I I I I i I I , : I I _ _ 5 _ I � :� �I �_ �'',,i0'�._ �`.i .i_ : �`y 6ATE -I I 1 I I I I I-I I 1..._ _I � `i�_ � � I � ' I — \�I I� ___ _ k - - . e�aeeuwz - I . 6�� , , � --------=- ==----_=�— _-,. . -- ---, — - ----- ----- ---�� . .. ` � � . I , ' �_, - , , ,• ,1 . � . �r �i �'41� .. � ,1 [- I �4 'S� > ��' ' . . ,, �'yl. a'_�� � S . � . . f .F T'� � . !. ; 1'� _ •I �� � - 1 • '� �� }. � ' . _ _ _ � " + � +�r� - ' � ti� '' �4 Yy•_ °'a:.-Fi � ' � .;,.��" +i , �7 �� •:`� �.:9-_„ . .d� � ��a � / ,S .� r�•} : ' K_ d •+F S. ':,i'". •�, i , - . 'j �3_ � a rf -. . - Y. - .� �;�` • . ' �'r7"� u��',. .t ` t+ - . ♦�-. +:r. ��'�,. .� • :; i � '' : , . s � ; _ r . � .�{, r,,..��.� ., :�:; : ,;.: •. t.. . . ' �1 i . r ' i _ a ` ��l _.7 . ' i�. � . . . , l � - : _t, , � ! : .- , , � 4,{+'�•�•. ., �:� . , . . �r .,'�; �r - . _�. � r'�;#r ��- ' "'��,r' ' F.. { , ', 'f�` . . . w • i� -_ t . r,�,,y'. ' �. :�'�,• . •'�� � ' .;�y;. . ,:..5 •�fl _ �.^.w'•_, • ''�' F� � .tii'. . • . . , .i��'� :.�� � . � -'+y,ti ..�. -i.��.r " • 3ti' - ; • -� '-.Yv'� `� = r .. • + "��'_ -. . +�iv��,s' -' � �,���.. _',� : .,"�� . �. �; . , : . . , 1 r � � -..s�tr'.. ., ,:.�y, .. _ �"°- . _'z �s��� � '�:+- 4•,� f -�s�r'+ ;-'� : �' .Ni.•� ����•+��•f r .��(� 'L' � ��i' �� . � �r . •. . . . � - M1''�. t • � , . . . - r.a� .� �•ri�-�.x{�f11R,.C:....i.li._�• � �s' .• ^ �;�s� • F f�.f�i . �r" r -� �w y ' •s� • _ i � : . F *. .�.��� . - - .0 r * - � i . '� . . � 'l . �f - . ': �' s '� � Fy � �Yw a ,J � •{' , • ' . l _ • ��� . a�f .* • 1{� _. �- • '' i il�l .�i.i, �� .��a"�; � �.-_ -- - . �r•r-ti ' �: f� [� 1 I .`. 1' \ I �� 1� �' h � �:. .�•4� ' •T� A , �� U Z � Z W WI-� L-I � z w F� � �./ � � 0 0 z U W 7 0 � 7 � U W � � � � C� O � cn U Q � ��/� o� � / � � � m Q � � �WW� O ��� z ��W Q v�� � w � � O � PLATE A•� Fine-grained soils (More than half of material is smaller than No. 200 sieve)Sands (More than half of coarse fraction is smaller than No. 4 sieve size)Gravels (More than half of coarse fraction is larger than No. 4 sieve size)Sands with fines (Appreciable amount of fines)Clean sands (Little or no fines)Gravels with fines (Appreciable amount of fines)Clean gravels (Little or no fines)Pt OH CH MH OL CL ML SC SM SP SW GC GM GP GW Grp. Sym. Peat and other highly organic soils Organic clays of medium to high plasticity, organic silts Inorganic clays of high plasticity, fat clays Inorganic silts, micaceous or diatomaceous fine sandy or silty soils, elastic silts Organic silts and organic silty clays of low plasticity Inorganic clays of low to medium plasticity, gravelly clays, sandy clays, silty clays, and lean clays Inorganic silts and very fine sands, rock flour, silty or clayey fine sands, or clayey silts with slight plasticity Clayey sands, sand-clay mixtures Silty sands, sand-silt mixtures Poorly graded sands; gravelly sands, little or no fines Well-graded sands, gravelly sands, little or no fines Clayey gravels, gravel-sand- clay mixtures Silty gravels, gravel-sand-silt mixtures Poorly graded gravels, gravel- sand mixtures, little or no fines Well-graded gravels, gravel- sand mixtures, little or no fines Typical Names Determine percentages of sand and gravel from grain size curve. Less than 5 percent.....................................................GW, GP, SW, SP More than 12 percent....................................................GM, GC, SM, SC 5 to 12 percent...........................Borderline cases requiring dual symbolsLiquid and Plastic limits above "A" line with P.I. greater than 7 Liquid and Plastic limits below "A" line or P.I. less than 4 Not meeting all gradation Liquid and Plastic limits above "A" line with P.I. greater than 7 Liquid and Plastic limits below "A" line or P.I. greater than 4 Not meeting all gradation PLATE A.2 requirements for SW requirements for GW UNIFIED SOIL CLASSIFICATION SYSTEMCoarse-grained soils (more than half of the material is larger than No. 200 sieve size)Depending on percentage of fines (fraction smaller than No. 200 sieve size), coarse-grained soils are classified as follows:Laboratory Classification Criteria Highly Organic soilsSilts and clays (Liquid limit greater than 50)Silts and clays (Liquid limit less than 50)Liquid and plastic limits plotting between 4 and 7 are borderline cases requiring use of dual symbols Liquid and plastic limits plotting in hatched zone between 4 and 7 are borderline cases requiring use of dual symbols Major Divisions 0 10 20 30 40 50 60 70 80 90 1000 10 20 30 40 50 60 CL-ML4 7 CL CH OH and MH ML and OL Liquid Limit Plasticity ChartPlasticity IndexCu= ----- D60 D10 greater than 6:CC= -------------- (D30)2 D10 x D60 between 1 and 3 Cu= ----- D60 D10 greater than 4:CC= -------------- (D30)2 D10 x D60 between 1 and 3 SOIL OR ROCK TYPES GRAVEL LEAN CLAY LIMESTONE SAND SANDY SHALE SILT SILTY SANDSTONE HIGHLY PLASTIC CLAY CLAYEY CONGLOMERATE Shelby Tube Auger Split Spoon Rock Core Cone Pen No Recovery TERMS DESCRIBING CONSISTENCY, CONDITION, AND STRUCTURE OF SOIL Fine Grained Soils (More than 50% Passing No. 200 Sieve) Descriptive Item Penetrometer Reading, (tsf) Soft 0.0 to 1.0 Firm 1.0 to 1.5 Stiff 1.5 to 3.0 Very Stiff 3.0 to 4.5 Hard 4.5+ Coarse Grained Soils (More than 50% Retained on No. 200 Sieve) Penetration Resistance Descriptive Item Relative Density (blows/foot) 0 to 4 Very Loose 0 to 20% 4 to 10 Loose 20 to 40% 10 to 30 Medium Dense 40 to 70% 30 to 50 Dense 70 to 90% Over 50 Very Dense 90 to 100% Soil Structure Calcareous Contains appreciable deposits of calcium carbonate; generally nodular Slickensided Having inclined planes of weakness that are slick and glossy in appearance Laminated Composed of thin layers of varying color or texture Fissured Containing cracks, sometimes filled with fine sand or silt Interbedded Composed of alternate layers of different soil types, usually in approximately equal proportions TERMS DESCRIBING PHYSICAL PROPERTIES OF ROCK Hardness and Degree of Cementation Very Soft or Plastic Can be remolded in hand; corresponds in consistency up to very stiff in soils Soft Can be scratched with fingernail Moderately Hard Can be scratched easily with knife; cannot be scratched with fingernail Hard Difficult to scratch with knife Very Hard Cannot be scratched with knife Poorly Cemented or Friable Easily crumbled Cemented Bound together by chemically precipitated material; Quartz, calcite, dolomite, siderite, and iron oxide are common cementing materials. Degree of Weathering Unweathered Rock in its natural state before being exposed to atmospheric agents Slightly Weathered Noted predominantly by color change with no disintegrated zones Weathered Complete color change with zones of slightly decomposed rock Extremely Weathered Complete color change with consistency, texture, and general appearance approaching soil KEY TO CLASSIFICATION AND SYMBOLS PLATE A.3                                           !"#$ %!&#$'&#()# *)++ ,+- ,++ ,+ (, () (* (* ,( )-,..+ */)0 */)0 -/+ -/) -/.) */+ ,++ ,/)1 ,++ ,/()1 ,++ +/)1 ,++ +/)1 " !"!/ 23!/ 23 45 '5 45 '      ! "!#$% &2 627$'($'))'(%*+,-)'')$'($ ./01  ) ,+ ,) (+ () $  2 8'7  /2   #/9//2 !(++9 7:   45 2  9;// $47 !/  %4  7 ,*+'-'  <   #5959'5/9$  ;7: '<// 4//2.33 034 " !",,+=,>=,,-/"2?4%?/"'#> ,( ,>                           5                  !"#$ %!&#$'&#()# ,+* >@ (+ ,> (+ (- (+ ,> ,) ),,@A> */)0 */)0 */)0 */+ -/) -/) */+ ,++ (/.)1 ,++ +/.)1 ,++ +/.)1 " !"!/ .23!/ 23 45 '5 45 '  /    ! "!#$% &2 627$'($'))'(%*+,-)'')$'($ ./01 . ) ,+ ,) (+ () $  2 8'7  /2   #/9//2 !(++9 7:   45 2  9;// $47 !/  %4  7 ,*+'-'  <   #5959'5/9$  ;7: '<// 4//2.33 034 " !",,+=,>=,,-/"2?4%?/"'#> ,( ,>             5                  !"#$ %!&#$'&#()# >+++,++ ,,( ,,( (+ (, (, (+ ,@ ,@ ,. *+,()( */)0 */)0 -/.) (/) -/.) -/) */+ ,++ ,/()1 ,++ ,1 ,++ +/.)1 " !"!/ 423!/ 23 45 '5 45 '  5    ! "!#$% &2 627$'($'))'(%*+,-)'')$'($ ./01 4 ) ,+ ,) (+ () $  2 8'7  /2   #/9//2 !(++9 7:   45 2  9;// $47 !/  %4  7 ,*+'-'  <   #5959'5/9$  ;7: '<// 4//2.33 034 " !",,+=,>=,,-/"2?4%?/"'#> ,( ,>                 5  !"#$ %!&#$'&#)# ,,@++ ,+) ,,> ,A ,. ,* ,, ,, *+,@)@ */)0 */)0 */)0 */)0 */)0 " !"!/ 23!/ 23 45 '5 45 '  2    ! "!#$% &2 627$'($'))'(%*+,-)'!'( /01  ) $  2 8'7  /2   #/9//2 !(++9 7:   45 2  9;// $47 !/  %4  7 ,*+'-'  <   #5959'5/9$  ;7: '<// 4//2.33 034 " !",,+=,>=,,-/"2?4%?/"'#> ,( ,>      5         !"#$ %!&#$'&#)# ,,, ,A ,A ,) ,- ,( (),,-A */)0 */)0 */)0 */)0 */)0 " !"!/ /23!/ 23 45 '5 45 '  6    ! "!#$% &2 627$'($'))'(%*+,-)' !'( /01 / ) $  2 8'7  /2   #/9//2 !(++9 7:   45 2  9;// $47 !/  %4  7 ,*+'-'  <   #5959'5/9$  ;7: '<// 4//2.33 034 " !",,+=,>=,,-/"2?4%?/"'#> ,( ,> 789 *        5       !"#$ %!&#$'&#)# @+++,,* (( ,A ,) ,. ,* (*,*-@ */+ */)0 */)0 */)0 */)0 " !"!/ 523!/ 23 45 '5 45 '  3    ! "!#$% &2 627$'($'))'(%*+,-)' !: + /01 5 ) $  2 8'7  /2   #/9//2 !(++9 7:   45 2  9;// $47 !/  %4  7 ,*+'-'  <   #5959'5/9$  ;7: '<// 4//2.33 034 " !",,+=,>=,,-/"2?4%?/"'#> ,( ,> CMJ ENGINEERING, INC. )5((6:(//7(675(68/76 3URMHFW 3DUNHU&RXQW\(DVW6XE&RXUWKRXVH :HDWKHUIRUG7H[DV 3URMHFW1R  %RULQJ 1R 'HSWK ,QWHUYDO IW  6DPSOH 'HVFULSWLRQ /LTXLG /LPLW // 3ODVWLF /LPLW 3/ 3ODVWLFLW\ ,QGH[ 3, 0RLVWXUH &RQWHQW3HUFHQW 6ZHOO  ,QLWLDO)LQDO %± ± &OD\       %± ± &OD\       %± ± &OD\       )UHHVZHOOWHVWVSHUIRUPHGDWDSSUR[LPDWHRYHUEXUGHQSUHVVXUH $WWHUEHUJ/LPLWWHVWVPD\KDYHEHHQSHUIRUPHGRQDGMDFHQWVDPSOHV 3/$7($ CITY OF FORT WORTH East Parker County Subcourthouse Water & Sewer Main Extensions STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS City Project No. 102824 Revised July 1, 2011 GR-01 06 00 Product Requirements CITY OF FORT WORTH WATER DEPARTMENT STANDARD PRODUCT LIST Updated: October 21, 2020 The Fort Worth Water Department’s Standard Products List has been developed to minimize the submittal review of products which meet the Fort Worth Water Department’s Standard Specifications during utility construction projects. When Technical Specifications for specific products, are included as part of the Construction Contract Documents, the requirements of the Technical Specification will override the Fort Worth Water Department’s Standard Specifications and the Fort Worth Water Department’s Standard Products List and approval of the specific products will be based on the requirements of the Technical Specification whether or not the specific product meets the Fort Worth Water Department’s Standard Specifications or is on the Fort Worth Water Department’s Standard Products List. Table of Content (Click on items to go directly to the page) Items Page A.Water & Sewer 1. Manholes & Bases/Components ........................................................... 1 2.Manholes & Bases/Fiberglass ............................................................... 2 3.Manholes & Bases/Frames & Covers/Rectangular ............................... 3 4.Manholes & Bases/Frames & Covers/Round ....................................... 4 5.Manholes & Bases/Frames & Covers/Water Tight & Pressure Tight .. 5 6.Manholes & Bases/Precast Concrete .................................................... 6 7.Manholes & Bases/Rehab Systems/Cementitious ................................ 7 8.Manholes & Bases/Rehab Systems/NonCementitious ......................... 8 9.Manhole Insert (Field Operations Use Only) ........................................ 9 10. Pipe Casing Spacer ............................................................................... 10 11. Pipes/Ductile Iron ................................................................................. 11 12. Utility Line Marker ............................................................................... 12 B.Sewer 13. Coatings/Epoxy ..................................................................................... 13 14. Coatings/Polyurethane .......................................................................... 14 15. Combination Air Valves ....................................................................... 15 16. Pipes/Concrete ...................................................................................... 16 17. Pipe Enlargement System (Method) ..................................................... 17 18. Pipes/Fiberglass Reinforced Pipe ......................................................... 18 19. Pipes/HDPE .......................................................................................... 19 20. Pipes/PVC (Pressure Sewer) ................................................................. 20 21. Pipes/PVC* ........................................................................................... 21 22. Pipes/Rehab/CIPP ................................................................................. 22 23. Pipes/Rehab/Fold & Form .................................................................... 23 24. Pipes/Open Profile Large Diameter ...................................................... 24 C.Water 25. Appurtenances ....................................................................................... 25 26. Bolts, Nuts, and Gaskets ....................................................................... 26 27. Combination Air Release Valve ........................................................... 27 28. Dry Barrel Fire Hydrants ...................................................................... 28 29. Meters ................................................................................................... 29 30. Pipes/PVC (Pressure Water) ................................................................. 30 31. Pipes/Valves & Fittings/Ductile Iron Fittings ....................................... 31 32. Pipes/Valves & Fittings/Resilient Seated Gate Valve .......................... 32 33. Pipes/Valves & Fittings/Rubber Seated Butterfly Valve ...................... 33 34. Polyethylene Encasement ..................................................................... 34 35. Sampling Stations ................................................................................. 35 36. Automatic Flusher ................................................................................. 36 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeWater & Sewer - Manholes & Bases/Components 33-39-10 (Rev 2/3/16)07/23/97 33 05 13 Urethane Hydrophilic WaterstopAsahi Kogyo K.K.Adeka Ultra-Seal P-201ASTM D2240/D412/D79204/26/00 33 05 13 Offset Joint for 4' Diam. MHHanson Concrete ProductsDrawing No. 35-0048-00104/26/00 33 05 13 Profile Gasket for 4' Diam. MH.Press-Seal Gasket Corp.250-4G GasketASTM C-443/C-361SS MH1/26/99 33 05 13 HDPE Manhole Adjustment RingsLadtech, IncHDPE Adjustment RingNon-traffic area5/13/05 33 05 13 Manhole External WrapCanusa - CPSWrapidSeal Manhole Encapsulation SystemCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.* From Original Standard Products ListClick to Return to the Table of Content1Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Water & Sewer - Manholes & Bases/Fiberglass 33-39-13 (1/8/13)1/26/99 33 39 13 Fiberglass ManholeFluid Containment, Inc.FlowtiteASTM 3753Non-traffic area08/30/06 33 39 13 Fiberglass ManholeL.F. ManufacturingNon-traffic area* From Original Standard Products ListClick to Return to the Table of Content2Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Water & Sewer - Manholes & Bases/Frames & Covers/Rectangular 33-05-13 (Rev 2/3/16)*33 05 13 Manhole Frames and CoversWestern Iron Works, Bass & Hays Foundry100124"x40" WD* From Original Standard Products ListClick to Return to the Table of Content3Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Water & Sewer - Manholes & Bases/Frames & Covers/Standard (Round) 33-05-13 (Rev 2/3/16)*33 05 13 Manhole Frames and CoversWestern Iron Works, Bass & Hays Foundry3002424" Dia.*33 05 13 Manhole Frames and CoversMcKinley Iron Works Inc.A 24 AM24" Dia.08/24/18 33 05 13 Manhole Frames and CoversNeenah FoundryR-1272ASTM A48 & AASHTO M30624" Dia.08/24/18 33 05 13 Manhole Frames and CoversNeenah FoundryR- 165-LM (Hinged)ASTM A48 & AASHTO M30624" Dia.08/24/18 33 05 13 Manhole Frames and CoversNeenah FoundryNF 1274ASTM A48 & AASHTO M30630" Dia.08/24/18 33 05 13 Manhole Frames and CoversNeenah FoundryR-1743-LM (Hinged)ASTM A48 & AASHTO M30630" dia.33 05 13 Manhole Frames and CoversSigma CorporationMH-144N33 05 13 Manhole Frames and CoversSigma CorporationMH-143N33 05 13 Manhole Frames and CoversPont-A-MoussonGTS-STD24" dia.33 05 13 Manhole Frames and CoversNeenah Casting24" dia.10/31/06 33 05 13 Manhole Frames and Covers (Hinged)PowersealHinged Ductile Iron Manhole ASTM A53624" Dia.7/25/03 33 05 13 Manhole Frames and CoversSaint-Gobain Pipelines (Pamrex/rexus)RE32-R8FS30" Dia.01/31/06 33 05 1330" Dia. MH Ring and CoverEast Jordan Iron WorksV1432-2 and V1483 DesignsAASHTO M306-0430" Dia.11/02/10 33 05 1330" Dia. MH Ring and CoverSigma CorporationMH1651FWN & MH1650230" Dia07/19/11 33 05 1330" Dia. MH Ring and CoverStar Pipe ProductsMH32FTWSS-DC 30" Dia08/10/11 33 05 1330" Dia. MH Ring and CoverAccucast220700 Heavy Duty with Gasket Ring30" Dia10/14/13 33 05 1330" Dia. MH Ring and Cover (Hinged & Lockable)East Jordan Iron Works 30" ERGO XL Assembly with Cam Lock/MPIC/T-Gasket ASSHTO M105 & ASTM A53630" Dia06/01/17 34 05 1330" Dia. MH Ring and Cover (Hinged & Lockable) CISIP Industries2280 (32")ASTM A 4830" Dia.09/16/19 33 05 13.1030" Dia. MH Ring and Cover Composite Access Products, L.P.CAP-ONE-30-FTW, Composite, w/ Lock w/o Hing30" Dia.* From Original Standard Products ListClick to Return to the Table of Content4Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Water & Sewer - Manholes & Bases/Frames & Covers/Water Tight & Pressure Tight 33-05-13 (Rev 2/3/16)*33 05 13 Manhole Frames and CoversPont-A-MoussonPamtight24" Dia.*33 05 13 Manhole Frames and CoversNeenah Casting24" Dia.*33 05 13 Manhole Frames and CoversWestern Iron Works,Bass & Hays Foundry300-24P24" Dia.*33 05 13 Manhole Frames and CoversMcKinley Iron Works Inc.WPA24AM24" Dia.03/08/00 33 05 13 Manhole Frames and CoversAccucastRC-2100ASTM A 4824" Dia.04/20/01 33 05 13 Manhole Frames and Covers(SIP)Serampore Industries Private Ltd.300-24-23.75 Ring and CoverASTM A 4824" Dia.* From Original Standard Products ListClick to Return to the Table of Content5Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Water & Sewer - Manholes & Bases/Precast Concrete (Rev 1/8/13)*33 39 10 Manhole, Precast ConcreteHydro Conduit CorpSPL Item #49ASTM C 47848"*33 39 10 Manhole, Precast ConcreteWall Concrete Pipe Co. Inc.ASTM C-44348"09/23/96 33 39 10 Manhole, Precast ConcreteConcrete Product Inc.48" I.D. Manhole w/ 32" ConeASTM C 47848" w/32" cone05/08/18 33 39 10 Manhole, Precast ConcreteThe Turner Company48", 60" I.D. Manhole w/ 32" ConeASTM C 47848", 60"10/27/06 33 39 10 Manhole, Precast ConcreteOldcastle Precast Inc.48" I.D. Manhole w/ 24" ConeASTM C 47848" Diam w 24" Ring06/09/10 33 39 10 Manhole, Precast (Reinforce Polymer)ConcreteUS Composite PipeReinforced Polymer Concrete ASTM C-7648" to 72"09/06/19 33 39 20 Manhole, Precast ConcreteForterra Pipe and Precast60" & 72" I.D. Manhole w/32" ConeASTM C-7660" & 72"* From Original Standard Products ListClick to Return to the Table of Content6Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Water & Sewer - Manholes & Bases/Rehab Systems/Cementitious*E1-14 Manhole Rehab SystemsQuadex04/23/01E1-14 Manhole Rehab SystemsStandard Cement Materials, Inc.Reliner MSPE1-14 Manhole Rehab SystemsAP/M Permaform4/20/01E1-14 Manhole Rehab SystemStrong CompanyStrong Seal MS2A Rehab System5/12/03E1-14 Manhole Rehab System (Liner)Poly-triplex TechnologiesMH repair product to stop infiltrationASTM D581308/30/06General Concrete RepairFlexKrete TechnologiesVinyl Polyester Repair ProductMisc. Use* From Original Standard Products ListClick to Return to the Table of Content7Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Water & Sewer - Manholes & Bases/Rehab Systems/NonCementitious05/20/96E1-14 Manhole Rehab SystemsSprayroq, Spray Wall Polyurethane CoatingASTM D639/D790*E1-14 Manhole Rehab SystemsSun Coast12/14/01Coating for Corrosion protection(Exterior)ERTECHSeries 20230 and 2100 (Asphatic Emulsion)For Exterior Coating of Concrete Structures Only01/31/06Coatings for Corrosion ProtectionChestertonArc 791, S1HB, S1, S2Acid Resistance TestSewer Applications8/28/2006Coatings for Corrosion ProtectionWarren EnvironmentalS-301 and M-301Sewer Applications08/30/06Coatings for Corrosion ProtectionCitadelSLS-30 Solids EpoxySewer Applications03/19/1833 05 16, 33 39 10, 33 39 20 Coating for Corrosion protection(Exterior)Sherwin WilliamsRR&C Dampproofing Non-Fibered Spray Grade (Asphatic Emulsion)For Exterior Coating of Concrete Structures Only* From Original Standard Products ListClick to Return to the Table of Content8Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Water & Sewer - Manhole Inserts - Field Operations Use Only (Rev 2/3/16)*33 05 13 Manhole InsertKnutson EnterprisesMade to Order - PlasticASTM D 1248For 24" dia.*33 05 13 Manhole InsertSouth Western PackagingMade to Order - PlasticASTM D 1248For 24" dia.*33 05 13 Manhole InsertNoflow-InflowMade to Order - PlasticASTM D 1248For 24" dia.09/23/96 33 05 13 Manhole InsertSouthwestern Packing & Seals, Inc.LifeSaver - Stainless SteelFor 24" dia.09/23/96 33 05 13 Manhole InsertSouthwestern Packing & Seals, Inc.TetherLok - Stainless SteelFor 24" dia* From Original Standard Products ListClick to Return to the Table of Content9Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Water & Sewer - Pipe Casing Spacers 33-05-24 (07/01/13)11/04/02Steel Band Casing SpacersAdvanced Products and Systems, Inc.Carbon Steel Spacers, Model SI02/02/93Stainless Steel Casing SpacerAdvanced Products and Systems, Inc.Stainless Steel Spacer, Model SSI04/22/87Casing SpacersCascade Waterworks ManufacturingCasing Spacers09/14/10Stainless Steel Casing SpacerPipeline Seal and InsulatorStainless Steel Casing SpacerUp to 48"09/14/10Coated Steel Casin SpacersPipeline Seal and InsulatorCoated Steel Casin SpacersUp to 48" 05/10/11Stainless Steel Casing SpacerPowerseal4810 PowerchockUp to 48"03/19/18Casing SpacersBWMSS-12 Casing Spacer(Stainless Steel)03/19/18Casing SpacersBWMFB-12 Casing Spacer (Coated Carbon Steel) for Non_pressure Pipe and Grouted Casing* From Original Standard Products ListClick to Return to the Table of Content10Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Water & Sewer - Pipes/Ductile Iron 33-11-10(1/8/13)*33 11 10 Ductile Iron PipeGriffin Pipe Products, Co.Super Bell-Tite Ductile Iron Pressure Pipe, AWWA C150, C1513" thru 24"08/24/18 33 11 10 Ductile Iron PipeAmerican Ductile Iron Pipe Co.American Fastite Pipe (Bell Spigot)AWWA C150, C1514" thru 30"08/24/18 33 11 10 Ductile Iron PipeAmerican Ductile Iron Pipe Co.American Flex Ring (Restrained Joint)AWWA C150, C1514" thru 30"*33 11 10 Ductile Iron PipeU.S. Pipe and Foundry Co.AWWA C150, C151*33 11 10 Ductile Iron PipeMcWane Cast Iron Pipe Co.AWWA C150, C151* From Original Standard Products ListClick to Return to the Table of Content11Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Water & Sewer - Utility Line Marker (08/24/2018)* From Original Standard Products ListClick to Return to the Table of Content12Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Sewer - Coatings/Epoxy 33-39-60 (01/08/13)02/25/02Epoxy Lining SystemSauereisen, IncSewerGard 210RSLA County #210-1.3312/14/01Epoxy Lining SystemErtech Technical CoatingsErtech 2030 and 2100 Series04/14/05Interior Ductile Iron Pipe CoatingInduronProtecto 401ASTM B-117Ductile Iron Pipe Only01/31/06Coatings for Corrosion ProtectionChestertonArc 791, S1HB, S1, S2Acid Resistance TestSewer Applications8/28/2006Coatings for Corrosion ProtectionWarren EnvironmentalS-301 and M-301Sewer Applications* From Original Standard Products ListClick to Return to the Table of Content13Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Sewer - Coatings/Polyurethane* From Original Standard Products ListClick to Return to the Table of Content14Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Sewer - Combination Air Valves 05/25/18 33-31-70 Air Release ValveA.R.I. USA, Inc.D025LTP02(Composite Body)2"* From Original Standard Products ListClick to Return to the Table of Content15Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Sewer - Pipes/Concrete*E1-04 Conc. Pipe, ReinforcedWall Concrete Pipe Co. Inc.ASTM C 76*E1-04 Conc. Pipe, ReinforcedHydro Conduit CorporationClass III T&G, SPL Item #77ASTM C 76*E1-04 Conc. Pipe, ReinforcedHanson Concrete ProductsSPL Item #95-Manhole, #98- PipeASTM C 76*E1-04 Conc. Pipe, ReinforcedConcrete Pipe & Products Co. Inc.ASTM C 76* From Original Standard Products ListClick to Return to the Table of Content16Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Sewer - Pipe Enlargment System (Method)33-31-23 (01/18/13)PIM SystemPIM CorporationPolyethylenePIM Corp., Piscata Way, N.J. Approved PreviouslyMcConnell SystemsMcLat ConstructionPolyethyleneHouston, TexasApproved PreviouslyTRS SystemsTrenchless Replacement SystemPolyethyleneCalgary, CanadaApproved Previously* From Original Standard Products ListClick to Return to the Table of Content17Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Sewer - Pipe/Fiberglass Reinforced Pipe 33-31-13(1/8/13)7/21/97 33 31 13 Cent. Cast FiberglassHobas Pipe USA, Inc.Hobas Pipe (Non-Pressure)ASTM D3262/D375403/22/10 33 31 13 Fiberglass PipeAmeronBondstrand RPMP PipeASTM D3262/D375410/30/03Glass-Fiber Reinforced Polymer PipeThompson Pipe GroupFlowtiteASTM D3262/D37544/14/05Polymer Modified Concrete PipeAmitech USAMeyer Polycrete PipeASTM C33, A276, F4778" to 102", Class V06/09/10E1-9 Reinforced Polymer Concrete PipeUS Composite PipeReinforced Polymer Concrete PipeASTM C-76* From Original Standard Products ListClick to Return to the Table of Content18Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Sewer - Pipes/HDPE 33-31-23(1/8/13)*High-density polyethylene pipePhillips Driscopipe, Inc.Opticore Ductile Polyethylene PipeASTM D 12488"*High-density polyethylene pipePlexco Inc.ASTM D 12488"*High-density polyethylene pipePolly Pipe, Inc.ASTM D 12488"High-density polyethylene pipeCSR Hydro Conduit/Pipeline SystemsMcConnell Pipe EnlargementASTM D 1248* From Original Standard Products ListClick to Return to the Table of Content19Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Sewer - Pipes/PVC (Pressure Sewer) 33-11-12 (4/1/13)12/02/11 33-11-12 DR-14 PVC Pressure PipePipelife JetstreamPVC Pressure PipeAWWA C9004" thru 12"10/22/14 33-11-12 DR-14 PVC Pressure PipeRoyal Building ProductsRoyal Seal PVC Pressure PipeAWWA C9004" thru 12"* From Original Standard Products ListClick to Return to the Table of Content20Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Sewer - Pipes/PVC* 33-31-20 (7/1/13)*33-31-20 PVC Sewer PipeJ-M Manufacturing Co., Inc. (JM Eagle)SDR-26ASTM D 30344" - 15"12/23/97* 33-31-20 PVC Sewer PipeDiamond Plastics CorporationSDR-26ASTM D 30344" thru 15"*33-31-20 PVC Sewer PipeLamson Vylon PipeASTM F 7894" thru 15"01/18/18 33-31-20 PVC Sewer PipeVinyltech PVC PipeGravity SewerASTM D30344" thru 15"11/11/98 33-31-20 PVC Sewer PipeDiamond Plastics Corporation "S" Gravity Sewer PipeASTM F 67918" to 27"*33-31-20 PVC Sewer PipeJ-M Manufacturing Co, Inc. (JM Eagle)SDR 26/35 PS 115/46ASTM F 67918" - 27"09/11/12 33-31-20 PVC Sewer PipePipelife Jet StreamSDR-26 and SDR-35ASTM F-67918"05/06/0533-31-20PVC Solid Wall PipeDiamond Plastics CorporationSDR 26/35 PS 115/46ASTM F-67918" to 48"04/27/0633-31-20PVC Sewer Fittings HarcoSDR-26 and SDR-35 Gasket Fittings ASTM D-3034, D-1784, etc4" - 15"*33-31-20PVC Sewer FittingsPlastic Trends, In.cGasketed PVC Sewer Main FittingsASTM D 30343/19/2018 33 31 20 PVC Sewer PipePipelife Jet StreamSDR 35ASTM F67918"- 24"3/19/2018 33 31 20 PVC Sewer PipePipelife Jet StreamSDR 26ASTM D30344"- 15"3/29/2019 33 31 20Gasketed Fittings (PVC)GPK Products, Inc.SDR 26ASTM D3034/F-6794"- 15"10/21/2020 33 31 20 PVC Sewer PipeNAPCOSDR 26ASTM D30344" - 15"10/22/2020 33 31 20 PVC Sewer PipeSanderson Pipe Corp.SDR 26ASTM D30344"- 15"10/21/2020 33 31 20 PVC Sewer PipeNAPCOSDR 26/35 PS 115/46ASTM F-67918"- 36"* From Original Standard Products ListClick to Return to the Table of Content21Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Sewer - Pipes/Rehab/CIPP 33-31-12 (01/18/13)*Cured in Place PipeInsituform Texark, IncASTM F 121605/03/99Cured in Place PipeNational Envirotech GroupNational Liner, (SPL) Item #27ASTM F-1216/D-581305/29/96Cured in Place PipeReynolds Inc/Inliner Technolgy (Inliner USA)Inliner TechnologyASTM F 1216* From Original Standard Products ListClick to Return to the Table of Content22Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Sewer - Pipes/Rehab/Fold & Form*Fold and Form PipeCullum Pipe Systems, Inc.11/03/98Fold and Form PipeInsituform Technologies, Inc.Insituform "NuPIpe"ASTM F-1504Fold and Form PipeAmerican Pipe & Plastics, Inc.Demo. Purpose Only12/04/00Fold and Form PipeUltralinerUltraliner PVC Alloy PipelinerASTM F-1504, 1871, 186706/09/03Fold and Form PipeMiller Pipeline Corp.EX MethodASTM F-1504, F-1947Up to 18" diameter* From Original Standard Products ListClick to Return to the Table of Content23Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Sewer - Pipes/Open Profile Large Diameter09/26/91 E100-2 PVC Sewer Pipe, RibbedLamson Vylon PipeCarlon Vylon H.C. Closed Profile Pipe,ASTM F 67918" to 48"09/26/91 E100-2 PVC Sewer Pipe, RibbedExtrusion Technologies, Inc.Ultra-Rib Open Profile Sewer PipeASTM F 67918" to 48"E100-2 PVC Sewer Pipe, RibbedUponor ETI Company11/10/10 (E100-2) Polypropylene (PP) Sewer Pipe, Double WallAdvanced Drainage Systems (ADS) SaniTite HP Double Wall (Corrugated)ASTM F 273624"-30"11/10/10 (E100-2) Polypropylene (PP) Sewer Pipe, Triple WallAdvanced Drainage Systems (ADS)SaniTite HP Triple Wall PipeASTM F 276430" to 60"05/16/11Steel Reinforced Polyethylene PipeConTech Construction ProductsDurmaxxASTM F 256224" to 72"* From Original Standard Products ListClick to Return to the Table of Content24Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Water - Appurtenances 33-12-10 (07/01/13)01/18/18 33-12-10 Double Strap SaddleRomac202NS Nylon CoatedAWWA C8001"-2" SVC, up to 24" Pipe08/28/02Double Strap SaddleSmith Blair #317 Nylon Coated Double Strap Saddle07/23/12 33-12-10 Double Strap Service SaddleMueller CompanyDR2S Double (SS) Strap DI SaddleAWWA C8001"-2" SVC, up to 24" Pipe10/27/87Curb Stops-Ball Meter ValvesMcDonald6100M,6100MT & 610MT 3/4" and 1"10/27/87Curb Stops-Ball Meter ValvesMcDonald4603B, 4604B, 6100M, 6100TM and 6101M 1½" and 2"5/25/2018 33-12-10 Curb Stops-Ball Meter ValvesFord Meter Box Co., Inc.FB600-7NL, FB1600-7-NL, FV23-777-W-NL, L22-77NLAWWA C8002"5/25/2018 33-12-10 Curb Stops-Ball Meter ValvesFord Meter Box Co., Inc.FB600-6-NL, FB1600-6-NL, FV23-666-W-NL, L22-66NLAWWA C8001-1/2"5/25/2018 33-12-10 Curb Stops-Ball Meter ValvesFord Meter Box Co., Inc.FB600-4-NL, FB1600-4-NL, B11-444-WR-NL, B22444-WR-NL, L28-44NLAWWA C8001"5/25/2018 33-12-10 Curb Stops-Ball Meter ValvesMueller Co., Ltd.B-25000N, B-24277N-3, B-20200N-3, H-15000N, , H-1552N, H142276NAWWA C800, ANSF 61, ANSI/NSF 3722"5/25/2018 33-12-10 Curb Stops-Ball Meter ValvesMueller Co., Ltd.B-25000N, B-20200N-3, B-24277N-3,H-15000N, H-14276N, H-15525NAWWA C800, ANSF 61, ANSI/NSF 3721-1/2"5/25/2018 33-12-10 Curb Stops-Ball Meter ValvesMueller Co., Ltd.B-25000N, B-20200N-3,H-15000N, H-15530NAWWA C800, ANSF 61, ANSI/NSF 3721"01/26/00Coated Tapping Saddle with Double SS StrapsJCM Industries, Inc.#406 Double Band SS Saddle1"-2" Taps on up to 12" 0/5/21/12 33-12-25 Tapping Sleeve (Coated Steel)JCM Industries, Inc.412 Tapping Sleeve ESSAWWA C-223Up to 30" w/12" Out05/10/11Tapping Sleeve (Stainless Steel)Powerseal3490AS (Flange) & 3490MJ4"-8" and 16"02/29/12 33-12-25 Tapping Sleeve (Coated Steel)RomacFTS 240AWWA C-223U p to 42" w/24" Out02/29/12 33-12-25 Tapping Sleeve (Stainless Steel)RomacSST Stainless SteelAWWA C-223Up to 24" w/12" Out02/29/12 33-12-25 Tapping Sleeve (Stainless Steel)RomacSST III Stainless SteelAWWA C-223Up to 30" w/12" Out05/10/11Joint Repair ClampPowerseal3232 Bell Joint Repair Clamp4" to 30"Plastic Meter Box w/Composite LidDFW Plastics Inc.DFW37C-12-1EPAF FTWPlastic Meter Box w/Composite LidDFW Plastics Inc.DFW39C-12-1EPAF FTW08/30/06Plastic Meter Box w/Composite LidDFW Plastics Inc.DFW65C-14-1EPAF FTWClass "A"Concrete Meter BoxBass & HaysCMB37-B12 1118 LID-9Concrete Meter BoxBass & HaysCMB-18-Dual 1416 LID-9Concrete Meter BoxBass & HaysCMB65-B65 1527 LID-9* From Original Standard Products ListClick to Return to the Table of Content25Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Water - Bolts, Nuts, and Gaskets 33-11-05 (01/08/13)* From Original Standard Products ListClick to Return to the Table of Content26Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Water - Combination Air Release 33-31-70 (01/08/13)*E1-11 Combination Air Release ValveGA Industries, Inc.Empire Air and Vacuum Valve, Model 935 ASTM A 126 Class B, ASTM A 240 - float, ASTM A 307 - Cover Bolts1" & 2"*E1-11 Combination Air Release ValveMultiplex Manufacturing Co.Crispin Air and Vacuum Valves, Model No. 1/2", 1" & 2"*E1-11 Combination Air Release ValveValve and Primer Corp.APCO #143C, #145C and #147C1", 2" & 3"* From Original Standard Products ListClick to Return to the Table of Content27Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Water - Dry Barrel Fire Hydrants 33-12-40 (01/15/14)10/01/87 E-1-12 Dry Barrel Fire HydrantAmerican-Darling ValveDrawing Nos. 90-18608, 94-18560AWWA C-50203/31/88 E-1-12 Dry Barrel Fire HydrantAmerican Darling ValveShop Drawing No. 94-18791 AWWA C-50209/30/87 E-1-12 Dry Barrel Fire HydrantClow CorporationShop Drawing No. D-19895AWWA C-50201/12/93 E-1-12 Dry Barrel Fire HydrantAmerican AVK CompanyModel 2700AWWA C-50208/24/88 E-1-12 Dry Barrel Fire HydrantClow CorporationDrawings D20435, D20436, B20506AWWA C-502E-1-12 Dry Barrel Fire HydrantITT Kennedy ValveShop Drawing No. D-80783FWAWWA C-50209/24/87 E-1-12 Dry Barrel Fire HydrantM&H Valve CompanyShop Drawing No. 13476AWWA C-50210/14/87 E-1-12 Dry Barrel Fire HydrantMueller CompanyShop Drawings No. 6461 A-423 CenturionAWWA C-50201/15/88E1-12 Dry Barrel Fire HydrantMueller CompanyShop Drawing FH-12A-423 Super Centurion 200AWWA C-50210/09/87 E-1-12 Dry Barrel Fire HydrantU.S. Pipe & FoundryShop Drawing No. 960250AWWA C-50209/16/87 E-1-12 Dry Barrel Fire HydrantWaterous CompanyShop Drawing No. SK740803AWWA C-50208/12/16 33-12-40 Dry Barrel Fire HydrantEJ (East Jordan Iron Works)WaterMaster 5CD250* From Original Standard Products ListClick to Return to the Table of Content28Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Water - Meters02/05/93 E101-5 Detector Check MeterAmes CompanyModel 1000 Detector Check ValveAWWA C5504" - 10"08/05/04Magnetic Drive Vertical TurbineHerseyMagnetic Drive VerticalAWWA C701, Class 13/4" - 6"* From Original Standard Products ListClick to Return to the Table of Content29Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Water - Pipes/PVC (Pressure Water) 33-31-70 (01/08/13)01/18/18 33-11-12 PVC Pressure PipeVinyltech PVC PipeAWWA C900, AWWA C605, ASTM D17844"-12"3/19/2018 33 11 12 PVC Pressure PipePipelife Jet StreamDR14AWWA C9004"-12"3/19/2018 33 11 12 PVC Pressure PipePipelife Jet StreamDR18AWWA C90016"-24"5/25/2018 33 11 12 PVC Pressure PipeDiamond Plastics CorporationDR 14AWWA C9004"-12"5/25/2018 33 11 12 PVC Pressure PipeDiamond Plastics CorporationTrans 21, DR 14, DR 18AWWA C90016"-24"12/6/2018 33 11 12 PVC Pressure PipeJ-M Manifacturing Co., Inc d/b/a JM EagleDR 14"Blue Brute"AWWA C900-16UL 1285ANSI/NSF 61FM 16124"-12"12/6/2018 33 11 12 PVC Pressure PipeJ-M Manifacturing Co., Inc d/b/a JM EagleDR 18"Blue Brute"AWWA C900-16UL 1285ANSI/NSF 61FM 161216"-24"9/6/2019 33 11 12 PVC Pressure PipeUnderground Solutions Inc.DR14 Fusible PVCAWWA C9004" - 8"9/6/2019 33 11 12 PVC Pressure PipeNAPCODR18AWWA C90016" - 24"9/6/2019 33 11 12 PVC Pressure PipeNAPCODR14AWWA C9004"- 12"9/6/2019 33 11 12 PVC Pressure PipeSanderson Pipe Corp.DR14AWWA C9004"- 12"* From Original Standard Products ListClick to Return to the Table of Content30Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Water - Pipes/Valves & Fittings/Ductile Iron Fittings 33-11-11 (01/08/13)07/23/92E1-07 Ductile Iron FittingsStar Pipe Products, Inc.Mechanical Joint FittingsAWWA C153 & C110*E1-07 Ductile Iron FittingsGriffin Pipe Products, Co.Mechanical Joint FittingsAWWA C 110*E1-07 Ductile Iron FittingsMcWane/Tyler Pipe/ Union Utilities DivisionMechanical Joint Fittings, SSB Class 350AWWA C 153, C 110, C 11108/11/98E1-07 Ductile Iron FittingsSigma, Co.Mechanical Joint Fittings, SSB Class 351AWWA C 153, C 110, C 11202/26/14E1-07 MJ FittingsAccucastClass 350 C-153 MJ FittingsAWWA C1534"-12"05/14/98E1-07 Ductile Iron Joint RestraintsFord Meter Box Co./Uni-FlangeUni-Flange Series 1400 AWWA C111/C1534" to 36"05/14/98E1-24 PVC Joint RestraintsFord Meter Box Co./Uni-FlangeUni-Flange Series 1500 Circle-LockAWWA C111/C1534" to 24" 11/09/04E1-07 Ductile Iron Joint RestraintsOne Bolt, Inc.One Bolt Restrained Joint FittingAWWA C111/C116/C1534" to 12"02/29/12 33-11-11 Ductile Iron Pipe Mechanical Joint RestraintEBAA Iron, Inc.Megalug Series 1100 (for DI Pipe)AWWA C111/C116/C1534" to 42"02/29/12 33-11-11 PVC Pipe Mechanical Joint RestraintEBAA Iron, Inc.Megalug Series 2000 (for PVC Pipe)AWWA C111/C116/C1534" to 24"08/05/04E1-07 Mechanical Joint Retainer Glands(PVC)Sigma, Co.Sigma One-Lok SLC4 - SLC10AWWA C111/C1534" to 10"03/06/19 33-11-11 Mechanical Joint Retainer Glands(PVC)Sigma, Co.Sigma One-Lok SLCS4 - SLCS12AWWA C111/C1534" to 12"08/05/04E1-07 Mechanical Joint Retainer Glands(PVC)Sigma, Co.Sigma One-Lok SLCEAWWA C111/C15312" to 24"08/10/98E1-07 MJ Fittings(DIP)Sigma, Co.Sigma One-Lok SLDEAWWA C1534" - 24"10/12/10E1-24 Interior Restrained Joint SystemS & B Techncial ProductsBulldog System ( Diamond Lok 21 & JM Eagle ASTM F-16244" to 12"08/16/06E1-07 Mechanical Joint FittingsSIP Industries(Serampore)Mechanical Joint FittingsAWWA C1534" to 24"11/07/16 33-11-11 Mechanical Joint Retainer GlandsStar Pipe Products, Inc.PVC Stargrip Series 4000ASTM A536 AWWA C11111/07/16 33-11-11 Mechanical Joint Retainer GlandsStar Pipe Products, Inc.DIP Stargrip Series 3000ASTM A536 AWWA C11103/19/18 33-11-11 Mechanical Joint Retainer GlandsSIP Industries(Serampore)EZ Grip Joint Restraint (EZD) Black For DIPASTM A536 AWWA C1113"-48"03/19/18 33-11-11 Mechanical Joint Retainer GlandsSIP Industries(Serampore)EZ Grip Joint Restraint (EZD) Red for C900 DR14 PVC PipeASTM A536 AWWA C1114"-12"03/19/18 33-11-11 Mechanical Joint Retainer GlandsSIP Industries(Serampore)EZ Grip Joint Restraint (EZD) Red for C900 DR18 PVC PipeASTM A536 AWWA C11116"-24"* From Original Standard Products ListClick to Return to the Table of Content31Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Water - Pipes/Valves & Fittings/Resilient Seated Gate Valve* 33-12-20 (05/13/15)Resilient Wedged Gate Valve w/no GearsAmerican Flow ControlSeries 2500 Drawing # 94-2024716"12/13/02Resilient Wedge Gate ValveAmerican Flow ControlSeries 2530 and Series 2536AWWA C51530" and 36"08/31/99Resilient Wedge Gate ValveAmerican Flow ControlSeries 2520 & 2524 (SD 94-20255)AWWA C51520" and 24"05/18/99Resilient Wedge Gate ValveAmerican Flow ControlSeries 2516 (SD 94-20247)AWWA C51516"10/24/00E1-26 Resilient Wedge Gate ValveAmerican Flow ControlSeries 2500 (Ductile Iron)AWWA C5154" to 12"08/05/04Resilient Wedge Gate ValveAmerican Flow Control42" and 48" AFC 2500AWWA C51542" and 48"05/23/91E1-26 Resilient Wedge Gate ValveAmerican AVK CompanyAmerican AVK Resilient Seaded GVAWWA C5094" to 12"01/24/02E1-26 Resilient Wedge Gate ValveAmerican AVK Company20" and smaller*E1-26 Resilient Seated Gate ValveKennedy4" - 12"*E1-26 Resilient Seated Gate ValveM&H4" - 12"*E1-26 Resilient Seated Gate ValveMueller Co.4" - 12"11/08/99Resilient Wedge Gate Valve Mueller Co.Series A2361 (SD 6647)AWWA C51516"01/23/03Resilient Wedge Gate ValveMueller Co.Series A2360 for 18"-24" (SD 6709)AWWA C51524" and smaller05/13/05Resilient Wedge Gate ValveMueller Co.Mueller 30" & 36", C-515AWWA C51530" and 36"01/31/06Resilient Wedge Gate ValveMueller Co.Mueller 42" & 48", C-515AWWA C51542" and 48"01/28/88E1-26 Resilient Wedge Gate ValveClow Valve Co.AWWA C5094" - 12"10/04/94Resilient Wedge Gate ValveClow Valve Co.16" RS GV (SD D-20995)AWWA C51516"11/08/99E1-26 Resilient Wedge Gate ValveClow Valve Co.Clow RW Valve (SD D-21652)AWWA C51524" and smaller11/29/04Resilient Wedge Gate Valve Clow Valve Co.Clow 30" & 36" C-515AWWA C51530" and 36" (Note 3)11/30/12Resilient Wedge Gate ValveClow Valve Co.Clow Valve Model 2638AWWA C51524" to 48" (Note 3)05/08/91E1-26 Resilient Seated Gate ValveStockham Valves & FittingsAWWA C 509, ANSI 420 - stem, ASTM A 276 Type 304 - Bolts & nuts4" - 12"*E1-26 Resilient Seated Gate ValveU.S. Pipe and Foundry Co.Metroseal 250, requirements SPL #743" to 16"10/26/16 33-12-20 Resilient Seated Gate ValveEJ (East Jordan Iron Works)EJ FlowMaster Gate Valve & Boxes08/24/18Matco Gate Valve Matco-Norca225 MRAWWA/ANSI C115/An21.154" to 16"* From Original Standard Products ListClick to Return to the Table of Content32Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Water - Pipes/Valves & Fittings/Rubber Seated Butterfly Valve 33-12-21 (07/10/14)*E1-30 Rubber Seated Butterfly ValveHenry Pratt Co.AWWA C-50424"*E1-30 Rubber Seated Butterfly ValveMueller Co.AWWA C-50424"and smaller1/11/99E1-30 Rubber Seated Butterfly ValveDezurik Valves Co.AWWA C-50424" and larger06/12/03E1-30 Valmatic American Butterfly ValveValmatic Valve and Manufacturing Corp. Valmatic American Butterfly Valve.AWWA C-504Up to 84" diameter04/06/07E1-30 Rubber Seated Butterfly ValveM&H ValveM&H Style 4500 & 1450 AWWA C-50424" to 48"03/19/18 33 12 21 Rubber Seated Butterfly ValveG. A. Industries (Golden Anderson)AWWA C504 Butterfly ValveAWWA C-50430"-54"* From Original Standard Products ListClick to Return to the Table of Content33Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Water - Polyethylene Encasement 33-11-10 (01/08/13)05/12/05E1-13 Polyethylene EncasmentFlexsol PackagingFulton Enterprises AWWA C1058 mil LLD05/12/05E1-13 Polyethylene EncasmentMountain States Plastics (MSP) and AEP Ind.Standard HardwareAWWA C1058 mil LLD05/12/05E1-13 Polyethylene EncasmentAEP IndustriesBullstrong by Cowtown Bolt & GasketAWWA C1058 mil LLD09/06/19 33-11-11 Polyethylene EncasmentNorthtown Products Inc. PE Encasement fro DIPAWWA C1058 mil LLD* From Original Standard Products ListClick to Return to the Table of Content34Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Water - Sampling Station3/12/96Water Sampling StationWater PlusB20 Water Sampling Station* From Original Standard Products ListClick to Return to the Table of Content35Updated: 10/21/2020 Approval Spec No. ClasssificationManufacturerModel No.National SpecSizeCITY OF FORT WORTHWATER DEPARTMENT STANDARD PRODUCT LISTNote: All water or sewer pipe larger than 15 inch diameter shall be approved for use by the Water Department on a project specific basis. Special bedding may be required for some pipes.Water - Automatic Flusher10/21/20Automated Flushing SystemMueller HydroguardHG6-A-IN-2-BRN-LPRR(Portable) HG2-A-IN--2-PVC-018-LPLG(Permanent)* From Original Standard Products ListClick to Return to the Table of Content36Updated: 10/21/2020