Loading...
HomeMy WebLinkAboutContract 57623-PM1PROJECT MANUAL FOR THE CONSTRUCTION OF MAJOR INFRASTRUCTURE FOR TEXAS INDUSTRIES ADDITION NO. 3 LOT 2, BLOCK 2 City Project No. 103784 IPRC21-0134 FID 30114-0200431-103784-E07685 W-2818, X-27140 Mattie Parker David Cooke Mayor City Manager Christopher P. Harder, P.E. Director, Water Department William Johnson Director, Transportation and Public Works Department Prepared for The City of Fort Worth April, 2022 4-01-22 CSC No. 57623-PM1 00 00 00 STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS Page 1 of 6 CITY OF FORT WORTH Texas Industries Addition No 3, Lot 2 Block 2 STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS CPN #103784 Revised March 20, 2020 SECTION 00 00 10 TABLE OF CONTENTS DEVELOPER AWARDED PROJECTS Division 00 - General Conditions Last Revised 00 11 13 Invitation to Bidders 03/20/2020 00 21 13 Instructions to Bidders 03/20/2020 00 41 00 Bid Form 04/02/2014 00 42 43 Proposal Form Unit Price 05/22/2019 00 43 13 Bid Bond 04/02/2014 00 45 11 Bidders Prequalification’s 04/02/2014 00 45 12 Prequalification Statement 09/01/2015 00 45 13 Bidder Prequalification Application 03/09/2020 00 45 26 Contractor Compliance with Workers' Compensation Law 04/02/2014 00 45 40 Minority Business Enterprise Goal 08/21/2018 00 52 43 Agreement 06/16/2016 00 61 25 Certificate of Insurance 07/01/2011 00 62 13 Performance Bond 01/31/2012 00 62 14 Payment Bond 01/31/2012 00 62 19 Maintenance Bond 01/31/2012 00 72 00 General Conditions 11/15/2017 00 73 00 Supplementary Conditions 07/01/2011 00 73 10 Standard City Conditions of the Construction Contract for Developer Awarded Projects 01/10/2013 Division 01 - General Requirements Last Revised 01 11 00 Summary of Work 12/20/2012 01 25 00 Substitution Procedures 08/30/2013 01 31 19 Preconstruction Meeting 08/30/2013 01 31 20 Project Meetings 07/01/2011 01 32 33 Preconstruction Video 08/30/2013 01 33 00 Submittals 08/30/2013 01 35 13 Special Project Procedures 08/30/2013 01 45 23 Testing and Inspection Services 03/20/2020 01 50 00 Temporary Facilities and Controls 07/01/2011 01 55 26 Street Use Permit and Modifications to Traffic Control 07/01/2011 01 57 13 Storm Water Pollution Prevention Plan 07/01/2011 01 60 00 Product Requirements 03/20/2020 01 66 00 Product Storage and Handling Requirements 04/07/2014 01 70 00 Mobilization and Remobilization 04/07/2014 01 71 23 Construction Staking 04/07/2014 01 74 23 Cleaning 04/07/2014 01 77 19 Closeout Requirements 04/07/2014 01 78 23 Operation and Maintenance Data 04/07/2014 01 78 39 Project Record Documents 04/07/2014 00 00 00 STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS Page 2 of 6 CITY OF FORT WORTH Texas Industries Addition No 3, Lot 2 Block 2 STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS CPN #103784 Revised March 20, 2020 Technical Specifications which have been modified by the Engineer specifically for this Project; hard copies are included in the Project’s Contract Documents NONE 00 00 00 STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS Page 3 of 6 CITY OF FORT WORTH Texas Industries Addition No 3, Lot 2 Block 2 STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS CPN #103784 Revised March 20, 2020 Technical Specifications listed below are included for this Project by reference and can be viewed/downloaded from the City’s website at: http://fortworthtexas.gov/tpw/contractors/ or https://apps.fortworthtexas.gov/ProjectResources/ Division 02 - Existing Conditions Last Revised 02 41 13 Selective Site Demolition 12/20/2012 02 41 14 Utility Removal/Abandonment 12/20/2012 02 41 15 Paving Removal 02/02/2016 Division 03 - Concrete 03 30 00 Cast-In-Place Concrete 12/20/2012 03 34 13 Controlled Low Strength Material (CLSM) 12/20/2012 03 34 16 Concrete Base Material for Trench Repair 12/20/2012 03 80 00 Modifications to Existing Concrete Structures 12/20/2012 Division 26 - Electrical 26 05 00 Common Work Results for Electrical 11/22/2013 26 05 10 Demolition for Electrical Systems 12/20/2012 26 05 33 Raceways and Boxes for Electrical Systems 12/20/2012 26 05 43 Underground Ducts and Raceways for Electrical Systems 07/01/2011 26 05 50 Communications Multi-Duct Conduit 02/26/2016 Division 31 - Earthwork 31 10 00 Site Clearing 12/20/2012 31 23 16 Unclassified Excavation 01/28/2013 31 23 23 Borrow 01/28/2013 31 24 00 Embankments 01/28/2013 31 25 00 Erosion and Sediment Control 12/20/2012 31 36 00 Gabions 12/20/2012 31 37 00 Riprap 12/20/2012 Division 32 - Exterior Improvements 32 01 17 Permanent Asphalt Paving Repair 12/20/2012 32 01 18 Temporary Asphalt Paving Repair 12/20/2012 32 01 29 Concrete Paving Repair 12/20/2012 32 11 23 Flexible Base Courses 12/20/2012 32 11 29 Lime Treated Base Courses 12/20/2012 32 11 33 Cement Treated Base Courses 12/20/2012 32 11 37 Liquid Treated Soil Stabilizer 08/21/2015 32 12 16 Asphalt Paving 12/20/2012 32 12 73 Asphalt Paving Crack Sealants 12/20/2012 32 13 13 Concrete Paving 12/20/2012 32 13 20 Concrete Sidewalks, Driveways and Barrier Free Ramps 06/05/2018 32 13 73 Concrete Paving Joint Sealants 12/20/2012 32 14 16 Brick Unit Paving 12/20/2012 00 00 00 STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS Page 4 of 6 CITY OF FORT WORTH Texas Industries Addition No 3, Lot 2 Block 2 STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS CPN #103784 Revised March 20, 2020 32 16 13 Concrete Curb and Gutters and Valley Gutters 10/05/2016 32 17 23 Pavement Markings 11/22/2013 32 17 25 Curb Address Painting 11/04/2013 32 31 13 Chain Fences and Gates 12/20/2012 32 31 26 Wire Fences and Gates 12/20/2012 32 31 29 Wood Fences and Gates 12/20/2012 32 32 13 Cast-in-Place Concrete Retaining Walls 06/05/2018 32 91 19 Topsoil Placement and Finishing of Parkways 12/20/2012 32 92 13 Hydro-Mulching, Seeding, and Sodding 12/20/2012 32 93 43 Trees and Shrubs 12/20/2012 Division 33 - Utilities 33 01 30 Sewer and Manhole Testing 12/20/2012 33 01 31 Closed Circuit Television (CCTV) Inspection 03/03/2016 33 03 10 Bypass Pumping of Existing Sewer Systems 12/20/2012 33 04 10 Joint Bonding and Electrical Isolation 12/20/2012 33 04 11 Corrosion Control Test Stations 12/20/2012 33 04 12 Magnesium Anode Cathodic Protection System 12/20/2012 33 04 30 Temporary Water Services 07/01/2011 33 04 40 Cleaning and Acceptance Testing of Water Mains 02/06/2013 33 04 50 Cleaning of Sewer Mains 12/20/2012 33 05 10 Utility Trench Excavation, Embedment, and Backfill 12/12/2016 33 05 12 Water Line Lowering 12/20/2012 33 05 13 Frame, Cover and Grade Rings – Cast Iron 01/22/2016 33 05 13.10 Frame, Cover and Grade Rings – Composite 01/22/2016 33 05 14 Adjusting Manholes, Inlets, Valve Boxes, and Other Structures to Grade 12/20/2012 33 05 16 Concrete Water Vaults 12/20/2012 33 05 17 Concrete Collars 12/20/2012 33 05 20 Auger Boring 12/20/2012 33 05 21 Tunnel Liner Plate 12/20/2012 33 05 22 Steel Casing Pipe 12/20/2012 33 05 23 Hand Tunneling 12/20/2012 33 05 24 Installation of Carrier Pipe in Casing or Tunnel Liner Plate 06/19/2013 33 05 26 Utility Markers/Locators 12/20/2012 33 05 30 Location of Existing Utilities 12/20/2012 33 11 05 Bolts, Nuts, and Gaskets 12/20/2012 33 11 10 Ductile Iron Pipe 12/20/2012 33 11 11 Ductile Iron Fittings 12/20/2012 33 11 12 Polyvinyl Chloride (PVC) Pressure Pipe 11/16/2018 33 11 13 Concrete Pressure Pipe, Bar-Wrapped, Steel Cylinder Type 12/20/2012 33 11 14 Buried Steel Pipe and Fittings 12/20/2012 33 12 10 Water Services 1-inch to 2-inch 02/14/2017 33 12 11 Large Water Meters 12/20/2012 33 12 20 Resilient Seated Gate Valve 12/20/2012 33 12 21 AWWA Rubber-Seated Butterfly Valves 12/20/2012 33 12 25 Connection to Existing Water Mains 02/06/2013 33 12 30 Combination Air Valve Assemblies for Potable Water Systems 12/20/2012 33 12 40 Fire Hydrants 01/03/2014 00 00 00 STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS Page 5 of 6 CITY OF FORT WORTH Texas Industries Addition No 3, Lot 2 Block 2 STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS CPN #103784 Revised March 20, 2020 33 12 50 Water Sample Stations 12/20/2012 33 12 60 Standard Blow-off Valve Assembly 06/19/2013 33 31 12 Cured in Place Pipe (CIPP) 12/20/2012 33 31 13 Fiberglass Reinforced Pipe for Gravity Sanitary Sewers 12/20/2012 33 31 15 High Density Polyethylene (HDPE) Pipe for Sanitary Sewer 12/20/2012 33 31 20 Polyvinyl Chloride (PVC) Gravity Sanitary Sewer Pipe 06/19/2013 33 31 21 Polyvinyl Chloride (PVC) Closed Profile Gravity Sanitary Sewer Pipe 12/20/2012 33 31 22 Sanitary Sewer Slip Lining 12/20/2012 33 31 23 Sanitary Sewer Pipe Enlargement 12/20/2012 33 31 50 Sanitary Sewer Service Connections and Service Line 04/26/2013 33 31 70 Combination Air Valve for Sanitary Sewer Force Mains 12/20/2012 33 39 10 Cast-in-Place Concrete Manholes 12/20/2012 33 39 20 Precast Concrete Manholes 12/20/2012 33 39 30 Fiberglass Manholes 12/20/2012 33 39 40 Wastewater Access Chamber (WAC) 12/20/2012 33 39 60 Epoxy Liners for Sanitary Sewer Structures 12/20/2012 33 41 10 Reinforced Concrete Storm Sewer Pipe/Culverts 07/01/2011 33 41 11 High Density Polyethylene (HDPE) Pipe for Storm Drain 12/20/2012 33 41 12 Reinforced Polyethlene (SRPE) Pipe 11/13/2015 33 46 00 Subdrainage 12/20/2012 33 46 01 Slotted Storm Drains 07/01/2011 33 46 02 Trench Drains 07/01/2011 33 49 10 Cast-in-Place Manholes and Junction Boxes 12/20/2012 33 49 20 Curb and Drop Inlets 12/20/2012 33 49 40 Storm Drainage Headwalls and Wingwalls 07/01/2011 Division 34 - Transportation 34 41 10 Traffic Signals 10/12/2015 34 41 10.01 Attachment A – Controller Cabinet 12/18/2015 34 41 10.02 Attachment B – Controller Specification 02/2012 34 41 10.03 Attachment C – Software Specification 01/2012 34 41 11 Temporary Traffic Signals 11/22/2013 34 41 13 Removing Traffic Signals 12/20/2012 34 41 15 Rectangular Rapid Flashing Beacon 11/22/2013 34 41 16 Pedestrian Hybrid Signal 11/22/2013 34 41 20 Roadway Illumination Assemblies 12/20/2012 34 41 20.01 Arterial LED Roadway Luminaires 06/15/2015 34 41 20.02 Freeway LED Roadway Luminaires 06/15/2015 34 41 20.03 Residential LED Roadway Luminaires 06/15/2015 34 41 30 Aluminum Signs 11/12/2013 34 41 50 Single-Mode Fiber Optic Cable 02/26/2016 34 71 13 Traffic Control 11/22/2013 00 00 00 STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS Page 6 of 6 CITY OF FORT WORTH Texas Industries Addition No 3, Lot 2 Block 2 STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS CPN #103784 Revised March 20, 2020 Appendix GC-4.01 Availability of Lands GC-4.02 Subsurface and Physical Conditions GC-4.04 Underground Facilities GC-4.06 Hazardous Environmental Condition at Site GC-6.06.D Minority and Women Owned Business Enterprise Compliance GC-6.07 Wage Rates GC-6.09 Permits and Utilities GC-6.24 Nondiscrimination GR-01 60 00 Product Requirements END OF SECTION DIVISION 00 GENERAL CONDITIONS UTILITIES SECiiQN b0 42 43 Developer Awazded Prnjects - PROFOSAL FDRM Texas Industries Rddition No. 3 I.ot 2, Hbck 2 City Prc�ject #10378A ifl�il'i' PR10E BID Project Item Infarmatian Bidlist 5pecification Unii of Sid Item ����� Saclion€do. Measime Q�aart. Un'stPrice SidValuc 1 83'[1.I)46'I 12" PVC Water Plpe 2 3319.D241 S" PVG Water Pipe S 3305A908 Trench 5afe 4 3311.IX741 Quetilg Iron VYater Plitln 5 w1 Re�raint S 33D5.91� 24" Casin S t bth�'ihan O en Cut Incl. 6 3912.20D3 2" �amestic 1Naler Serv�ce 8 Nleter Smr 7 3312.20U3 2` 1rri aSGn Service 8�leler Box 8 3812.3403 1i" Gete Vaive & Va[Ve BOx 9 3$12.3008 8" Ca�EB V�IVe 8 Va[Y9 Box 3311 'f 0, �F 3311 i2 3311 10, � 3311 12 33 Ob 1 fi �F' 38 ii i7 TDh 33 �5 22 LF 33 72 1d EA 33 92 iD EA 33 12 20 EA 33 12 �0 EA 33 12 25 L5 485 30 Sl5 0.5 60 i 1 4 3 1 $74_00 13 33�'i.Q101 V9Cuum'I'sst Manhodes 14 53�5.�1 D9 TrenCh Saie 95 3331.4195 8" S�R-28 PVG Sewer Pipe 16 333S.i001 4' S�i. �la. Manhole 17 3359.10U3 A' Extra Depth Manho{e 'ES 5888.6i3U1 Conned to �ci9ti 4' �ia. C sanitary �ewer subtota! crrrcpr-acrwonn� ffiCANOtIHD CO3+}BiRUCCION BID PF€JPO����� AWARDH3 Y4tl7EC7& P� Bav�.d 7eamY �� 16251 38 0'! 9D EA 39 Q8 16 LF 381i 10, 33 31 12, LF 33 8'[ 20 33 3810, � 33 89 20 39 8910, vF sa ss za aa oo vo � 2 $28.Q� �56.�Q 32 $i�.SO $338.U0 32 �52.5Q $1,88D_00 9 $4,869.00 $4,889.00 & 5120.f1� $960.00 GO 4233,�id PSVpDsal s�c�riorr ao aa a� 1?eveloper Aw�ded Projects - PILOPD3AL FORh�i 7exes Industtip AdditioarIo. 3 Lot 2, Blcek 2 City Project #x�aoc iiNtT PIiICE BIR Ii�m 5torm prain Fati3ida� 19 3391A201 #5" RCP, 21 3941.9205 24" RCP, 22 3347.0602 B(i' FIC�, 23 3341.1402 75GL' 90X Project Item Ipiazmatioa Descrigtion SectianNo. I Measure Unit Prire I Bid value � �52.50 �2,835.60 $8d.5� :5�5,463.50 $322.90 $80,600.00 $530.50 $100,795.0� $1,56 $1,015.50 �7 q99.00 $7,499.00 $i 881.00 $9.762.00 $2,063.00 52,�3.d6 577,36d.0a 5�17,364.00 $19,�75.00 ffi19,575.00 $4,87�.25 $4,871.25 $108.00 �1,944.00 �23.00 $18d.[i0 $10 589.00 $i0 58A.OU $257,887.25 #38$��57.65 So�c IBadvrall, 1 W2-6'x1 all utiliiy irt E7rafn 1Alaterl3anit�ry Sewerl9to►cn Draln Faeiliti8s Su@totai 934110 LF 983 33 41 90 l.F 250 33411(3 LF 190 �a o5 �o �� en 33 49 10 EA 4 33 49 40 EA 2 93 49 46 EA 1 00 00 00 EA 1 fl0 00 0� �P. i 347115 LS 1 31 39 QO SY t8 3305'EO CY 8 UO 0� 00 LS 1 This bid is sulamiti�i hy ttie entity' lisied 6eEaw: Compaoy: Mlass Uiil'�UeB. LL.0 6y: Me4i nosa SireetAddroaa 33CQ Rodc island Rd , { GHy, StaSe, 71p Code: ]Ning'Y)( 7'Fx]60 Ptx�ne: (817S77o-i462 $Igndturo T�Se: F''M DaW: 63i15d24?2 CaehsctaregtsestoromplcceWOWCforFiNALACCEPTANCEwid� '� worldtt�da9�sRfterthcdatevrhsnthe CDDTI'RAGT wmmmcea to rx� w p�nvidM;n the C:enersl CondiE7oe*- �+ID UF S&L1TON crn �Fo�r wc�ttx 5'CAtII1ARDCQN6fRVCTiGNHQiPROC�I3AL-OI:VE[AI�RAWARDEDPRWECYS W 9143 Bid P�apoe�i l+mmlisNeed 3mimpd9, 7tr20 00 45 l2 DAP PREQUALIF[CAT10N SI'ATEMEN'C Page l of 1 SECTION OU 45 12 DAP — PREQUALIFICATION STATEMENT Each Bidder is required to complete the information below by identifying the prequaliiied contractors and/or subcontractors whom they intend to utilize far the major work type(s) Iisted. In the "Ma'or Work �pe" box provide the coznplete maior work type and actual description as provided bv the Water De artment %r watex and sewer and TPW for avin . Contractor/Subcontractor Company Name Prequalification Ex iration Date WastewatEr New De�elopment Open Cut 36" and under; Water New pe�elapment Open Cut Moss Utilities, LLC 04/30/2022 (16° and under); The undersigned hereby certifies that the cantractors and/or subcantractors described in the table above are currently prequalified for the worlc types listed. BIDDER: Moss Utilities, LLC 3300 Rock Island Ad. Irvin�, TX 75060 BY: (Signature} TITLE: .�� � S;� DaT�: 3, �� f 2�' END OF SECT�ON C{TY OF FORT WORFH Texas Industries Addition No 3, Lot 2 Block 2 5TANOAR� CONSTRUCTI�N PREQUALIRCATIQN STATEMENT— �EVELDPER AWAR6E� PR6JECfS City Project #103784 Form Version Septemher 1, 2015 Oa4526- 1 CONTRACTOR COMPLiANCB WIi'H WOItKER'S COMPENSATION LAW Page 1 of 1 sECTiorr fla as Zc CONTRACT�R COMPLIANCE WITH WORKER'S COMI'ENSATTON LAW Pursuant to Texas Labar Code Section 40&.a96(a}, as amended, Contractar certifies that it provides worker's campensation insurance coverage for all of its einployees employed on City Project Na 1U3784 . Contractor f�arther certifies ihat, pursuant to Texas Labor Code, Section AOb.096(b}, as amended, it will provide to City its su.bconiractar's certificates of compliance with worker's conrzpensation coverage. CUNTRACTOR: Moss Utilities LLC Company 3300 Rack Island Rd. Address Irvin TX 750Ga City/StatelZip By: ��iV' Sigr�at�.ire: Title: c�L THE STATE OF TEXAS COUNTY OF TARRANT BE��� k�e �s_ i�ned authority, on this day personally appeared 4� , known to nne to be the person whose name is subscribed to the foregoin instrum �t,�at�d acknowledged to me that he/she executeci #he same as the act and deed af '' �l� for the purposes and consideration therein expressed anci in the capacity therein stated. GIVEN ER,MY HAND AND SEAL OF OFFICE this �G� day of 2022. . � `���tiYFP{1���' ��gg��p pEqNN DAVlS N ry Public in an for the tate of Texas ?'`.�•";L %� Notary pub�ic, Stata of Texas ?�; �: T� Comm. �XPires 12-09-202b %'„�'o��:� Notary iD 433482$03 END OF SECTION n�u,� CIT`Y OF FORT WORTH Texas industries Addition No 3, Lot 2 Slock 2 STANDAIiD CONSTRUCTTON SPECFFICATION DOCUMHNTS CiYy Project # 143784 ltevised April 2, 2D i4 April 26, 2022 OOS243-2 Developer Awarded Project Agreement Page 2 of 4 Article 4. CUNTRACT PRICE I3eveloper a,grees to pay Contractor for performance af the Work in accordance with the Contract Dacuments an arnount in current funds of Three FIundred Ei�htv Ei�ht T6ausand Twa �iundred Fiftv Seven & SS/1Q� Dollars ($388,257.551 Ar�icle 5. CQ1tiTTRACT DOCUMENTS 5.1 CONTEh1TS: A. The Contract Documen#s wvhich comprise the entire agreement between Developer and Conttactar concerning tha Work consist of the fallawing: 1. This Agreement. 2. Atkachments to this Agreement: a. Bid Farm {As provided by Developer) 1} Propvsal Fonn (DAP Version} 2) Prequalification Statement 3) S#ate and Federal docutzien#s (project specific) b. Insurance ACORD Form(s} c. Pay;nent Bond (DAP Version} d. Perfarmance Bond (DAP Version) e. Maintenance Bond (DAP Version} f. Power of Attarney for the Bonds g. Worker's Compensation Afftdavit h. MBE and/or SBE Comrrtitment Fortn {If required) 3. Standard City General Conditions o#' the Consiruction Cantract for Developer Awarded Projects. 4. Si�pplementary Conditions. 5. Specifications specifieally made a part of the Contract Documents by attachment or, if not attached, as incorporated by reference and described in the Table of Contents of the Project's Contraet Documents. 6. Drawings. 7. Addenda. 8. Documentation submitted by Cantractor prior to Natice of Award. 9. The following which may be delivered or issued after the Effective Date af the Agreement and, if issued, become an incorporated part af the Contraot Documents: a. Notice to Pi�ocesd. b. Field �rders. c. Char�ge Orders. d. �.etter of Final Acceptance, CIT'Y OF FORT WORTH Texas Industries Addition No 3, Lot 2 Block 2 STANbARD CONSTRUCTiON SPEC[FICATION DOCtJMIIdTS —DAP City Project #103784 Revised 3una 16, 201d 005243-3 Developer Awarded Project Agreement Psge 3 aF4 Article 6. INDEMNIFICATIO1wT 6.1 Cantractar cavena�nts and agrees fo indemnify, hold harmless and defend, at its own ezpense, the city, its af�cers, servants and emplayees, from and against any and a!I cAaims arising out of, ar aIIeged to arise oat of, the work and services to be performed by the contractor, its officers, agents, employees, subcontractars, licenses or inviEees under this contract. This indemni�cation nrovisian is spec�cally intended to onerate and be effeciive eveu if it is alleeed or uroven tlxat mil or some of the damages beinQ sought were caused in whale or in qart, bv anv act, omission or ne�ligencs of the eity. This indemnity provision is intended to include, without limitation, inde�tnnity far costs, expenses auci legal fees incurred by the city in defending agaiust sueh claims and causss af actions. 6.2 Contractar coven�nts and agrees to indemnify and hold harmless, at its own egpense, the ciky, its off'�cers, servants aud enaployees, fram and against any �nd all loss, damage or destruction of property of the city, arising out af, or aileged to arise out af, the work and services to 6e perfarmed by fhe con#ractor, its officers, agents, employees, subcon�tractors, licensees or invitees under this contract This indemnification r�visian is s eci#icall int to o eraie aud be ef%c#ive even if it is alle ed or proven that all or some of he dama�es bein� sou�ht were caused, in whole ar in part, bv anv act, omission or negC eig nce of t�xe citv, Article �. MISCELLANEf)US 7.1 Terms. Terms used in this Agreement are defined in Article 1 af the Standard City Conditions of the Constructian Contract for Develo�er Awarded Projects. 7.2 Assignment of Contract. T'his Agreement, including a11 of the Con#ract Documents may not be assigned by the Contractor without the advanced express written cansent af the De��elaper. 7.3 Successors and Assigns. Developer and Contraetar each binds itself, its partners, successors, assigns and legal rapresentatives to tlne ather party hereto, in respect Yo all covenants, agreements and obligatians contained in the Contract Dacutnents. '7.4 Severability. Any pravision or part oi the Contract Dacuments held to be unconstitutional, void or unenfarceable by a court of competent jurisdiction shall be deemed stricken, and all remaining provisions sl�all continue to be �valid and bindin; upon DEVELflPER and CONTR.ACTOR. 7.5 Goveming Law and Venue. This Agreement, including all of the Contract Docwnents is perfarmable in the S#ate of Te�cas. Venue shall be Tanant Cou�ty, Texas, or the United States Dis#rict Court far the Northern District of Texas, Fort Warth Division. CITY OF FORT WORTH Texas Industries Additson Na 3, Lot 2 Block 2 STANDAR[3 CONSTRUCTIQN SPECIFICATION DOCCJMENTS —DAP City Froject # 3p3784 Revised June 16, 2Qlb 04/26/2022 Additional Insured — Automatic — Owners, Lessees Or Contractors � �r��i�� THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. Policy No. GLO 0187957-05 Effective Date: ��1�22 This endorsement modifies insurance provided under the: Commercial General Liability Coverage Part A. Section II — Who Is An Insured is amended to include as an additional insured any person or organization whom you are required to add as an additional insured under a written contract or written agreement executed by you, but only with respect to liability for "bodily injury", "property damage" or "personal and advertising injury" and subject to the following: 1. If such written contract or written agreement specifically requires that you provide that the person or organization be named as an additional insured under one or both of the following endorsements: a. The Insurance Services Office (ISO) ISO CG 20 10 (10/01 edition); or b. The ISO CG 20 37 (10/01 edition), such person or organization is then an additional insured with respect to such endorsement(s), but only to the extent that "bodily injury", "property damage" or "personal and advertising injury" arises out of: (1) Your ongoing operations, with respect to Paragraph 1.a. above; or (2) "Your work", with respect to Paragraph 1.b. above, which is the subject of the written contract or written agreement. However, solely with respect to this Paragraph 1., insurance afforded to such additional insured: (a) Only applies if the "bodily injury", "property damage" or "personal and advertising injury" offense occurs during the policy period and subsequent to your execution of the written contract or written agreement; and (b) Does not apply to "bodily injury" or "property damage" caused by "your work" and included within the "products-completed operations hazard" unless the written contract or written agreement specifically requires that you provide such coverage to such additional insured. 2. If such written contract or written agreement specifically requires that you provide that the person or organization be named as an additional insured under one or both of the following endorsements: a. The Insurance Services Office (ISO) ISO CG 20 10 (07/04 edition); or b. The ISO CG 20 37 (07/04 edition), such person or organization is then an additional insured with respect to such endorsement(s), but only to the extent that "bodily injury", "property damage" or "personal and advertising injury" is caused, in whole or in part, by: (1) Your acts or omissions; or (2) The acts or omissions of those acting on your behalf, U-GL-2162-A CW (02/19) Page 1 of 4 Includes copyrighted material of Insurance Services Office, Inc., with its permission. in the performance of: (a) Your ongoing operations, with respect to Paragraph 2.a. above; or (b) "Your work" and included in the "products-completed operations hazard", with respect to Paragraph 2.b. above, which is the subject of the written contract or written agreement. However, solely with respect to this Paragraph 2., insurance afforded to such additional insured: (i) Only applies if the "bodily injury", "property damage" or "personal and advertising injury" offense occurs during the policy period and subsequent to your execution of the written contract or written agreement; and (ii) Does not apply to "bodily injury" or "property damage" caused by "your work" and included within the "products-completed operations hazard" unless the written contract or written agreement specifically requires that you provide such coverage to such additional insured. 3. If neither Paragraph 1. nor Paragraph 2. above apply and such written contract or written agreement requires that you provide that the person or organization be named as an additional insured: a. Under the ISO CG 20 10 (04/13 edition, any subsequent edition or if no edition date is specified); or b. With respect to ongoing operations (if no form is specified), such person or organization is then an additional insured only to the extent that "bodily injury", "property damage" or "personal and advertising injury" is caused, in whole or in part by: (1) Your acts or omissions; or (2) The acts or omissions of those acting on your behalf, in the performance of your ongoing operations, which is the subject of the written contract or written agreement. However, solely with respect to this Paragraph 3., insurance afforded to such additional insured: (a) Only applies to the extent permitted by law; (b) Will not be broader than that which you are required by the written contract or written agreement to provide for such additional insured; and (c) Only applies if the "bodily injury", "property damage" or "personal and advertising injury" offense occurs during the policy period and subsequent to your execution of the written contract or written agreement. 4. If neither Paragraph 1. nor Paragraph 2. above apply and such written contract or written agreement requires that you provide that the person or organization be named as an additional insured: a. Under the ISO CG 20 37 (04/13 edition, any subsequent edition or if no edition date is specified); or b. With respect to the "products-completed operations hazard" (if no form is specified), such person or organization is then an additional insured only to the extent that "bodily injury" or "property damage" is caused, in whole or in part by "your work" and included in the "products-completed operations hazard", which is the subject of the written contract or written agreement. However, solely with respect to this Paragraph 4., insurance afforded to such additional insured: (1) Only applies to the extent permitted by law; (2) Will not be broader than that which you are required by the written contract or written agreement to provide for such additional insured; (3) Only applies if the "bodily injury" or "property damage" occurs during the policy period and subsequent to your execution of the written contract or written agreement; and (4) Does not apply to "bodily injury" or "property damage" caused by "your work" and included within the "products-completed operations hazard" unless the written contract or written agreement specifically requires that you provide such coverage to such additional insured. U-GL-2162-A CW (02/19) Page 2 of 4 Includes copyrighted material of Insurance Services Office, Inc., with its permission. B. Solely with respect to the insurance afforded to any additional insured referenced in Section A. of this endorsement, the following additional exclusion applies: This insurance does not apply to "bodily injury", "property damage" or "personal and advertising injury" arising out of the rendering of, or failure to render, any professional architectural, engineering or surveying services including: 1. The preparing, approving or failing to prepare or approve maps, shop drawings, opinions, reports, surveys, field orders, change orders or drawings and specifications; or 2. Supervisory, inspection, architectural or engineering activities. This exclusion applies even if the claims against any insured allege negligence or other wrongdoing in the supervision, hiring, employment, training or monitoring of others by that insured, if the "occurrence" which caused the "bodily injury" or "property damage", or the offense which caused the "personal and advertising injury", involved the rendering of or the failure to render any professional architectural, engineering or surveying services. C. Solely with respect to the coverage provided by this endorsement, the following is added to Paragraph 2. Duties In The Event Of Occurrence, Offense, Claim Or Suit of Section IV — Commercial General Liability Conditions: The additional insured must see to it that: (1) We are notified as soon as practicable of an "occurrence" or offense that may result in a claim; (2) We receive written notice of a claim or "suit" as soon as practicable; and (3) A request for defense and indemnity of the claim or "suiY' will promptly be brought against any policy issued by another insurer under which the additional insured may be an insured in any capacity. This provision does not apply to insurance on which the additional insured is a Named Insured if the written contract or written agreement requires that this coverage be primary and non-contributory. D. Solely with respect to the coverage provided by this endorsement: 1. The following is added to the Other Insurance Condition of Section IV — Commercial General Liability Conditions: Primary and Noncontributory insurance This insurance is primary to and will not seek contribution from any other insurance available to an additional insured provided that: a. The additional insured is a Named Insured under such other insurance; and b. You are required by written contract or written agreement that this insurance be primary and not seek contribution from any other insurance available to the additional insured. 2. The following paragraph is added to Paragraph 4.b, of the Other Insurance Condition under Section IV — Commercial General Liability Conditions: This insurance is excess over: Any of the other insurance, whether primary, excess, contingent or on any other basis, available to an additional insured, in which the additional insured on our policy is also covered as an additional insured on another policy providing coverage for the same "occurrence", offense, claim or "suit". This provision does not apply to any policy in which the additional insured is a Named Insured on such other policy and where our policy is required by a written contract or written agreement to provide coverage to the additional insured on a primary and non- contributory basis. E. This endorsement does not apply to an additional insured which has been added to this Coverage Part by an endorsement showing the additional insured in a Schedule of additional insureds, and which endorsement applies specifically to that identified additional insured. F. Solely with respect to the insurance afforded to an additional insured under Paragraph A.3. or Paragraph A.4. of this endorsement, the following is added to Section III — Limits Of Insurance: Additional Insured — Automatic — Owners, Lessees Or Contractors Limit The most we will pay on behalf of the additional insured is the amount of insurance: U-GL-2162-A CW (02/19) Page 3 of 4 Indudes copyrighted material of Insurance Services Office, Inc., with its permission. 1. Required by the written contract or written agreement referenced in Section A. of this endorsement; or 2. Available under the applicable Limits of Insurance shown in the Declarations, whichever is less. This endorsement shall not increase the applicable Limits of Insurance shown in the Declarations. All other terms, conditions, provisions and exclusions of this policy remain the same. U-GL-2162-A CW (02/19) Page 4 of 4 Indudes copyrighted material of Insurance Services Office, Inc., with its permission. Forming A Part of Policy No. GLO 0187957-05 COMMERCIAL GENERAL LIABILITY CG 20 07 0413 THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. ADDITIONAL INSURED - ENGINEERS, ARCHITECTS OR SURVEYORS This endorsement modifies insurance provided under the following: COMMERCIAL GENERAL LIABILITY COVERAGE PART A. Sectan II — Who Is An Insured is amended to include as an additional insured any architect, engineer, or surveyor engaged by you but only with respect to liability for "bodily injury", "property damage" or "personal and advertising injury" caused, in whole or in part, by your acts or omissions or the acts or omissions of those acting on your behalf: 1. In connection with your premises; or 2. In the performance operations. of your ongoing However: 1. The insurance afforded to such additional insured only applies to the extent permitted by law; and 2. If coverage provided to the additional insured is required by a contract or agreement, the insurance afforded to such additional insured will not be broader than that which you are required by the contract or agreement to provide for such additional insured. B. With respect to the insurance afforded to these additional insureds, the following additional exclusion applies: This insurance does not apply to "bodily injury", "property damage" or "personal and advertising injury" arising out of the rendering of or the failure to render any professional services by or for you, including: 1. The preparing, approving, or failing to prepare or approve, maps, shop drawings, opinions, reports, surveys, field orders, change orders or drawings and specifications; or 2. Supervisory, inspection, architectural or engineering activities. This exclusion applies even if the claims against any insured allege negligence or other wrongdoing in the supervision, hiring, employment, training or monitoring of others by that insured, if the "occurrence" which caused the "bodily injury" or "property damage", or the offense which caused the "personal and advertising injury", involved the rendering of or the failure to render any professional services by or for you. C. With respect to the insurance afforded to these additional insureds, the following is added to Section III — Limits Of Insurance: If coverage provided to the additional insured is required by a contract or agreement, the most we will pay on behalf of the additional insured is the amount of insurance: 1. Required by the contract or agreement; or 2. Available under the applicable Limits of Insurance shown in the Declarations; whichever is less. This endorsement shall not increase the applicable Limits of Insurance shown in the Declarations. CG 20 07 0413 :� Insurance Services Office, Inc., 2012 Page 1 of 1 Coverage Extension Endorsement � ������ Policy No. Eff. Date of Pol. Exp. Date of Pol. Ef£ Date of End. Producer No. Add' I. Prem Return Prem. BAP0187958-0 7/1/22 7/1/23 7/1/22 5o85s000 INCL THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. This endorsement modifies insurance provided under the: Business Auto Coverage Form Motor Carrier Coverage Form A. Amended Who Is An Insured 1. The following is added to the Who Is An Insured Provision in Section II — Covered Autos Liability Coverage: The following are also "insureds": a. Any "employee" of yours is an "insured" while using a covered "auto" you don't own, hire or borrow for acts performed within the scope of employment by you. Any "employee" of yours is also an "insured" while operating an "auto" hired or rented under a contract or agreement in an "employee's" name, with your permission, while performing duties related to the conduct of your business. b. Anyone volunteering services to you is an "insured" while using a covered "auto" you don't own, hire or borrow to transport your clients or other persons in activities necessary to your business. c. Anyone else who furnishes an "auto" referenced in Paragraphs A.1.a. and A.1.b. in this endorsement. d. Where and to the extent permitted by law, any person(s) or organization(s) where required by written contract or written agreement with you executed prior to any "accident", including those person(s) or organization(s) directing your work pursuant to such written contract or written agreement with you, provided the "accident" arises out of operations governed by such contract or agreement and only up to the limits required in the written contract or written agreement, or the Limits of Insurance shown in the Declarations, whichever is less. 2. The following is added to the Other Insurance Condition in the Business Auto Coverage Form and the Other Insurance — Primary and Excess Insurance Provisions Condition in the Motor Carrier Coverage Form: Coverage for any person(s) or organization(s), where required by written contract or written agreement with you executed prior to any "accident", will apply on a primary and non-contributory basis and any insurance maintained by the additional "insured" will apply on an excess basis. However, in no event will this coverage extend beyond the terms and conditions of the Coverage Form. B. Amendment — Supplementary Payments Paragraphs a.(2) and a.(4) of the Coverage Extensions Provision in Section II — Covered Autos Liability Coverage are replaced by the following: (2) Up to $5,000 for the cost of bail bonds (including bonds for related traffic law violations) required because of an "accidenY' we cover. We do not have to furnish these bonds. (4) All reasonable expenses incurred by the "insured" at our request, including actual loss of earnings up to $500 a day because of time off from work. U-CA-424-F CW (04-14) Page 1 of 6 Indudes copyrighted material of Insurance Services Office, Inc., with its permission. C. Fellow Employee Coverage The Fellow Employee Exclusion contained in Section II — Covered Autos Liability Coverage does not apply. D. Driver Safety Program Liability and Physical Damage Coverage 1. The following is added to the Racing Exclusion in Section II — Covered Autos Liability Coverage: This exclusion does not apply to covered "autos" participating in a driver safety program event, such as, but not limited to, auto or truck rodeos and other auto or truck agility demonstrations. 2. The following is added to Paragraph 2. in the Exclusions of Section III — Physical Damage Coverage of the Business Auto Coverage Form and Paragraph 2.b. in the Exclusions of Section IV — Physical Damage Coverage of the Motor Carrier Coverage Form: This exclusion does not apply to covered "autos" participating in a driver safety program event, such as, but not limited to, auto or truck rodeos and other auto or truck agility demonstrations. E. Lease or Loan Gap Coverage The following is added to the Coverage Provision of the Physical Damage Coverage Section: Lease Or Loan Gap Coverage In the event of a total "loss" to a covered "auto", we will pay any unpaid amount due on the lease or loan for a covered "auto", less: a. Any amount paid under the Physical Damage Coverage Section of the Coverage Form; and b. Any: (1) Overdue lease or loan payments at the time of the "loss"; (2) Financial penalties imposed under a lease for excessive use, abnormal wear and tear or high mileage; (3) Security deposits not returned by the lessor; (4) Costs for extended warranties, credit life insurance, health, accident or disability insurance purchased with the loan or lease; and (5) Carry-over balances from previous leases or loans. F. Towing and Labor Paragraph A.2. of the Physical Damage Coverage Section is replaced by the following: We will pay up to $75 for towing and labor costs incurred each time a covered "auto" of the private passenger type is disabled. However, the labor must be performed at the place of disablement. G. Extended Glass Coverage The following is added to Paragraph A.3.a. of the Physical Damage Coverage Section: If glass must be replaced, the deductible shown in the Declarations will apply. However, if glass can be repaired and is actually repaired rather than replaced, the deductible will be waived. You have the option of having the glass repaired rather than replaced. H. Hired Auto Physical Damage — Increased Loss of Use Expenses The Coverage Extension for Loss Of Use Expenses in the Physical Damage Coverage Section is replaced by the following: Loss Of Use Expenses For Hired Auto Physical Damage, we will pay expenses for which an "insured" becomes legally responsible to pay for loss of use of a vehicle rented or hired without a driver under a written rental contract or written rental agreement. We will pay for loss of use expenses if caused by: U-CA-424-F CW (04-14) Page 2 of 6 Indudes copyrighted material of Insurance Services Office, Inc., with its permission. (1) Other than collision only if the Declarations indicate that Comprehensive Coverage is provided for any covered "auto"; (2) Specified Causes Of Loss only if the Declarations indicate that Specified Causes Of Loss Coverage is provided for any covered "auto"; or (3) Collision only if the Declarations indicate that Collision Coverage is provided for any covered "auto". However, the most we will pay for any expenses for loss of use is $100 per day, to a maximum of $3000. I. Personal Effects Coverage The following is added to the Coverage Provision of the Physical Damage Coverage Section: Personal Effects Coverage a. We will pay up to $750 for "loss" to personal effects which are: (1) Personal property owned by an "insured"; and (2) In or on a covered "auto". b. Subject to Paragraph a. above, the amount to be paid for "loss" to personal effects will be based on the lesser of: (1) The reasonable cost to replace; or (2) The actual cash value. c. The coverage provided in Paragraphs a. and b. above, only applies in the event of a total theft of a covered "auto". No deductible applies to this coverage. However, we will not pay for "loss" to personal effects of any of the following: (1) Accounts, bills, currency, deeds, evidence of debt, money, notes, securities, or commercial paper or other documents of value. (2) Bullion, gold, silver, platinum, or other precious alloys or metals; furs or fur garments; jewelry, watches, precious or semi-precious stones. (3) Paintings, statuary and other works of art. (4) Contraband or property in the course of illegal transportation or trade. (5) Tapes, records, discs or other similar devices used with audio, visual or data electronic equipment. Any coverage provided by this Provision is excess over any other insurance coverage available for the same "loss". J. Tapes, Records and Discs Coverage 1. The Exclusion in Paragraph B.4.a. of Section III — Physical Damage Coverage in the Business Auto Coverage Form and the Exclusion in Paragraph B.2.c. of Section IV — Physical Damage Coverage in the Motor Carrier Coverage Form does not apply. 2. The following is added to Paragraph 1.a. Comprehensive Coverage under the Coverage Provision of the Physical Damage Coverage Section: We will pay for "loss" to tapes, records, discs or other similar devices used with audio, visual or data electronic equipment. We will pay only if the tapes, records, discs or other similar audio, visual or data electronic devices: (a) Are the property of an "insured"; and (b) Are in a covered "auto" at the time of "loss". The most we will pay for such "loss" to tapes, records, discs or other similar devices is $500. The Physical Damage Coverage Deductible Provision does not apply to such "loss". U-CA-424-F CW (04-14) Page 3 of 6 Indudes copyrighted material of Insurance Services Office, Inc., with its permission. K. Airbag Coverage The Exclusion in Paragraph B.3.a. of Section III — Physical Damage Coverage in the Business Auto Coverage Form and the Exclusion in Paragraph B.4.a. of Section IV — Physical Damage Coverage in the Motor Carrier Coverage Form does not apply to the accidental discharge of an airbag. L. Two or More Deductibles The following is added to the Deductible Provision of the Physical Damage Coverage Section: If an accident is covered both by this policy or Coverage Form and by another policy or Coverage Form issued to you by us, the following applies for each covered "auto" on a per vehicle basis: 1. If the deductible on this policy or Coverage Form is the smaller (or smallest) deductible, it will be waived; or 2. If the deductible on this policy or Coverage Form is not the smaller (or smallest) deductible, it will be reduced by the amount of the smaller (or smallest) deductible. M. Physical Damage — Comprehensive Coverage — Deductible The following is added to the Deductible Provision of the Physical Damage Coverage Section: Regardless of the number of covered "autos" damaged or stolen, the maximum deductible that will be applied to Comprehensive Coverage for all "loss" from any one cause is $5,000 or the deductible shown in the Declarations, whichever is greater. N. Temporary Substitute Autos — Physical Damage 1. The following is added to Section I— Covered Autos: Temporary Substitute Autos — Physical Damage If Physical Damage Coverage is provided by this Coverage Form on your owned covered "autos", the following types of vehicles are also covered "autos" for Physical Damage Coverage: Any "auto" you do not own when used with the permission of its owner as a temporary substitute for a covered "auto" you do own but is out of service because of its: 1. Breakdown; 2. Repair; 3. Servicing; 4. "Loss"; or 5. Destruction. 2. The following is added to the Paragraph A. Coverage Provision of the Physical Damage Coverage Section: Temporary Substitute Autos — Physical Damage We will pay the owner for "loss" to the temporary substitute "auto" unless the "loss" results from fraudulent acts or omissions on your part. If we make any payment to the owner, we will obtain the owner's rights against any other party. The deductible for the temporary substitute "auto" will be the same as the deductible for the covered "auto" it replaces. O. Amended Duties In The Event Of Accident, Claim, Suit Or Loss Paragraph a. of the Duties In The Event Of Accident, Claim, Suit Or Loss Condition is replaced by the following: a. In the event of "accident", claim, "suit" or "loss", you must give us or our authorized representative prompt notice of the "accident", claim, "suiY' or "loss". However, these duties only apply when the "accident", claim, "suit" or "loss" is known to you (if you are an individual), a partner (if you are a partnership), a member (if you are a limited liability company) or an executive officer or insurance manager (if you are a corporation). The failure of any U-CA-424-F CW (04-14) Page 4 of 6 Indudes copyrighted material of Insurance Services Office, Inc., with its permission. agent, servant or employee of the "insured" to notify us of any "accident", claim, "suiY' or "loss" shall not invalidate the insurance afforded by this policy. Include, as soon as practicable: (1) How, when and where the "accident" or "loss" occurred and if a claim is made or "suit" is brought, written notice of the claim or "suit" including, but not limited to, the date and details of such claim or "suiY'; (2) The "insured's" name and address; and (3) To the extent possible, the names and addresses of any injured persons and witnesses. If you report an "accident", claim, "suit" or "loss" to another insurer when you should have reported to us, your failure to report to us will not be seen as a violation of these amended duties provided you give us notice as soon as practicable after the fact of the delay becomes known to you. P. Waiver of Transfer Of Rights Of Recovery Against Others To Us The following is added to the Transfer Of Rights Of Recovery Against Others To Us Condition: This Condition does not apply to the extent required of you by a written contract, executed prior to any "accidenY' or "loss", provided that the "accidenY' or "loss" arises out of operations contemplated by such contract. This waiver only applies to the person or organization designated in the contract. Q. Employee Hired Autos — Physical Damage Paragraph b. of the Other Insurance Condition in the Business Auto Coverage Form and Paragraph f. of the Other Insurance — Primary and Excess Insurance Provisions Condition in the Motor Carrier Coverage Form are replaced by the following: For Hired Auto Physical Damage Coverage, the following are deemed to be covered "autos" you own: (1) Any covered "auto" you lease, hire, rent or borrow; and (2) Any covered "auto" hired or rented under a written contract or written agreement entered into by an "employee" or elected or appointed official with your permission while being operated within the course and scope of that "employee's" employment by you or that elected or appointed official's duties as respect their obligations to you. However, any "auto" that is leased, hired, rented or borrowed with a driver is not a covered "auto". R. Unintentional Failure to Disclose Hazards The following is added to the Concealment, Misrepresentation Or Fraud Condition: However, we will not deny coverage under this Coverage Form if you unintentionally: (1) Fail to disclose any hazards existing at the inception date of this Coverage Form; or (2) Make an error, omission, improper description of "autos" or other misstatement of information. You must notify us as soon as possible after the discovery of any hazards or any other information that was not provided to us prior to the acceptance of this policy. S. Hired Auto — World Wide Coverage Paragraph 7a.(5) of the Policy Period, Coverage Territory Condition is replaced by the following: (5) Anywhere in the world if a covered "auto" is leased, hired, rented or borrowed for a period of 60 days or less, T. Bodily Injury Redefined The definition of "bodily injury" in the Definitions Section is replaced by the following: "Bodily injury" means bodily injury, sickness or disease, sustained by a person including death or mental anguish, resulting from any of these at any time. Mental anguish means any type of inental or emotional illness or disease. U-CA-424-F CW (04-14) Page 5 of 6 Indudes copyrighted material of Insurance Services Office, Inc., with its permission. U. Expected Or Intended Injury The Expected Or Intended Injury Exclusion in Paragraph B. Exclusions under Section II — Covered Auto Liability Coverage is replaced by the following: Expected Or Intended Injury "Bodily injury" or "property damage" expected or intended from the standpoint of the "insured". This exclusion does not apply to "bodily injury" or "property damage" resulting from the use of reasonable force to protect persons or property. V. Physical Damage — Additional Temporary Transportation Expense Coverage Paragraph A.4.a. of Section III — Physical Damage Coverage is replaced by the following: 4. Coverage Extensions a. Transportation Expenses We will pay up to $50 per day to a maximum of $1,000 for temporary transportation expense incurred by you because of the total theft of a covered "auto" of the private passenger type. We will pay only for those covered "autos" for which you carry either Comprehensive or Specified Causes of Loss Coverage. We will pay for temporary transportation expenses incurred during the period beginning 48 hours after the theft and ending, regardless of the policy's expiration, when the covered "auto" is returned to use or we pay for its "loss". W. Replacement of a Private Passenger Auto with a Hybrid or Alternative Fuel Source Auto The following is added to Paragraph A. Coverage of the Physical Damage Coverage Section: In the event of a total "loss" to a covered "auto" of the private passenger type that is replaced with a hybrid "auto" or "auto" powered by an alternative fuel source of the private passenger type, we will pay an additional 10% of the cost of the replacement "auto", excluding tax, title, license, other fees and any aftermarket vehicle upgrades, up to a maximum of $2500. The covered "auto" must be replaced by a hybrid "auto" or an "auto" powered by an alternative fuel source within 60 calendar days of the payment of the "loss" and evidenced by a bill of sale or new vehicle lease agreement. To qualify as a hybrid "auto", the "auto" must be powered by a conventional gasoline engine and another source of propulsion power. The other source of propulsion power must be electric, hydrogen, propane, solar or natural gas, either compressed or liquefied. To qualify as an "auto" powered by an alternative fuel source, the "auto" must be powered by a source of propulsion power other than a conventional gasoline engine. An "auto" solely propelled by biofuel, gasoline or diesel fuel or any blend thereof is not an "auto" powered by an alternative fuel source. X. Return of Stolen Automobile The following is added to the Coverage Extension Provision of the Physical Damage Coverage Section: If a covered "auto" is stolen and recovered, we will pay the cost of transport to return the "auto" to you. We will pay only for those covered "autos" for which you carry either Comprehensive or Specified Causes of Loss Coverage. All other terms, conditions, provisions and exclusions of this policy remain the same. U-CA-424-F CW (04-14) Page 6 of 6 Indudes copyrighted material of Insurance Services Office, Inc., with its permission. � General Liability Supplemental Coverage Endorsement ZURICH � THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. Policy No. GLO 0187957-05 Effective Date: 07/01/2022 This endorsement modifies insurance provided under the: Commercial General Liability Coverage Part The following changes apply to this Coverage Part. However, endorsements attached to this Coverage Part will supersede any provisions to the contrary in this General Liability Supplemental Coverage Endorsement. A. Broadened Named Insured 1. The following is added to Section II — Who Is An Insured: Any organization of yours, other than a partnership or joint venture, which is not shown in the Declarations, and over which you maintain an ownership interest of more than 50% of such organization as of the effective date of this Coverage Part, will qualify as a Named Insured. However, such organization will not qualify as a Named Insured under this provision if it: a. Is newly acquired or formed during the policy period; b. Is also an insured under another policy, other than a policy written to apply specifically in excess of this Coverage Part; or c. Would be an insured under another policy but for its termination or the exhaustion of its limits of insurance. Each such organization remains qualified as a Named Insured only while you maintain an ownership interest of more than 50% in the organization during the policy period. 2. The last paragraph of Section II — Who Is An Insured does not apply to this provision to the extent that such paragraph would conflict with this provision. B. Newly Acquired or Formed Organizations as Named Insureds 1. Paragraph 3. of Section II — Who Is An Insured is replaced by the following: 3. Any organization you newly acquire or form during the policy period, other than a partnership or joint venture, and over which you maintain an ownership interest of more than 50% of such organization, will qualify as a Named Insured if there is no other similar insurance available to that organization. However: a. Coverage under this provision is afforded only until the 180'" day after you acquire or form the organization or the end of the policy period, whichever is earlier; b. Coverage A does not apply to "bodily injury" or "property damage" that occurred before you acquired or formed the organization; and c. Coverage B does not apply to "personal and advertising injury" arising out of an offense committed before you acquired or formed the organization. An additional premium will apply in accordance with our rules and rates in effect on the date you acquired or formed the organization. U-GL-1345-C CW (03/20) Page 1 of 12 Includes copyrighted material of Insurance Services Office, Inc., with its permission. 2. The last paragraph of Section II — Who Is An Insured does not apply to this provision to the extent that such paragraph would conflict with this provision. C. Insured Status — Employees Paragraph 2.a.(1) of Section II — Who Is An Insured is replaced by the following: 2. Each of the following is also an insured: a. Your "volunteer workers" only while performing duties related to the conduct of your business, or your "employees", other than either your "executive officers" (if you are an organization other than a partnership, joint venture or limited liability company) or your managers (if you are a limited liability company), but only for acts within the scope of their employment by you or while performing duties related to the conduct of your business. However, none of these "employees" or "volunteer workers" are insureds for: (1) "Bodily injury" or "personal and advertising injury": (a) To you, to your partners or members (if you are a partnership orjoint venture), to your members (if you are a limited liability company), to a co='employee" while in the course of his or her employment or performing duties related to the conduct of your business, or to your other "volunteer workers" while performing duties related to the conduct of your business; (b) To the spouse, child, parent, brother or sister of that co-"employee" or "volunteer worker" as a consequence of Paragraph (1)(a) above; (c) For which there is any obligation to share damages with or repay someone else who must pay damages because of the injury described in Paragraphs (1)(a) or (b) above; or (d) Arising out of his or her providing or failing to provide professional health care services. However: Paragraphs (1)(a) and (1)(d) do not apply to your "employees" or "volunteer workers", who are not employed by you or volunteering for you as health care professionals, for "bodily injury" arising out of "Good Samaritan Acts" while the "employee" or "volunteer worker" is performing duties related to the conduct of your business. "Good Samaritan Acts" mean any assistance of a medical nature rendered or provided in an emergency situation for which no remuneration is demanded or received. Paragraphs (1)(a), (b) and (c) do not apply to any "employee" designated as a supervisor or higher in rank, with respect to "bodily injury" to co-"employees". As used in this provision, "employees" designated as a supervisor or higher in rank means only "employees" who are authorized by you to exercise direct or indirect supervision or control over "employees" or "volunteer workers" and the manner in which work is performed. D. Additional Insureds — Lessees of Premises 1. Section II — Who Is An Insured is amended to include as an additional insured any person(s) or organization(s) who leases or rents a part of the premises you own or manage who you are required to add as an additional insured on this policy under a written contract or written agreement, but only with respect to liability arising out of your ownership, maintenance or repair of that part of the premises which is not reserved for the exclusive use or occupancy of such person or organization or any other tenant or lessee. This provision does not apply after the person or organization ceases to lease or rent premises from you. However, the insurance afforded to such additional insured: a. Only applies to the extent permitted by law; and b. Will not be broader than that which you are required by the written contract or written agreement to provide for such additional insured. 2. With respect to the insurance afforded to the additional insureds under this endorsement, the following is added to Section III — Limits Of Insurance: The most we will pay on behalf of the additional insured is the amount of insurance: U-GL-1345-C CW (03/20) Page 2 of 12 Includes copyrighted material of Insurance Services Office, Inc., with its permission. a. Required by the written contract or written agreement referenced in Subparagraph D.1. above (of this endorsement); or b. Available under the applicable Limits of Insurance shown in the Declarations, whichever is less. This Paragraph D. shall not increase the applicable Limits of Insurance shown in the Declarations. E. Additional Insured — Vendors 1. The following change applies if this Coverage Part provides insurance to you for "bodily injury" and "property damage" included in the "products-completed operations hazard": Section II — Who Is An Insured is amended to include as an additional insured any person or organization (referred to throughout this Paragraph E. as vendor) who you have agreed in a written contract or written agreement, prior to loss, to name as an additional insured, but only with respect to "bodily injury" or "property damage" arising out of "your products" which are distributed or sold in the regular course of the vendor's business: However, the insurance afforded to such vendor: a. Only applies to the extent permitted by law; and b. Will not be broader than that which you are required by the written contract or written agreement to provide for such vendor. 2. With respect to the insurance afforded to these vendors, the following additional exclusions apply: a. The insurance afforded the vendor does not apply to: (1) "Bodily injury" or "property damage" for which the vendor is obligated to pay damages by reason of the assumption of liability in a contract or agreement. This exclusion does not apply to liability for damages that the vendor would have in the absence of the contract or agreement; (2) Any express warranty unauthorized by you; (3) Any physical or chemical change in the product made intentionally by the vendor; (4) Repackaging, except when unpacked solely for the purpose of inspection, demonstration, testing, or the substitution of parts under instructions from the manufacturer, and then repackaged in the original container; (5) Any failure to make such inspections, adjustments, tests or servicing as the vendor has agreed to make or normally undertakes to make in the usual course of business, in connection with the distribution or sale of the products; (6) Demonstration, installation, servicing or repair operations, except such operations performed at the vendor's premises in connection with the sale of the product; (7) Products which, after distribution or sale by you, have been labeled or relabeled or used as a container, part or ingredient of any other thing or substance by or for the vendor; or (8) "Bodily injury" or "property damage" arising out of the sole negligence of the vendor for its own acts or omissions or those of its employees or anyone else acting on its behalf. However, this exclusion does not apply to: (a) The exceptions contained in Subparagraphs (4) or (6); or (b) Such inspections, adjustments, tests or servicing as the vendor has agreed to make or normally undertakes to make in the usual course of business, in connection with the distribution or sale of the products. b. This insurance does not apply to any insured person or organization, from whom you have acquired such products, or any ingredient, part or container, entering into, accompanying or containing such products. c. This insurance does not apply to any of "your products" for which coverage is excluded under this Coverage Part. U-GL-1345-C CW (03/20) Page 3 of 12 Includes copyrighted material of Insurance Services Office, Inc., with its permission. 3. With respect to the insurance afforded to the vendor under this endorsement, the following is added to Section III — Limits Of Insurance: The most we will pay on behalf of the vendor is the amount of insurance: a. Required by the written contract or written agreement referenced in Subparagraph E.1. above (of this endorsement); or b. Available under the applicable Limits of Insurance shown in the Declarations, whichever is less. This Paragraph E. shall not increase the applicable Limits of Insurance shown in the Declarations. F. Additional Insured — Managers, Lessors or Governmental Entity 1. Section II — Who Is An Insured is amended to include as an insured any person or organization who is a manager, lessor or governmental entity who you are required to add as an additional insured on this policy under a written contract, written agreement or permit, but only with respect to liability for "bodily injury", "property damage" or "personal and advertising injury" caused, in whole or in part, by: a. Your acts or omissions; or b. The acts or omission of those acting on your behalf; and resulting directly from: a. Operations performed by you or on your behalf for which the state or political subdivision has issued a permit; b. Ownership, maintenance, occupancy or use of premises by you; or c. Maintenance, operation or use by you of equipment leased to you by such person or organization. However, the insurance afforded to such additional insured: a. Only applies to the extent permitted by law; and b. Will not be broader than that which you are required by the written contract or written agreement to provide for such additional insured. 2. This provision does not apply: a. Unless the written contract or written agreement has been executed, or the permit has been issued, prior to the "bodily injury", "property damage" or offense that caused "personal and advertising injury"; b. To any person or organization included as an insured under Paragraph 3. of Section II — Who Is An Insured; c. To any lessor of equipment if the "occurrence" or offense takes place after the equipment lease expires; d. To any: (1) Owners or other interests from whom land has been leased by you; or (2) Managers or lessors of premises, if: (a) The "occurrence" or offense takes place after the expiration of the lease or you cease to be a tenant in that premises; (b) The "bodily injury", "property damage" or "personal and advertising injury" arises out of the structural alterations, new construction or demolition operations performed by or on behalf of the manager or lessor; or (c) The premises are excluded under this Coverage Part. 3. With respect to the insurance afforded to the additional insureds under this endorsement, the following is added to Section III — Limits Of Insurance: The most we will pay on behalf of the additional insured is the amount of insurance: a. Required by the written contract or written agreement referenced in Subparagraph F.1. above (of this endorsement); or U-GL-1345-C CW (03/20) Page 4 of 12 Includes copyrighted material of Insurance Services Office, Inc., with its permission. b. Available under the applicable Limits of Insurance shown in the Declarations, whichever is less. This Paragraph F. shall not increase the applicable Limits of Insurance shown in the Declarations. G. Damage to Premises Rented or Occupied by You 1. The last paragraph under Paragraph 2. Exclusions of Section I— Coverage A— Bodily Injury And Property Damage Liability is replaced by the following: Exclusions c. through n. do not apply to damage by "specific perils" to premises while rented to you or temporarily occupied by you with permission of the owner. A separate Damage To Premises Rented To You Limit of Insurance applies to this coverage as described in Section III — Limits Of Insurance. 2. Paragraph 6. of Section III — Limits Of Insurance is replaced by the following: 6. Subject to Paragraph 5. above, the Damage To Premises Rented To You Limit is the most we will pay under Coverage A for damages because of "property damage" to any one premises while rented to you, or in the case of damage by one or more "specific perils" to any one premises, while rented to you or temporarily occupied by you with permission of the owner. H. Broadened Contractual Liability The "insured contract" definition under the Definitions Section is replaced by the following: "Insured contract" means: a. A contract for a lease of premises. However, that portion of the contract for a lease of premises that indemnifies any person or organization for damage by "specific perils" to premises while rented to you or temporarily occupied by you with permission of the owner is not an "insured contract"; b. A sidetrack agreement; c. Any easement or license agreement; d. An obligation, as required by ordinance, to indemnify a municipality, except in connection with work for a municipality; e. An elevator maintenance agreement; f. That part of any other contract or agreement pertaining to your business (including an indemnification of a municipality in connection with work performed for a municipality) under which you assume the tort liability of another party to pay for "bodily injury", "property damage", or "personal and advertising injury" arising out of the offenses of false arrest, detention or imprisonment, to a third person or organization. Tort liability means a liability that would be imposed by law in the absence of any contract or agreement. Paragraph f. does not include that part of any contract or agreement: (1) That indemnifies an architect, engineer or surveyor for injury or damage arising out of: (a) Preparing, approving, or failing to prepare or approve, maps, shop drawings, opinions, reports, surveys, field orders, change orders or drawings and specifications; or (b) Giving directions or instructions, or failing to give them, if that is the primary cause of the injury or damage; or (2) Under which the insured, if an architect, engineer or surveyor, assumes liability for an injury or damage arising out of the insured's rendering or failure to render professional services, including those listed in Paragraph (1) above and supervisory, inspection, architectural or engineering activities. I. Definition — Specific Perils The following definition is added to the Definitions Section: "Specific perils" means: a. Fire; b. Lightning; U-GL-1345-C CW (03/20) Page 5 of 12 Includes copyrighted material of Insurance Services Office, Inc., with its permission. c. Explosion; d. Windstorm or hail; e. Smoke; f. Aircraft or vehicles; g. Vandalism; h. Weight of snow, ice or sleet; i. Leakage from fire extinguishing equipment, including sprinklers; or j. Accidental discharge or leakage of water or steam from any part of a system or appliance containing water or steam. J. Limited Contractual Liability Coverage — Personal and Advertising Injury 1. Exclusion e. of Section I— Coverage B— Personal And Advertising Injury Liability is replaced by the following: 2. Exclusions This insurance does not apply to: e. Contractual Liability "Personal and advertising injury" for which the insured has assumed liability in a contract or agreement. This exclusion does not apply to: (1) Liability for damages that the insured would have in the absence of the contract or agreement; or (2) Liability for "personal and advertising injury" if: (a) The "personal and advertising injury" arises out of the offenses of false arrest, detention or imprisonment; (b) The liability pertains to your business and is assumed in a written contract or written agreement in which you assume the tort liability of another. Tort liability means a liability that would be imposed by law in the absence of any contract or agreement; and (c) The "personal and advertising injury" occurs subsequent to the execution of the written contract or written agreement. Solely for purposes of liability so assumed in such written contract or written agreement, reasonable attorney fees and necessary litigation expenses incurred by or for a party other than an insured are deemed to be damages because of "personal and advertising injury" described in Paragraph (a) above, provided: (i) Liability to such party for, or for the cost of, that party's defense has also been assumed in the same written contract or written agreement; and (ii) Such attorney fees and litigation expenses are for defense of that party against a civil or alternative dispute resolution proceeding in which damages to which this insurance applies are alleged. 2. Paragraph 2.d. of Section I— Supplementary Payments — Coverages A and B is replaced by the following: d. The allegations in the "suit" and the information we know about the "occurrence" or offense are such that no conflict appears to exist between the interests of the insured and the interests of the indemnitee; 3. The following is added to the paragraph directly following Paragraph 2.f. of Section I— Supplementary Payments — Coverages A and B: Notwithstanding the provisions of Paragraph 2.e.(2) of Section I— Coverage B— Personal And Advertising Injury Liability, such payments will not be deemed to be damages for "personal and advertising injury" and will not reduce the limits of insurance. U-GL-1345-C CW (03/20) Page 6 of 12 Includes copyrighted material of Insurance Services Office, Inc., with its permission. K. Supplementary Payments The following changes apply to Supplementary Payments — Coverages A and B: Paragraphs 1.b. and 1.d. are replaced by the following: b. Up to $2,500 for the cost of bail bonds required because of accidents or traffic law violations arising out of the use of any vehicle to which the Bodily Injury Liability Coverage applies. We do not have to furnish these bonds. d. All reasonable expenses incurred by the insured at our request to assist us in the investigation or defense of the claim or "suit", including actual loss of earnings up to $500 a day because of time off from work. L. Broadened Property Damage 1. Property Damage to Contents of Premises Rented Short-Term The paragraph directly following Paragraph (6) in Exclusion j. of Section I— Coverage A— Bodily Injury And Property Damage Liability is replaced by the following: Paragraphs (1), (3) and (4) of this exclusion do not apply to "property damage" to premises (other than damage by "specific perils"), including "property damage" to the contents of such premises, rented to you under a rental agreement for a period of 14 or fewer consecutive days. A separate Limit of Insurance applies to Damage to Premises Rented to You as described in Section III — Limits Of Insurance. 2. Elevator Property Damage a. The following is added to Exclusion j. of Section I— Coverage A— Bodily Injury And Property Damage Liability: Paragraphs (3) and (4) of this exclusion do not apply to "property damage" arising out of the use of an elevator at premises you own, rent or occupy. b. The following is added to Section III — Limits Of Insurance: Subject to Paragraph 5. above, the most we will pay under Coverage A for damages because of "property damage" to property loaned to you or personal property in the care, custody or control of the insured arising out of the use of an elevator at premises you own, rent or occupy is $25,000 per "occurrence". 3. Property Damage to Borrowed Equipment a. The following is added to Exclusion j. of Section I— Coverage A— Bodily Injury And Property Damage Liability: Paragraph (4) of this exclusion does not apply to "property damage" to equipment you borrow from others at a jobsite. b. The following is added to Section III — Limits Of Insurance: Subject to Paragraph 5. above, the most we will pay under Coverage A for damages because of "property damage" to equipment you borrow from others is $25,000 per "occurrence". M. Expected or Intended Injury or Damage Exclusion a. of Section I— Coverage A— Bodily Injury And Property Damage Liability is replaced by the following: a. Expected Or Intended Injury Or Damage "Bodily injury" or "property damage" expected or intended from the standpoint of the insured. This exclusion does not apply to "bodily injury" or "property damage" resulting from the use of reasonable force to protect persons or property. N. Definitions — Bodily Injury The "bodily injury" definition under the Definitions Section is replaced by the following: "Bodily injury" means bodily injury, sickness or disease sustained by a person, including mental anguish, mental injury, shock, fright or death sustained by that person which results from that bodily injury, sickness or disease. U-GL-1345-C CW (03/20) Page 7 of 12 Includes copyrighted material of Insurance Services Office, Inc., with its permission. O. Insured Status — Amateur Athletic Participants Section II — Who Is An Insured is amended to include as an insured any person you sponsor while participating in amateur athletic activities. However, no such person is an insured for: a. "Bodily injury" to: (1) Your "employee", "volunteer worker" or any person you sponsor while participating in such amateur athletic activities; or (2) You, any partner or member (if you are a partnership or joint venture), or any member (if you are a limited liability company) while participating in such amateur athletic activities; or b. "Property damage" to property owned by, occupied or used by, rented to, in the care, custody or control of, or over which the physical control is being exercised for any purpose by: (1) Your "employee", "volunteer worker" or any person you sponsor; or (2) You, any partner or member (if you are a partnership or joint venture), or any member (if you are a limited liability company). P. Non-Owned Aircraft, Auto and Watercraft Exclusion g. of Section I— Coverage A— Bodily Injury And Property Damage Liability is replaced by the following: g. Aircraft, Auto Or Watercraft "Bodily injury" or "property damage" arising out of the ownership, maintenance, use or entrustment to others of any aircraft, "auto" or watercraft owned or operated by or rented or loaned to any insured. Use includes operation and "loading or unloading". This exclusion applies even if the claims against any insured allege negligence or other wrongdoing in the supervision, hiring, employment, training or monitoring of others by that insured, if the "occurrence" which caused the "bodily injury" or "property damage" involved the ownership, maintenance, use or entrustment to others of any aircraft, "auto" or watercraft that is owned or operated by or rented or loaned to any insured. This exclusion does not apply to: (1) A watercraft while ashore on premises you own or rent; (2) A watercraft you do not own that is: (a) Less than 51 feet long; and (b) Not being used to carry persons for a charge; (3) Parking an "auto" on, or on the ways next to, premises you own or rent, provided the "auto" is not owned by or rented or loaned to you or the insured; (4) Liability assumed under any "insured contract" for the ownership, maintenance or use of aircraft or watercraft; (5) An aircraft that is hired or chartered by you or loaned to you, with a paid and licensed crew, and is not owned in whole or in part by an insured; or (6) "Bodily injury" or "property damage" arising out of: (a) The operation of machinery or equipment that is attached to, or part of, a land vehicle that would qualify under the definition of "mobile equipmenY' if it were not subject to a compulsory or financial responsibility law or other motor vehicle insurance law where it is licensed or principally garaged; or (b) The operation of any of the machinery or equipment listed in Paragraph f.(2) or f.(3) of the definition of "mobile equipment". Q. Definitions — Leased Worker, Temporary Worker and Labor Leasing Firm 1. The "leased worker" and "temporary worker" definitions under the Definitions Section are replaced by the following: U-GL-1345-C CW (03/20) Page 8 of 12 Includes copyrighted material of Insurance Services Office, Inc., with its permission. "Leased worker" means a person leased to you by a"labor leasing firm" under a written agreement between you and the "labor leasing firm", to perform duties related to the conduct of your business. "Leased worker" does not include a "temporary worker". "Temporary worker" means a person who is furnished to you to support or supplement your work force during "employee" absences, temporary skill shortages, upturns or downturns in business or to meet seasonal or short- term workload conditions. "Temporary worker" does not include a"leased worker". 2. The following definition is added to the Definitions Section: "Labor leasing firm" means any person or organization who hires out workers to others, including any: a. Employment agency, contractor or services; b. Professional employer organization; or c. Temporary help service. R. Definition — Mobile Equipment Paragraph f. of the "mobile equipmenY' definition under the Definitions Section is replaced by the following: f. Vehicles not described in Paragraph a., b., c. or d. above maintained primarily for purposes other than the transportation of persons or cargo. However, self-propelled vehicles with the following types of permanently attached equipment, exceeding a combined gross vehicle weight of 1000 pounds, are not "mobile equipment" but will be considered "autos": (1) Equipment designed primarily for: (a) Snow removal; (b) Road maintenance, but not construction or resurfacing; or (c) Street cleaning; (2) Cherry pickers and similar devices mounted on automobile or truck chassis and used to raise or lower workers; and (3) Air compressors, pumps and generators, including spraying, welding, building cleaning, geophysical exploration, lighting and well servicing equipment. S. Definitions — Your Product and Your Work The "your product" and "your work" definitions under the Definitions Section are replaced by the following: "Your product": a. Means: (1) Any goods or products, other than real property, manufactured, sold, handled, distributed or disposed of by: (a) You; (b) Others trading under your name; or (c) A person or organization whose business or assets you have acquired; and (2) Containers (other than vehicles), materials, parts or equipment furnished in connection with such goods or products. b. Includes: (1) Warranties or representations made at any time with respect to the fitness, quality, durability, performance, use, handling, maintenance, operation or safety of "your product"; and (2) The providing of or failure to provide warnings or instructions. c. Does not include vending machines or other property rented to or located for the use of others but not sold. U-GL-1345-C CW (03/20) Page 9 of 12 Includes copyrighted material of Insurance Services Office, Inc., with its permission. "Your work": a. Means: (1) Work, services or operations performed by you or on your behalf; and (2) Materials, parts or equipment furnished in connection with such work, services or operations. b. Includes: (1) Warranties or representations made at any time with respect to the fitness, quality, durability, performance, use, handling, maintenance, operation or safety of "your work"; and (2) The providing of or failure to provide warnings or instructions. T. Duties in the Event of Occurrence, Offense, Claim or Suit Condition The following paragraphs are added to Paragraph 2. Duties In The Event Of Occurrence, Offense, Claim Or Suit of Section IV — Commercial General Liability Conditions: Notice of an "occurrence" or of an offense which may result in a claim under this insurance or notice of a claim or "suit" shall be given to us as soon as practicable after knowledge of the "occurrence", offense, claim or "suit" has been reported to any insured listed under Paragraph 1. of Section II — Who Is An Insured or an "employee" authorized by you to give or receive such notice. Knowledge by other "employees" of an "occurrence", offense, claim or "suit" does not imply that you also have such knowledge. In the event that an insured reports an "occurrence" to the workers compensation carrier of the Named Insured and this "occurrence" later develops into a General Liability claim, covered by this Coverage Part, the insured's failure to report such "occurrence" to us at the time of the "occurrence" shall not be deemed to be a violation of this Condition. You must, however, give us notice as soon as practicable after being made aware that the particular claim is a General Liability rather than a Workers Compensation claim. U. Other Insurance Condition Paragraphs 4.a. and 4.b.(1) of the Other Insurance Condition of Section IV — Commercial General Liability Conditions are replaced by the following: 4. Other Insurance If other valid and collectible insurance is available to the insured for a loss we cover under Coverages A or B of this Coverage Part, our obligations are limited as follows: a. Primary Insurance This insurance is primary except when Paragraph b. below applies. If this insurance is primary, our obligations are not affected unless any of the other insurance is also primary. Then, we will share with all that other insurance by the method described in Paragraph c. below. However, this insurance is primary to and will not seek contribution from any other insurance available to an additional insured provided that: (1) The additional insured is a Named Insured under such other insurance; and (2) You are required by written contract or written agreement that this insurance be primary and not seek contribution from any other insurance available to the additional insured. Other insurance includes any type of self insurance or other mechanism by which an insured arranges for funding of its legal liabilities. b. Excess Insurance (1) This insurance is excess over: (a) Any of the other insurance, whether primary, excess, contingent or on any other basis: (i) That is property insurance, Builder's Risk, Installation Risk or similar coverage for "your work"; (ii) That is property insurance purchased by you (including any deductible or self insurance portion thereof) to cover premises rented to you or temporarily occupied by you with permission of the owner; U-GL-1345-C CW (03/20) Page 10 of 12 Includes copyrighted material of Insurance Services Office, Inc., with its permission. (iii) That is insurance purchased by you (including any deductible or self insurance portion thereof) to cover your liability as a tenant for "property damage" to premises rented to you or temporarily occupied by you with permission of the owner; (iv) If the loss arises out of the maintenance or use of aircraft, "autos" or watercraft to the extent not subject to Exclusion g. of Section I— Coverage A— Bodily Injury And Property Damage Liability; or (v) That is property insurance (including any deductible or self insurance portion thereof) purchased by you to cover damage to: Equipment you borrow from others; or Property loaned to you or personal property in the care, custody or control of the insured arising out of the use of an elevator at premises you own, rent or occupy. (b) Any other primary insurance (including any deductible or self insurance portion thereof) available to the insured covering liability for damages arising out of the premises, operations, products, work or services for which the insured has been granted additional insured status either by policy provision or attachment of any endorsement. Other primary insurance includes any type of self insurance or other mechanism by which an insured arranges for funding of its legal liabilities. (c) Any of the other insurance, whether primary, excess, contingent or on any other basis, available to an additional insured, in which the additional insured on our policy is also covered as an additional insured on another policy providing coverage for the same "occurrence", claim or "suit". This provision does not apply to any policy in which the additional insured is a Named Insured on such other policy and where our policy is required by written contract or written agreement to provide coverage to the additional insured on a primary and non-contributory basis. V. Unintentional Failure to Disclose All Hazards Paragraph 6. Representations of Section IV — Commercial General Liability Conditions is replaced by the following: 6. Representations By accepting this policy, you agree: a. The statements in the Declarations are accurate and complete; b. Those statements are based upon representations you made to us; and c. We have issued this policy in reliance upon your representations. Coverage will continue to apply if you unintentionally: a. Fail to disclose all hazards existing at the inception of this policy; or b. Make an error, omission or improper description of premises or other statement of information stated in this policy. You must notify us as soon as possible after the discovery of any hazards or any other information that was not provided to us prior to inception of this Coverage Part. W. Waiver of Right of Subrogation Paragraph 8. Transfer Of Rights Of Recovery Against Others To Us of Section IV — Commercial General Liability Conditions is replaced by the following: 8. Transfer Of Rights Of Recovery Against Others To Us a. If the insured has rights to recover all or part of any payment we have made under this Coverage Part, those rights are transferred to us. The insured must do nothing after loss to impair them. At our request, the insured will bring "suit" or transfer those rights to us and help us enforce them. b. If the insured waives its right to recover payments for injury or damage from another person or organization in a written contract executed prior to a loss, we waive any right of recovery we may have against such person or organization because of any payment we have made under this Coverage Part. The written contract will U-GL-1345-C CW (03/20) Page 11 of 12 Includes copyrighted material of Insurance Services Office, Inc., with its permission. be considered executed when the insured's performance begins, or when it is signed, whichever happens first. This waiver of rights shall not be construed to be a waiver with respect to any other operations in which the insured has no contractual interest. X. Liberalization Condition The following condition is added to Section IV — Commercial General Liability Conditions: Liberalization Clause If we revise this Coverage Part to broaden coverage without an additional premium charge, your policy will automatically provide the additional coverage as of the day the revision is effective in the state shown in the mailing address of your policy. All other terms, conditions, provisions and exclusions of this policy remain the same. U-GL-1345-C CW (03/20) Page 12 of 12 Includes copyrighted material of Insurance Services Office, Inc., with its permission. Policy # WC0187956-05 WORKERS COMPENSATION AND EMPLOYERS LIABILITY INSURANCE POLICY WC 00 03 13 (Ed. 4-84) WAIVER OF OUR RIGHT TO RECOVER FROM OTHERS ENDORSEMENT We have the right to recover our payments from anyone liable for an injury covered by this policy. We will not enforce our right against the person or organization named in the Schedule. (This agreement applies only to the extent that you perform work under a written contract that requires you to obtain this agreement from us.) This agreement shall not operate directly or indirectly to benefit anyone not named in the Schedule. Schedule ALL PERSONS AND/OR ORGANIZATIONS THAT ARE REQUIRED BY WRITTEN CONTRACT OR AGREEMENT WITH THE INSURED, EXECUTED PRIOR TO THE ACCIDENT OR LOSS, THAT WAIVER OF SUBROGATION BE PROVIDED UNDER THIS POLICY FOR WORK PERFORMED BY YOU FOR THAT PERSON AND/OR ORGANIZATION. WC000313 (Ed.4-84) � 1983 National Council on Compensation Insurance. � Blanket Notification to Others of Cancellation Z U RI C H or Non-Renewal THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. Policy No. GLO 0187959-05 Effective Date: 07/01/2022 This endorsement applies to insurance provided under the: Commercial General Liability Coverage Part A. If we cancel or non-renew this Coverage Part by written notice to the first Named Insured, we will mail or deliver notification that such Coverage Part has been cancelled or non-renewed to each person or organization shown in a list provided to us by the first Named Insured if you are required by written contact or written agreement to provide such notification. Such list: 1. Must be provided to us prior to cancellation or non-renewal; 2. Must contain the names and addresses of only the persons or organizations requiring notification that such Coverage Part has been cancelled or non-renewed; and 3. Must be in an electronic format that is acceptable to us. B. Our notification as described in Paragraph A. of this endorsement will be based on the most recent list in our records as of the date the notice of cancellation or non-renewal is mailed or delivered to the first Named Insured. We will mail or deliver such notification to each person or organization shown in the list: 1. Within 10 days of the effective date of the notice of cancellation, if we cancel for non-payment of premium; or 2. At least 30 days prior to the effective date of: a. Cancellation, if cancelled for any reason other than nonpayment of premium; or b. Non-renewal, but not including conditional notice of renewal, unless a greater number of days is shown in the Schedule of this endorsement for the mailing or delivering of such notification with respect to Paragraph B.1. or Paragraph B.2. above. C. Our mailing or delivery of notification described in Paragraphs A. and B. of this endorsement is intended as a courtesy only. Our failure to provide such mailing or delivery will not: 1. Extend the Coverage Part cancellation or non-renewal date; 2. Negate the cancellation or non-renewal; or 3. Provide any additional insurance that would not have been provided in the absence of this endorsement. U-GL-1521-B CW (01/19) Page 1 of 2 Includes copyrighted material of Insurance Services Office, Inc., with its permission. D. We are not responsible for the accuracy, integrity, timeliness and validity of information contained in the list provided to us as described in Paragraphs A. and B. of this endorsement. SCHEDULE The total number of days for mailing or delivering with respect to Paragraph B.1. of �,; this endorsement is amended to indicate the following number of days: The total number of days for mailing or delivering with respect to Paragraph B.2. of 30** this endorsement is amended to indicate the following number of days: * If a number is not shown here, 10 days continues to apply. ** If a number is not shown here, 30 days continues to apply. All other terms and conditions of this policy remain unchanged. U-GL-1521-B CW (01/19) Page 2 of 2 Includes copyrighted material of Insurance Services Office, Inc., with its permission. Blanket Notification to Others of Cancellation or Non-Renewal Policy No. BAP0187958- Eff. Date of Pol 7/1/22 � ���i�H Exp. Date of Pol. Eff. Date of End. Producer No. Add'I. Prem Return Prem. 7/1/23 %/1/22 50858000 THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. This endorsement modifies insurance provided under the: Commercial Automobile Coverage Part A. If we cancel or non-renew this Coverage Part by written notice to the first Named Insured, we will mail or deliver notification that such Coverage Part has been cancelled or non-renewed to each person or organization shown in a list provided to us by the first Named Insured if you are required by written contact or written agreement to provide such notification. However, such notification will not be mailed or delivered if a conditional notice of renewal has been sent to the first Named Insured. Such list: 1. Must be provided to us prior to cancellation or non-renewal; 2. Must contain the names and addresses of only the persons or organizations requiring notification that such Coverage Part has been cancelled or non-renewed; and 3. Must be in an electronic format that is acceptable to us. B. Our notification as described in Paragraph A. of this endorsement will be based on the most recent list in our records as of the date the notice of cancellation or non-renewal is mailed or delivered to the first Named Insured. We will mail or deliver such notification to each person or organization shown in the list: 1. Within seven days of the effective date of the notice of cancellation, if we cancel for non-payment of premium; or 2. At least 30 days prior to the effective date of: a. Cancellation, if cancelled for any reason other than nonpayment of premium; or b. Non-renewal, but not including conditional notice of renewal. C. Our mailing or delivery of notification described in Paragraphs A. and B. of this endorsement is intended as a courtesy only. Our failure to provide such mailing or delivery will not: 1. Extend the Coverage Part cancellation or non-renewal date; 2. Negate the cancellation or non-renewal; or 3. Provide any additional insurance that would not have been provided in the absence of this endorsement. D. We are not responsible for the accuracy, integrity, timeliness and validity of information contained in the list provided to us as described in Paragraphs A. and B. of this endorsement. All other terms and conditions of this policy remain unchanged. U-CA-832-A CW (01 / 13) Pag e 1 of 1 Includes copyrighted material of Insurance Services Office, Inc., with its permission. WORKERS COMPENSATION AND EMPLOYERS LIABILITY INSURANCE POLICY WC 99 06 43 BLANKET NOTIFICATION TO OTHERS OF CANCELLATION OR NONRENEWAL ENDORSEMENT This endorsement adds the following to Part Six of the policy. PART SIX CONDITIONS Blanket Notffication to Others of Cancellation or Nonrenewal 1. If we cancel or non-renew this policy by written notice to you, we will mail or deliver notification that such policy has been cancelled or non-renewed to each person or organization shown in a list provided to us by you if you are required by written contract or written agreement to provide such notification. However, such notification will not be mailed or delivered if a conditional notice of renewal has been sent to you. Such list: a. Must be provided to us prior to cancellation or non-renewal; b. Must contain the names and addresses of only the persons or organizations requiring notification that such policy has been cancelled or non-renewed; and c. Must be in an electronic format that is acceptable to us. 2. Our notification as described in Paragraph 1. above will be based on the most recent list in our records as of the date the notice of cancellation or non-renewal is mailed or delivered to you. We will mail or deliver such notification to each person or organization shown in the list: a. Within seven days of the effective date of the notice of cancellation, if we cancel for non-payment of premium; or b. At least 30 days prior to the effective date of: (1) Cancellation, if cancelled for any reason other than nonpayment of premium; or (2) Non-renewal, but not including conditional notice of renewal. 3. Our mailing or delivery of notification described in Paragraphs 1. and 2. above is intended as a courtesy only. Our failure to provide such mailing or delivery will not: a. Extend the policy cancellation or non-renewal date; b. Negate the cancellation or non-renewal; or c. Provide any additional insurance that would not have been provided in the absence of this endorsement. 4. We are not responsible for the accuracy, integrity, timeliness and validity of information contained in the list provided to us as described in Paragraphs 1. and 2. above. All other terms and conditions of this policy remain unchanged. This endorsement changes the policy to which it is attached and is effective on the date issued unless otherwise stated. (The information below is required only when this endorsement is issued subsequent to preparation of the policy.) Endorsement Effective �/1/22 Policy No. WC0187956-05 Endorsement No. Premium $ Insurance Company Zurich American Insurance Company WC 99 06 43 Page 1 of 1 (Ed. 01-13) Includes copyright material of the National Council on Compensation Insurance, Inc. used with its permission. �� 2012 Copyright National Council on Compensation Insurance, Inc. All Rights Reserved. Additional Insured — Automatic — Owners, Lessees Or Contractors � �r��i�� THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. Policy No. GLO 0187957-05 Effective Date: ��1�22 This endorsement modifies insurance provided under the: Commercial General Liability Coverage Part A. Section II — Who Is An Insured is amended to include as an additional insured any person or organization whom you are required to add as an additional insured under a written contract or written agreement executed by you, but only with respect to liability for "bodily injury", "property damage" or "personal and advertising injury" and subject to the following: 1. If such written contract or written agreement specifically requires that you provide that the person or organization be named as an additional insured under one or both of the following endorsements: a. The Insurance Services Office (ISO) ISO CG 20 10 (10/01 edition); or b. The ISO CG 20 37 (10/01 edition), such person or organization is then an additional insured with respect to such endorsement(s), but only to the extent that "bodily injury", "property damage" or "personal and advertising injury" arises out of: (1) Your ongoing operations, with respect to Paragraph 1.a. above; or (2) "Your work", with respect to Paragraph 1.b. above, which is the subject of the written contract or written agreement. However, solely with respect to this Paragraph 1., insurance afforded to such additional insured: (a) Only applies if the "bodily injury", "property damage" or "personal and advertising injury" offense occurs during the policy period and subsequent to your execution of the written contract or written agreement; and (b) Does not apply to "bodily injury" or "property damage" caused by "your work" and included within the "products-completed operations hazard" unless the written contract or written agreement specifically requires that you provide such coverage to such additional insured. 2. If such written contract or written agreement specifically requires that you provide that the person or organization be named as an additional insured under one or both of the following endorsements: a. The Insurance Services Office (ISO) ISO CG 20 10 (07/04 edition); or b. The ISO CG 20 37 (07/04 edition), such person or organization is then an additional insured with respect to such endorsement(s), but only to the extent that "bodily injury", "property damage" or "personal and advertising injury" is caused, in whole or in part, by: (1) Your acts or omissions; or (2) The acts or omissions of those acting on your behalf, U-GL-2162-A CW (02/19) Page 1 of 4 Includes copyrighted material of Insurance Services Office, Inc., with its permission. in the performance of: (a) Your ongoing operations, with respect to Paragraph 2.a. above; or (b) "Your work" and included in the "products-completed operations hazard", with respect to Paragraph 2.b. above, which is the subject of the written contract or written agreement. However, solely with respect to this Paragraph 2., insurance afforded to such additional insured: (i) Only applies if the "bodily injury", "property damage" or "personal and advertising injury" offense occurs during the policy period and subsequent to your execution of the written contract or written agreement; and (ii) Does not apply to "bodily injury" or "property damage" caused by "your work" and included within the "products-completed operations hazard" unless the written contract or written agreement specifically requires that you provide such coverage to such additional insured. 3. If neither Paragraph 1. nor Paragraph 2. above apply and such written contract or written agreement requires that you provide that the person or organization be named as an additional insured: a. Under the ISO CG 20 10 (04/13 edition, any subsequent edition or if no edition date is specified); or b. With respect to ongoing operations (if no form is specified), such person or organization is then an additional insured only to the extent that "bodily injury", "property damage" or "personal and advertising injury" is caused, in whole or in part by: (1) Your acts or omissions; or (2) The acts or omissions of those acting on your behalf, in the performance of your ongoing operations, which is the subject of the written contract or written agreement. However, solely with respect to this Paragraph 3., insurance afforded to such additional insured: (a) Only applies to the extent permitted by law; (b) Will not be broader than that which you are required by the written contract or written agreement to provide for such additional insured; and (c) Only applies if the "bodily injury", "property damage" or "personal and advertising injury" offense occurs during the policy period and subsequent to your execution of the written contract or written agreement. 4. If neither Paragraph 1. nor Paragraph 2. above apply and such written contract or written agreement requires that you provide that the person or organization be named as an additional insured: a. Under the ISO CG 20 37 (04/13 edition, any subsequent edition or if no edition date is specified); or b. With respect to the "products-completed operations hazard" (if no form is specified), such person or organization is then an additional insured only to the extent that "bodily injury" or "property damage" is caused, in whole or in part by "your work" and included in the "products-completed operations hazard", which is the subject of the written contract or written agreement. However, solely with respect to this Paragraph 4., insurance afforded to such additional insured: (1) Only applies to the extent permitted by law; (2) Will not be broader than that which you are required by the written contract or written agreement to provide for such additional insured; (3) Only applies if the "bodily injury" or "property damage" occurs during the policy period and subsequent to your execution of the written contract or written agreement; and (4) Does not apply to "bodily injury" or "property damage" caused by "your work" and included within the "products-completed operations hazard" unless the written contract or written agreement specifically requires that you provide such coverage to such additional insured. U-GL-2162-A CW (02/19) Page 2 of 4 Includes copyrighted material of Insurance Services Office, Inc., with its permission. B. Solely with respect to the insurance afforded to any additional insured referenced in Section A. of this endorsement, the following additional exclusion applies: This insurance does not apply to "bodily injury", "property damage" or "personal and advertising injury" arising out of the rendering of, or failure to render, any professional architectural, engineering or surveying services including: 1. The preparing, approving or failing to prepare or approve maps, shop drawings, opinions, reports, surveys, field orders, change orders or drawings and specifications; or 2. Supervisory, inspection, architectural or engineering activities. This exclusion applies even if the claims against any insured allege negligence or other wrongdoing in the supervision, hiring, employment, training or monitoring of others by that insured, if the "occurrence" which caused the "bodily injury" or "property damage", or the offense which caused the "personal and advertising injury", involved the rendering of or the failure to render any professional architectural, engineering or surveying services. C. Solely with respect to the coverage provided by this endorsement, the following is added to Paragraph 2. Duties In The Event Of Occurrence, Offense, Claim Or Suit of Section IV — Commercial General Liability Conditions: The additional insured must see to it that: (1) We are notified as soon as practicable of an "occurrence" or offense that may result in a claim; (2) We receive written notice of a claim or "suit" as soon as practicable; and (3) A request for defense and indemnity of the claim or "suiY' will promptly be brought against any policy issued by another insurer under which the additional insured may be an insured in any capacity. This provision does not apply to insurance on which the additional insured is a Named Insured if the written contract or written agreement requires that this coverage be primary and non-contributory. D. Solely with respect to the coverage provided by this endorsement: 1. The following is added to the Other Insurance Condition of Section IV — Commercial General Liability Conditions: Primary and Noncontributory insurance This insurance is primary to and will not seek contribution from any other insurance available to an additional insured provided that: a. The additional insured is a Named Insured under such other insurance; and b. You are required by written contract or written agreement that this insurance be primary and not seek contribution from any other insurance available to the additional insured. 2. The following paragraph is added to Paragraph 4.b, of the Other Insurance Condition under Section IV — Commercial General Liability Conditions: This insurance is excess over: Any of the other insurance, whether primary, excess, contingent or on any other basis, available to an additional insured, in which the additional insured on our policy is also covered as an additional insured on another policy providing coverage for the same "occurrence", offense, claim or "suit". This provision does not apply to any policy in which the additional insured is a Named Insured on such other policy and where our policy is required by a written contract or written agreement to provide coverage to the additional insured on a primary and non- contributory basis. E. This endorsement does not apply to an additional insured which has been added to this Coverage Part by an endorsement showing the additional insured in a Schedule of additional insureds, and which endorsement applies specifically to that identified additional insured. F. Solely with respect to the insurance afforded to an additional insured under Paragraph A.3. or Paragraph A.4. of this endorsement, the following is added to Section III — Limits Of Insurance: Additional Insured — Automatic — Owners, Lessees Or Contractors Limit The most we will pay on behalf of the additional insured is the amount of insurance: U-GL-2162-A CW (02/19) Page 3 of 4 Indudes copyrighted material of Insurance Services Office, Inc., with its permission. 1. Required by the written contract or written agreement referenced in Section A. of this endorsement; or 2. Available under the applicable Limits of Insurance shown in the Declarations, whichever is less. This endorsement shall not increase the applicable Limits of Insurance shown in the Declarations. All other terms, conditions, provisions and exclusions of this policy remain the same. U-GL-2162-A CW (02/19) Page 4 of 4 Indudes copyrighted material of Insurance Services Office, Inc., with its permission. Forming A Part of Policy No. GLO 0187957-05 COMMERCIAL GENERAL LIABILITY CG 20 07 0413 THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. ADDITIONAL INSURED - ENGINEERS, ARCHITECTS OR SURVEYORS This endorsement modifies insurance provided under the following: COMMERCIAL GENERAL LIABILITY COVERAGE PART A. Sectan II — Who Is An Insured is amended to include as an additional insured any architect, engineer, or surveyor engaged by you but only with respect to liability for "bodily injury", "property damage" or "personal and advertising injury" caused, in whole or in part, by your acts or omissions or the acts or omissions of those acting on your behalf: 1. In connection with your premises; or 2. In the performance operations. of your ongoing However: 1. The insurance afforded to such additional insured only applies to the extent permitted by law; and 2. If coverage provided to the additional insured is required by a contract or agreement, the insurance afforded to such additional insured will not be broader than that which you are required by the contract or agreement to provide for such additional insured. B. With respect to the insurance afforded to these additional insureds, the following additional exclusion applies: This insurance does not apply to "bodily injury", "property damage" or "personal and advertising injury" arising out of the rendering of or the failure to render any professional services by or for you, including: 1. The preparing, approving, or failing to prepare or approve, maps, shop drawings, opinions, reports, surveys, field orders, change orders or drawings and specifications; or 2. Supervisory, inspection, architectural or engineering activities. This exclusion applies even if the claims against any insured allege negligence or other wrongdoing in the supervision, hiring, employment, training or monitoring of others by that insured, if the "occurrence" which caused the "bodily injury" or "property damage", or the offense which caused the "personal and advertising injury", involved the rendering of or the failure to render any professional services by or for you. C. With respect to the insurance afforded to these additional insureds, the following is added to Section III — Limits Of Insurance: If coverage provided to the additional insured is required by a contract or agreement, the most we will pay on behalf of the additional insured is the amount of insurance: 1. Required by the contract or agreement; or 2. Available under the applicable Limits of Insurance shown in the Declarations; whichever is less. This endorsement shall not increase the applicable Limits of Insurance shown in the Declarations. CG 20 07 0413 :� Insurance Services Office, Inc., 2012 Page 1 of 1 Coverage Extension Endorsement � ������ Policy No. Eff. Date of Pol. Exp. Date of Pol. Ef£ Date of End. Producer No. Add' I. Prem Return Prem. BAP0187958-0 7/1/22 7/1/23 7/1/22 5o85s000 INCL THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. This endorsement modifies insurance provided under the: Business Auto Coverage Form Motor Carrier Coverage Form A. Amended Who Is An Insured 1. The following is added to the Who Is An Insured Provision in Section II — Covered Autos Liability Coverage: The following are also "insureds": a. Any "employee" of yours is an "insured" while using a covered "auto" you don't own, hire or borrow for acts performed within the scope of employment by you. Any "employee" of yours is also an "insured" while operating an "auto" hired or rented under a contract or agreement in an "employee's" name, with your permission, while performing duties related to the conduct of your business. b. Anyone volunteering services to you is an "insured" while using a covered "auto" you don't own, hire or borrow to transport your clients or other persons in activities necessary to your business. c. Anyone else who furnishes an "auto" referenced in Paragraphs A.1.a. and A.1.b. in this endorsement. d. Where and to the extent permitted by law, any person(s) or organization(s) where required by written contract or written agreement with you executed prior to any "accident", including those person(s) or organization(s) directing your work pursuant to such written contract or written agreement with you, provided the "accident" arises out of operations governed by such contract or agreement and only up to the limits required in the written contract or written agreement, or the Limits of Insurance shown in the Declarations, whichever is less. 2. The following is added to the Other Insurance Condition in the Business Auto Coverage Form and the Other Insurance — Primary and Excess Insurance Provisions Condition in the Motor Carrier Coverage Form: Coverage for any person(s) or organization(s), where required by written contract or written agreement with you executed prior to any "accident", will apply on a primary and non-contributory basis and any insurance maintained by the additional "insured" will apply on an excess basis. However, in no event will this coverage extend beyond the terms and conditions of the Coverage Form. B. Amendment — Supplementary Payments Paragraphs a.(2) and a.(4) of the Coverage Extensions Provision in Section II — Covered Autos Liability Coverage are replaced by the following: (2) Up to $5,000 for the cost of bail bonds (including bonds for related traffic law violations) required because of an "accidenY' we cover. We do not have to furnish these bonds. (4) All reasonable expenses incurred by the "insured" at our request, including actual loss of earnings up to $500 a day because of time off from work. U-CA-424-F CW (04-14) Page 1 of 6 Indudes copyrighted material of Insurance Services Office, Inc., with its permission. C. Fellow Employee Coverage The Fellow Employee Exclusion contained in Section II — Covered Autos Liability Coverage does not apply. D. Driver Safety Program Liability and Physical Damage Coverage 1. The following is added to the Racing Exclusion in Section II — Covered Autos Liability Coverage: This exclusion does not apply to covered "autos" participating in a driver safety program event, such as, but not limited to, auto or truck rodeos and other auto or truck agility demonstrations. 2. The following is added to Paragraph 2. in the Exclusions of Section III — Physical Damage Coverage of the Business Auto Coverage Form and Paragraph 2.b. in the Exclusions of Section IV — Physical Damage Coverage of the Motor Carrier Coverage Form: This exclusion does not apply to covered "autos" participating in a driver safety program event, such as, but not limited to, auto or truck rodeos and other auto or truck agility demonstrations. E. Lease or Loan Gap Coverage The following is added to the Coverage Provision of the Physical Damage Coverage Section: Lease Or Loan Gap Coverage In the event of a total "loss" to a covered "auto", we will pay any unpaid amount due on the lease or loan for a covered "auto", less: a. Any amount paid under the Physical Damage Coverage Section of the Coverage Form; and b. Any: (1) Overdue lease or loan payments at the time of the "loss"; (2) Financial penalties imposed under a lease for excessive use, abnormal wear and tear or high mileage; (3) Security deposits not returned by the lessor; (4) Costs for extended warranties, credit life insurance, health, accident or disability insurance purchased with the loan or lease; and (5) Carry-over balances from previous leases or loans. F. Towing and Labor Paragraph A.2. of the Physical Damage Coverage Section is replaced by the following: We will pay up to $75 for towing and labor costs incurred each time a covered "auto" of the private passenger type is disabled. However, the labor must be performed at the place of disablement. G. Extended Glass Coverage The following is added to Paragraph A.3.a. of the Physical Damage Coverage Section: If glass must be replaced, the deductible shown in the Declarations will apply. However, if glass can be repaired and is actually repaired rather than replaced, the deductible will be waived. You have the option of having the glass repaired rather than replaced. H. Hired Auto Physical Damage — Increased Loss of Use Expenses The Coverage Extension for Loss Of Use Expenses in the Physical Damage Coverage Section is replaced by the following: Loss Of Use Expenses For Hired Auto Physical Damage, we will pay expenses for which an "insured" becomes legally responsible to pay for loss of use of a vehicle rented or hired without a driver under a written rental contract or written rental agreement. We will pay for loss of use expenses if caused by: U-CA-424-F CW (04-14) Page 2 of 6 Indudes copyrighted material of Insurance Services Office, Inc., with its permission. (1) Other than collision only if the Declarations indicate that Comprehensive Coverage is provided for any covered "auto"; (2) Specified Causes Of Loss only if the Declarations indicate that Specified Causes Of Loss Coverage is provided for any covered "auto"; or (3) Collision only if the Declarations indicate that Collision Coverage is provided for any covered "auto". However, the most we will pay for any expenses for loss of use is $100 per day, to a maximum of $3000. I. Personal Effects Coverage The following is added to the Coverage Provision of the Physical Damage Coverage Section: Personal Effects Coverage a. We will pay up to $750 for "loss" to personal effects which are: (1) Personal property owned by an "insured"; and (2) In or on a covered "auto". b. Subject to Paragraph a. above, the amount to be paid for "loss" to personal effects will be based on the lesser of: (1) The reasonable cost to replace; or (2) The actual cash value. c. The coverage provided in Paragraphs a. and b. above, only applies in the event of a total theft of a covered "auto". No deductible applies to this coverage. However, we will not pay for "loss" to personal effects of any of the following: (1) Accounts, bills, currency, deeds, evidence of debt, money, notes, securities, or commercial paper or other documents of value. (2) Bullion, gold, silver, platinum, or other precious alloys or metals; furs or fur garments; jewelry, watches, precious or semi-precious stones. (3) Paintings, statuary and other works of art. (4) Contraband or property in the course of illegal transportation or trade. (5) Tapes, records, discs or other similar devices used with audio, visual or data electronic equipment. Any coverage provided by this Provision is excess over any other insurance coverage available for the same "loss". J. Tapes, Records and Discs Coverage 1. The Exclusion in Paragraph B.4.a. of Section III — Physical Damage Coverage in the Business Auto Coverage Form and the Exclusion in Paragraph B.2.c. of Section IV — Physical Damage Coverage in the Motor Carrier Coverage Form does not apply. 2. The following is added to Paragraph 1.a. Comprehensive Coverage under the Coverage Provision of the Physical Damage Coverage Section: We will pay for "loss" to tapes, records, discs or other similar devices used with audio, visual or data electronic equipment. We will pay only if the tapes, records, discs or other similar audio, visual or data electronic devices: (a) Are the property of an "insured"; and (b) Are in a covered "auto" at the time of "loss". The most we will pay for such "loss" to tapes, records, discs or other similar devices is $500. The Physical Damage Coverage Deductible Provision does not apply to such "loss". U-CA-424-F CW (04-14) Page 3 of 6 Indudes copyrighted material of Insurance Services Office, Inc., with its permission. K. Airbag Coverage The Exclusion in Paragraph B.3.a. of Section III — Physical Damage Coverage in the Business Auto Coverage Form and the Exclusion in Paragraph B.4.a. of Section IV — Physical Damage Coverage in the Motor Carrier Coverage Form does not apply to the accidental discharge of an airbag. L. Two or More Deductibles The following is added to the Deductible Provision of the Physical Damage Coverage Section: If an accident is covered both by this policy or Coverage Form and by another policy or Coverage Form issued to you by us, the following applies for each covered "auto" on a per vehicle basis: 1. If the deductible on this policy or Coverage Form is the smaller (or smallest) deductible, it will be waived; or 2. If the deductible on this policy or Coverage Form is not the smaller (or smallest) deductible, it will be reduced by the amount of the smaller (or smallest) deductible. M. Physical Damage — Comprehensive Coverage — Deductible The following is added to the Deductible Provision of the Physical Damage Coverage Section: Regardless of the number of covered "autos" damaged or stolen, the maximum deductible that will be applied to Comprehensive Coverage for all "loss" from any one cause is $5,000 or the deductible shown in the Declarations, whichever is greater. N. Temporary Substitute Autos — Physical Damage 1. The following is added to Section I— Covered Autos: Temporary Substitute Autos — Physical Damage If Physical Damage Coverage is provided by this Coverage Form on your owned covered "autos", the following types of vehicles are also covered "autos" for Physical Damage Coverage: Any "auto" you do not own when used with the permission of its owner as a temporary substitute for a covered "auto" you do own but is out of service because of its: 1. Breakdown; 2. Repair; 3. Servicing; 4. "Loss"; or 5. Destruction. 2. The following is added to the Paragraph A. Coverage Provision of the Physical Damage Coverage Section: Temporary Substitute Autos — Physical Damage We will pay the owner for "loss" to the temporary substitute "auto" unless the "loss" results from fraudulent acts or omissions on your part. If we make any payment to the owner, we will obtain the owner's rights against any other party. The deductible for the temporary substitute "auto" will be the same as the deductible for the covered "auto" it replaces. O. Amended Duties In The Event Of Accident, Claim, Suit Or Loss Paragraph a. of the Duties In The Event Of Accident, Claim, Suit Or Loss Condition is replaced by the following: a. In the event of "accident", claim, "suit" or "loss", you must give us or our authorized representative prompt notice of the "accident", claim, "suiY' or "loss". However, these duties only apply when the "accident", claim, "suit" or "loss" is known to you (if you are an individual), a partner (if you are a partnership), a member (if you are a limited liability company) or an executive officer or insurance manager (if you are a corporation). The failure of any U-CA-424-F CW (04-14) Page 4 of 6 Indudes copyrighted material of Insurance Services Office, Inc., with its permission. agent, servant or employee of the "insured" to notify us of any "accident", claim, "suiY' or "loss" shall not invalidate the insurance afforded by this policy. Include, as soon as practicable: (1) How, when and where the "accident" or "loss" occurred and if a claim is made or "suit" is brought, written notice of the claim or "suit" including, but not limited to, the date and details of such claim or "suiY'; (2) The "insured's" name and address; and (3) To the extent possible, the names and addresses of any injured persons and witnesses. If you report an "accident", claim, "suit" or "loss" to another insurer when you should have reported to us, your failure to report to us will not be seen as a violation of these amended duties provided you give us notice as soon as practicable after the fact of the delay becomes known to you. P. Waiver of Transfer Of Rights Of Recovery Against Others To Us The following is added to the Transfer Of Rights Of Recovery Against Others To Us Condition: This Condition does not apply to the extent required of you by a written contract, executed prior to any "accidenY' or "loss", provided that the "accidenY' or "loss" arises out of operations contemplated by such contract. This waiver only applies to the person or organization designated in the contract. Q. Employee Hired Autos — Physical Damage Paragraph b. of the Other Insurance Condition in the Business Auto Coverage Form and Paragraph f. of the Other Insurance — Primary and Excess Insurance Provisions Condition in the Motor Carrier Coverage Form are replaced by the following: For Hired Auto Physical Damage Coverage, the following are deemed to be covered "autos" you own: (1) Any covered "auto" you lease, hire, rent or borrow; and (2) Any covered "auto" hired or rented under a written contract or written agreement entered into by an "employee" or elected or appointed official with your permission while being operated within the course and scope of that "employee's" employment by you or that elected or appointed official's duties as respect their obligations to you. However, any "auto" that is leased, hired, rented or borrowed with a driver is not a covered "auto". R. Unintentional Failure to Disclose Hazards The following is added to the Concealment, Misrepresentation Or Fraud Condition: However, we will not deny coverage under this Coverage Form if you unintentionally: (1) Fail to disclose any hazards existing at the inception date of this Coverage Form; or (2) Make an error, omission, improper description of "autos" or other misstatement of information. You must notify us as soon as possible after the discovery of any hazards or any other information that was not provided to us prior to the acceptance of this policy. S. Hired Auto — World Wide Coverage Paragraph 7a.(5) of the Policy Period, Coverage Territory Condition is replaced by the following: (5) Anywhere in the world if a covered "auto" is leased, hired, rented or borrowed for a period of 60 days or less, T. Bodily Injury Redefined The definition of "bodily injury" in the Definitions Section is replaced by the following: "Bodily injury" means bodily injury, sickness or disease, sustained by a person including death or mental anguish, resulting from any of these at any time. Mental anguish means any type of inental or emotional illness or disease. U-CA-424-F CW (04-14) Page 5 of 6 Indudes copyrighted material of Insurance Services Office, Inc., with its permission. U. Expected Or Intended Injury The Expected Or Intended Injury Exclusion in Paragraph B. Exclusions under Section II — Covered Auto Liability Coverage is replaced by the following: Expected Or Intended Injury "Bodily injury" or "property damage" expected or intended from the standpoint of the "insured". This exclusion does not apply to "bodily injury" or "property damage" resulting from the use of reasonable force to protect persons or property. V. Physical Damage — Additional Temporary Transportation Expense Coverage Paragraph A.4.a. of Section III — Physical Damage Coverage is replaced by the following: 4. Coverage Extensions a. Transportation Expenses We will pay up to $50 per day to a maximum of $1,000 for temporary transportation expense incurred by you because of the total theft of a covered "auto" of the private passenger type. We will pay only for those covered "autos" for which you carry either Comprehensive or Specified Causes of Loss Coverage. We will pay for temporary transportation expenses incurred during the period beginning 48 hours after the theft and ending, regardless of the policy's expiration, when the covered "auto" is returned to use or we pay for its "loss". W. Replacement of a Private Passenger Auto with a Hybrid or Alternative Fuel Source Auto The following is added to Paragraph A. Coverage of the Physical Damage Coverage Section: In the event of a total "loss" to a covered "auto" of the private passenger type that is replaced with a hybrid "auto" or "auto" powered by an alternative fuel source of the private passenger type, we will pay an additional 10% of the cost of the replacement "auto", excluding tax, title, license, other fees and any aftermarket vehicle upgrades, up to a maximum of $2500. The covered "auto" must be replaced by a hybrid "auto" or an "auto" powered by an alternative fuel source within 60 calendar days of the payment of the "loss" and evidenced by a bill of sale or new vehicle lease agreement. To qualify as a hybrid "auto", the "auto" must be powered by a conventional gasoline engine and another source of propulsion power. The other source of propulsion power must be electric, hydrogen, propane, solar or natural gas, either compressed or liquefied. To qualify as an "auto" powered by an alternative fuel source, the "auto" must be powered by a source of propulsion power other than a conventional gasoline engine. An "auto" solely propelled by biofuel, gasoline or diesel fuel or any blend thereof is not an "auto" powered by an alternative fuel source. X. Return of Stolen Automobile The following is added to the Coverage Extension Provision of the Physical Damage Coverage Section: If a covered "auto" is stolen and recovered, we will pay the cost of transport to return the "auto" to you. We will pay only for those covered "autos" for which you carry either Comprehensive or Specified Causes of Loss Coverage. All other terms, conditions, provisions and exclusions of this policy remain the same. U-CA-424-F CW (04-14) Page 6 of 6 Indudes copyrighted material of Insurance Services Office, Inc., with its permission. � General Liability Supplemental Coverage Endorsement ZURICH � THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. Policy No. GLO 0187957-05 Effective Date: 07/01/2022 This endorsement modifies insurance provided under the: Commercial General Liability Coverage Part The following changes apply to this Coverage Part. However, endorsements attached to this Coverage Part will supersede any provisions to the contrary in this General Liability Supplemental Coverage Endorsement. A. Broadened Named Insured 1. The following is added to Section II — Who Is An Insured: Any organization of yours, other than a partnership or joint venture, which is not shown in the Declarations, and over which you maintain an ownership interest of more than 50% of such organization as of the effective date of this Coverage Part, will qualify as a Named Insured. However, such organization will not qualify as a Named Insured under this provision if it: a. Is newly acquired or formed during the policy period; b. Is also an insured under another policy, other than a policy written to apply specifically in excess of this Coverage Part; or c. Would be an insured under another policy but for its termination or the exhaustion of its limits of insurance. Each such organization remains qualified as a Named Insured only while you maintain an ownership interest of more than 50% in the organization during the policy period. 2. The last paragraph of Section II — Who Is An Insured does not apply to this provision to the extent that such paragraph would conflict with this provision. B. Newly Acquired or Formed Organizations as Named Insureds 1. Paragraph 3. of Section II — Who Is An Insured is replaced by the following: 3. Any organization you newly acquire or form during the policy period, other than a partnership or joint venture, and over which you maintain an ownership interest of more than 50% of such organization, will qualify as a Named Insured if there is no other similar insurance available to that organization. However: a. Coverage under this provision is afforded only until the 180'" day after you acquire or form the organization or the end of the policy period, whichever is earlier; b. Coverage A does not apply to "bodily injury" or "property damage" that occurred before you acquired or formed the organization; and c. Coverage B does not apply to "personal and advertising injury" arising out of an offense committed before you acquired or formed the organization. An additional premium will apply in accordance with our rules and rates in effect on the date you acquired or formed the organization. U-GL-1345-C CW (03/20) Page 1 of 12 Includes copyrighted material of Insurance Services Office, Inc., with its permission. 2. The last paragraph of Section II — Who Is An Insured does not apply to this provision to the extent that such paragraph would conflict with this provision. C. Insured Status — Employees Paragraph 2.a.(1) of Section II — Who Is An Insured is replaced by the following: 2. Each of the following is also an insured: a. Your "volunteer workers" only while performing duties related to the conduct of your business, or your "employees", other than either your "executive officers" (if you are an organization other than a partnership, joint venture or limited liability company) or your managers (if you are a limited liability company), but only for acts within the scope of their employment by you or while performing duties related to the conduct of your business. However, none of these "employees" or "volunteer workers" are insureds for: (1) "Bodily injury" or "personal and advertising injury": (a) To you, to your partners or members (if you are a partnership orjoint venture), to your members (if you are a limited liability company), to a co='employee" while in the course of his or her employment or performing duties related to the conduct of your business, or to your other "volunteer workers" while performing duties related to the conduct of your business; (b) To the spouse, child, parent, brother or sister of that co-"employee" or "volunteer worker" as a consequence of Paragraph (1)(a) above; (c) For which there is any obligation to share damages with or repay someone else who must pay damages because of the injury described in Paragraphs (1)(a) or (b) above; or (d) Arising out of his or her providing or failing to provide professional health care services. However: Paragraphs (1)(a) and (1)(d) do not apply to your "employees" or "volunteer workers", who are not employed by you or volunteering for you as health care professionals, for "bodily injury" arising out of "Good Samaritan Acts" while the "employee" or "volunteer worker" is performing duties related to the conduct of your business. "Good Samaritan Acts" mean any assistance of a medical nature rendered or provided in an emergency situation for which no remuneration is demanded or received. Paragraphs (1)(a), (b) and (c) do not apply to any "employee" designated as a supervisor or higher in rank, with respect to "bodily injury" to co-"employees". As used in this provision, "employees" designated as a supervisor or higher in rank means only "employees" who are authorized by you to exercise direct or indirect supervision or control over "employees" or "volunteer workers" and the manner in which work is performed. D. Additional Insureds — Lessees of Premises 1. Section II — Who Is An Insured is amended to include as an additional insured any person(s) or organization(s) who leases or rents a part of the premises you own or manage who you are required to add as an additional insured on this policy under a written contract or written agreement, but only with respect to liability arising out of your ownership, maintenance or repair of that part of the premises which is not reserved for the exclusive use or occupancy of such person or organization or any other tenant or lessee. This provision does not apply after the person or organization ceases to lease or rent premises from you. However, the insurance afforded to such additional insured: a. Only applies to the extent permitted by law; and b. Will not be broader than that which you are required by the written contract or written agreement to provide for such additional insured. 2. With respect to the insurance afforded to the additional insureds under this endorsement, the following is added to Section III — Limits Of Insurance: The most we will pay on behalf of the additional insured is the amount of insurance: U-GL-1345-C CW (03/20) Page 2 of 12 Includes copyrighted material of Insurance Services Office, Inc., with its permission. a. Required by the written contract or written agreement referenced in Subparagraph D.1. above (of this endorsement); or b. Available under the applicable Limits of Insurance shown in the Declarations, whichever is less. This Paragraph D. shall not increase the applicable Limits of Insurance shown in the Declarations. E. Additional Insured — Vendors 1. The following change applies if this Coverage Part provides insurance to you for "bodily injury" and "property damage" included in the "products-completed operations hazard": Section II — Who Is An Insured is amended to include as an additional insured any person or organization (referred to throughout this Paragraph E. as vendor) who you have agreed in a written contract or written agreement, prior to loss, to name as an additional insured, but only with respect to "bodily injury" or "property damage" arising out of "your products" which are distributed or sold in the regular course of the vendor's business: However, the insurance afforded to such vendor: a. Only applies to the extent permitted by law; and b. Will not be broader than that which you are required by the written contract or written agreement to provide for such vendor. 2. With respect to the insurance afforded to these vendors, the following additional exclusions apply: a. The insurance afforded the vendor does not apply to: (1) "Bodily injury" or "property damage" for which the vendor is obligated to pay damages by reason of the assumption of liability in a contract or agreement. This exclusion does not apply to liability for damages that the vendor would have in the absence of the contract or agreement; (2) Any express warranty unauthorized by you; (3) Any physical or chemical change in the product made intentionally by the vendor; (4) Repackaging, except when unpacked solely for the purpose of inspection, demonstration, testing, or the substitution of parts under instructions from the manufacturer, and then repackaged in the original container; (5) Any failure to make such inspections, adjustments, tests or servicing as the vendor has agreed to make or normally undertakes to make in the usual course of business, in connection with the distribution or sale of the products; (6) Demonstration, installation, servicing or repair operations, except such operations performed at the vendor's premises in connection with the sale of the product; (7) Products which, after distribution or sale by you, have been labeled or relabeled or used as a container, part or ingredient of any other thing or substance by or for the vendor; or (8) "Bodily injury" or "property damage" arising out of the sole negligence of the vendor for its own acts or omissions or those of its employees or anyone else acting on its behalf. However, this exclusion does not apply to: (a) The exceptions contained in Subparagraphs (4) or (6); or (b) Such inspections, adjustments, tests or servicing as the vendor has agreed to make or normally undertakes to make in the usual course of business, in connection with the distribution or sale of the products. b. This insurance does not apply to any insured person or organization, from whom you have acquired such products, or any ingredient, part or container, entering into, accompanying or containing such products. c. This insurance does not apply to any of "your products" for which coverage is excluded under this Coverage Part. U-GL-1345-C CW (03/20) Page 3 of 12 Includes copyrighted material of Insurance Services Office, Inc., with its permission. 3. With respect to the insurance afforded to the vendor under this endorsement, the following is added to Section III — Limits Of Insurance: The most we will pay on behalf of the vendor is the amount of insurance: a. Required by the written contract or written agreement referenced in Subparagraph E.1. above (of this endorsement); or b. Available under the applicable Limits of Insurance shown in the Declarations, whichever is less. This Paragraph E. shall not increase the applicable Limits of Insurance shown in the Declarations. F. Additional Insured — Managers, Lessors or Governmental Entity 1. Section II — Who Is An Insured is amended to include as an insured any person or organization who is a manager, lessor or governmental entity who you are required to add as an additional insured on this policy under a written contract, written agreement or permit, but only with respect to liability for "bodily injury", "property damage" or "personal and advertising injury" caused, in whole or in part, by: a. Your acts or omissions; or b. The acts or omission of those acting on your behalf; and resulting directly from: a. Operations performed by you or on your behalf for which the state or political subdivision has issued a permit; b. Ownership, maintenance, occupancy or use of premises by you; or c. Maintenance, operation or use by you of equipment leased to you by such person or organization. However, the insurance afforded to such additional insured: a. Only applies to the extent permitted by law; and b. Will not be broader than that which you are required by the written contract or written agreement to provide for such additional insured. 2. This provision does not apply: a. Unless the written contract or written agreement has been executed, or the permit has been issued, prior to the "bodily injury", "property damage" or offense that caused "personal and advertising injury"; b. To any person or organization included as an insured under Paragraph 3. of Section II — Who Is An Insured; c. To any lessor of equipment if the "occurrence" or offense takes place after the equipment lease expires; d. To any: (1) Owners or other interests from whom land has been leased by you; or (2) Managers or lessors of premises, if: (a) The "occurrence" or offense takes place after the expiration of the lease or you cease to be a tenant in that premises; (b) The "bodily injury", "property damage" or "personal and advertising injury" arises out of the structural alterations, new construction or demolition operations performed by or on behalf of the manager or lessor; or (c) The premises are excluded under this Coverage Part. 3. With respect to the insurance afforded to the additional insureds under this endorsement, the following is added to Section III — Limits Of Insurance: The most we will pay on behalf of the additional insured is the amount of insurance: a. Required by the written contract or written agreement referenced in Subparagraph F.1. above (of this endorsement); or U-GL-1345-C CW (03/20) Page 4 of 12 Includes copyrighted material of Insurance Services Office, Inc., with its permission. b. Available under the applicable Limits of Insurance shown in the Declarations, whichever is less. This Paragraph F. shall not increase the applicable Limits of Insurance shown in the Declarations. G. Damage to Premises Rented or Occupied by You 1. The last paragraph under Paragraph 2. Exclusions of Section I— Coverage A— Bodily Injury And Property Damage Liability is replaced by the following: Exclusions c. through n. do not apply to damage by "specific perils" to premises while rented to you or temporarily occupied by you with permission of the owner. A separate Damage To Premises Rented To You Limit of Insurance applies to this coverage as described in Section III — Limits Of Insurance. 2. Paragraph 6. of Section III — Limits Of Insurance is replaced by the following: 6. Subject to Paragraph 5. above, the Damage To Premises Rented To You Limit is the most we will pay under Coverage A for damages because of "property damage" to any one premises while rented to you, or in the case of damage by one or more "specific perils" to any one premises, while rented to you or temporarily occupied by you with permission of the owner. H. Broadened Contractual Liability The "insured contract" definition under the Definitions Section is replaced by the following: "Insured contract" means: a. A contract for a lease of premises. However, that portion of the contract for a lease of premises that indemnifies any person or organization for damage by "specific perils" to premises while rented to you or temporarily occupied by you with permission of the owner is not an "insured contract"; b. A sidetrack agreement; c. Any easement or license agreement; d. An obligation, as required by ordinance, to indemnify a municipality, except in connection with work for a municipality; e. An elevator maintenance agreement; f. That part of any other contract or agreement pertaining to your business (including an indemnification of a municipality in connection with work performed for a municipality) under which you assume the tort liability of another party to pay for "bodily injury", "property damage", or "personal and advertising injury" arising out of the offenses of false arrest, detention or imprisonment, to a third person or organization. Tort liability means a liability that would be imposed by law in the absence of any contract or agreement. Paragraph f. does not include that part of any contract or agreement: (1) That indemnifies an architect, engineer or surveyor for injury or damage arising out of: (a) Preparing, approving, or failing to prepare or approve, maps, shop drawings, opinions, reports, surveys, field orders, change orders or drawings and specifications; or (b) Giving directions or instructions, or failing to give them, if that is the primary cause of the injury or damage; or (2) Under which the insured, if an architect, engineer or surveyor, assumes liability for an injury or damage arising out of the insured's rendering or failure to render professional services, including those listed in Paragraph (1) above and supervisory, inspection, architectural or engineering activities. I. Definition — Specific Perils The following definition is added to the Definitions Section: "Specific perils" means: a. Fire; b. Lightning; U-GL-1345-C CW (03/20) Page 5 of 12 Includes copyrighted material of Insurance Services Office, Inc., with its permission. c. Explosion; d. Windstorm or hail; e. Smoke; f. Aircraft or vehicles; g. Vandalism; h. Weight of snow, ice or sleet; i. Leakage from fire extinguishing equipment, including sprinklers; or j. Accidental discharge or leakage of water or steam from any part of a system or appliance containing water or steam. J. Limited Contractual Liability Coverage — Personal and Advertising Injury 1. Exclusion e. of Section I— Coverage B— Personal And Advertising Injury Liability is replaced by the following: 2. Exclusions This insurance does not apply to: e. Contractual Liability "Personal and advertising injury" for which the insured has assumed liability in a contract or agreement. This exclusion does not apply to: (1) Liability for damages that the insured would have in the absence of the contract or agreement; or (2) Liability for "personal and advertising injury" if: (a) The "personal and advertising injury" arises out of the offenses of false arrest, detention or imprisonment; (b) The liability pertains to your business and is assumed in a written contract or written agreement in which you assume the tort liability of another. Tort liability means a liability that would be imposed by law in the absence of any contract or agreement; and (c) The "personal and advertising injury" occurs subsequent to the execution of the written contract or written agreement. Solely for purposes of liability so assumed in such written contract or written agreement, reasonable attorney fees and necessary litigation expenses incurred by or for a party other than an insured are deemed to be damages because of "personal and advertising injury" described in Paragraph (a) above, provided: (i) Liability to such party for, or for the cost of, that party's defense has also been assumed in the same written contract or written agreement; and (ii) Such attorney fees and litigation expenses are for defense of that party against a civil or alternative dispute resolution proceeding in which damages to which this insurance applies are alleged. 2. Paragraph 2.d. of Section I— Supplementary Payments — Coverages A and B is replaced by the following: d. The allegations in the "suit" and the information we know about the "occurrence" or offense are such that no conflict appears to exist between the interests of the insured and the interests of the indemnitee; 3. The following is added to the paragraph directly following Paragraph 2.f. of Section I— Supplementary Payments — Coverages A and B: Notwithstanding the provisions of Paragraph 2.e.(2) of Section I— Coverage B— Personal And Advertising Injury Liability, such payments will not be deemed to be damages for "personal and advertising injury" and will not reduce the limits of insurance. U-GL-1345-C CW (03/20) Page 6 of 12 Includes copyrighted material of Insurance Services Office, Inc., with its permission. K. Supplementary Payments The following changes apply to Supplementary Payments — Coverages A and B: Paragraphs 1.b. and 1.d. are replaced by the following: b. Up to $2,500 for the cost of bail bonds required because of accidents or traffic law violations arising out of the use of any vehicle to which the Bodily Injury Liability Coverage applies. We do not have to furnish these bonds. d. All reasonable expenses incurred by the insured at our request to assist us in the investigation or defense of the claim or "suit", including actual loss of earnings up to $500 a day because of time off from work. L. Broadened Property Damage 1. Property Damage to Contents of Premises Rented Short-Term The paragraph directly following Paragraph (6) in Exclusion j. of Section I— Coverage A— Bodily Injury And Property Damage Liability is replaced by the following: Paragraphs (1), (3) and (4) of this exclusion do not apply to "property damage" to premises (other than damage by "specific perils"), including "property damage" to the contents of such premises, rented to you under a rental agreement for a period of 14 or fewer consecutive days. A separate Limit of Insurance applies to Damage to Premises Rented to You as described in Section III — Limits Of Insurance. 2. Elevator Property Damage a. The following is added to Exclusion j. of Section I— Coverage A— Bodily Injury And Property Damage Liability: Paragraphs (3) and (4) of this exclusion do not apply to "property damage" arising out of the use of an elevator at premises you own, rent or occupy. b. The following is added to Section III — Limits Of Insurance: Subject to Paragraph 5. above, the most we will pay under Coverage A for damages because of "property damage" to property loaned to you or personal property in the care, custody or control of the insured arising out of the use of an elevator at premises you own, rent or occupy is $25,000 per "occurrence". 3. Property Damage to Borrowed Equipment a. The following is added to Exclusion j. of Section I— Coverage A— Bodily Injury And Property Damage Liability: Paragraph (4) of this exclusion does not apply to "property damage" to equipment you borrow from others at a jobsite. b. The following is added to Section III — Limits Of Insurance: Subject to Paragraph 5. above, the most we will pay under Coverage A for damages because of "property damage" to equipment you borrow from others is $25,000 per "occurrence". M. Expected or Intended Injury or Damage Exclusion a. of Section I— Coverage A— Bodily Injury And Property Damage Liability is replaced by the following: a. Expected Or Intended Injury Or Damage "Bodily injury" or "property damage" expected or intended from the standpoint of the insured. This exclusion does not apply to "bodily injury" or "property damage" resulting from the use of reasonable force to protect persons or property. N. Definitions — Bodily Injury The "bodily injury" definition under the Definitions Section is replaced by the following: "Bodily injury" means bodily injury, sickness or disease sustained by a person, including mental anguish, mental injury, shock, fright or death sustained by that person which results from that bodily injury, sickness or disease. U-GL-1345-C CW (03/20) Page 7 of 12 Includes copyrighted material of Insurance Services Office, Inc., with its permission. O. Insured Status — Amateur Athletic Participants Section II — Who Is An Insured is amended to include as an insured any person you sponsor while participating in amateur athletic activities. However, no such person is an insured for: a. "Bodily injury" to: (1) Your "employee", "volunteer worker" or any person you sponsor while participating in such amateur athletic activities; or (2) You, any partner or member (if you are a partnership or joint venture), or any member (if you are a limited liability company) while participating in such amateur athletic activities; or b. "Property damage" to property owned by, occupied or used by, rented to, in the care, custody or control of, or over which the physical control is being exercised for any purpose by: (1) Your "employee", "volunteer worker" or any person you sponsor; or (2) You, any partner or member (if you are a partnership or joint venture), or any member (if you are a limited liability company). P. Non-Owned Aircraft, Auto and Watercraft Exclusion g. of Section I— Coverage A— Bodily Injury And Property Damage Liability is replaced by the following: g. Aircraft, Auto Or Watercraft "Bodily injury" or "property damage" arising out of the ownership, maintenance, use or entrustment to others of any aircraft, "auto" or watercraft owned or operated by or rented or loaned to any insured. Use includes operation and "loading or unloading". This exclusion applies even if the claims against any insured allege negligence or other wrongdoing in the supervision, hiring, employment, training or monitoring of others by that insured, if the "occurrence" which caused the "bodily injury" or "property damage" involved the ownership, maintenance, use or entrustment to others of any aircraft, "auto" or watercraft that is owned or operated by or rented or loaned to any insured. This exclusion does not apply to: (1) A watercraft while ashore on premises you own or rent; (2) A watercraft you do not own that is: (a) Less than 51 feet long; and (b) Not being used to carry persons for a charge; (3) Parking an "auto" on, or on the ways next to, premises you own or rent, provided the "auto" is not owned by or rented or loaned to you or the insured; (4) Liability assumed under any "insured contract" for the ownership, maintenance or use of aircraft or watercraft; (5) An aircraft that is hired or chartered by you or loaned to you, with a paid and licensed crew, and is not owned in whole or in part by an insured; or (6) "Bodily injury" or "property damage" arising out of: (a) The operation of machinery or equipment that is attached to, or part of, a land vehicle that would qualify under the definition of "mobile equipmenY' if it were not subject to a compulsory or financial responsibility law or other motor vehicle insurance law where it is licensed or principally garaged; or (b) The operation of any of the machinery or equipment listed in Paragraph f.(2) or f.(3) of the definition of "mobile equipment". Q. Definitions — Leased Worker, Temporary Worker and Labor Leasing Firm 1. The "leased worker" and "temporary worker" definitions under the Definitions Section are replaced by the following: U-GL-1345-C CW (03/20) Page 8 of 12 Includes copyrighted material of Insurance Services Office, Inc., with its permission. "Leased worker" means a person leased to you by a"labor leasing firm" under a written agreement between you and the "labor leasing firm", to perform duties related to the conduct of your business. "Leased worker" does not include a "temporary worker". "Temporary worker" means a person who is furnished to you to support or supplement your work force during "employee" absences, temporary skill shortages, upturns or downturns in business or to meet seasonal or short- term workload conditions. "Temporary worker" does not include a"leased worker". 2. The following definition is added to the Definitions Section: "Labor leasing firm" means any person or organization who hires out workers to others, including any: a. Employment agency, contractor or services; b. Professional employer organization; or c. Temporary help service. R. Definition — Mobile Equipment Paragraph f. of the "mobile equipmenY' definition under the Definitions Section is replaced by the following: f. Vehicles not described in Paragraph a., b., c. or d. above maintained primarily for purposes other than the transportation of persons or cargo. However, self-propelled vehicles with the following types of permanently attached equipment, exceeding a combined gross vehicle weight of 1000 pounds, are not "mobile equipment" but will be considered "autos": (1) Equipment designed primarily for: (a) Snow removal; (b) Road maintenance, but not construction or resurfacing; or (c) Street cleaning; (2) Cherry pickers and similar devices mounted on automobile or truck chassis and used to raise or lower workers; and (3) Air compressors, pumps and generators, including spraying, welding, building cleaning, geophysical exploration, lighting and well servicing equipment. S. Definitions — Your Product and Your Work The "your product" and "your work" definitions under the Definitions Section are replaced by the following: "Your product": a. Means: (1) Any goods or products, other than real property, manufactured, sold, handled, distributed or disposed of by: (a) You; (b) Others trading under your name; or (c) A person or organization whose business or assets you have acquired; and (2) Containers (other than vehicles), materials, parts or equipment furnished in connection with such goods or products. b. Includes: (1) Warranties or representations made at any time with respect to the fitness, quality, durability, performance, use, handling, maintenance, operation or safety of "your product"; and (2) The providing of or failure to provide warnings or instructions. c. Does not include vending machines or other property rented to or located for the use of others but not sold. U-GL-1345-C CW (03/20) Page 9 of 12 Includes copyrighted material of Insurance Services Office, Inc., with its permission. "Your work": a. Means: (1) Work, services or operations performed by you or on your behalf; and (2) Materials, parts or equipment furnished in connection with such work, services or operations. b. Includes: (1) Warranties or representations made at any time with respect to the fitness, quality, durability, performance, use, handling, maintenance, operation or safety of "your work"; and (2) The providing of or failure to provide warnings or instructions. T. Duties in the Event of Occurrence, Offense, Claim or Suit Condition The following paragraphs are added to Paragraph 2. Duties In The Event Of Occurrence, Offense, Claim Or Suit of Section IV — Commercial General Liability Conditions: Notice of an "occurrence" or of an offense which may result in a claim under this insurance or notice of a claim or "suit" shall be given to us as soon as practicable after knowledge of the "occurrence", offense, claim or "suit" has been reported to any insured listed under Paragraph 1. of Section II — Who Is An Insured or an "employee" authorized by you to give or receive such notice. Knowledge by other "employees" of an "occurrence", offense, claim or "suit" does not imply that you also have such knowledge. In the event that an insured reports an "occurrence" to the workers compensation carrier of the Named Insured and this "occurrence" later develops into a General Liability claim, covered by this Coverage Part, the insured's failure to report such "occurrence" to us at the time of the "occurrence" shall not be deemed to be a violation of this Condition. You must, however, give us notice as soon as practicable after being made aware that the particular claim is a General Liability rather than a Workers Compensation claim. U. Other Insurance Condition Paragraphs 4.a. and 4.b.(1) of the Other Insurance Condition of Section IV — Commercial General Liability Conditions are replaced by the following: 4. Other Insurance If other valid and collectible insurance is available to the insured for a loss we cover under Coverages A or B of this Coverage Part, our obligations are limited as follows: a. Primary Insurance This insurance is primary except when Paragraph b. below applies. If this insurance is primary, our obligations are not affected unless any of the other insurance is also primary. Then, we will share with all that other insurance by the method described in Paragraph c. below. However, this insurance is primary to and will not seek contribution from any other insurance available to an additional insured provided that: (1) The additional insured is a Named Insured under such other insurance; and (2) You are required by written contract or written agreement that this insurance be primary and not seek contribution from any other insurance available to the additional insured. Other insurance includes any type of self insurance or other mechanism by which an insured arranges for funding of its legal liabilities. b. Excess Insurance (1) This insurance is excess over: (a) Any of the other insurance, whether primary, excess, contingent or on any other basis: (i) That is property insurance, Builder's Risk, Installation Risk or similar coverage for "your work"; (ii) That is property insurance purchased by you (including any deductible or self insurance portion thereof) to cover premises rented to you or temporarily occupied by you with permission of the owner; U-GL-1345-C CW (03/20) Page 10 of 12 Includes copyrighted material of Insurance Services Office, Inc., with its permission. (iii) That is insurance purchased by you (including any deductible or self insurance portion thereof) to cover your liability as a tenant for "property damage" to premises rented to you or temporarily occupied by you with permission of the owner; (iv) If the loss arises out of the maintenance or use of aircraft, "autos" or watercraft to the extent not subject to Exclusion g. of Section I— Coverage A— Bodily Injury And Property Damage Liability; or (v) That is property insurance (including any deductible or self insurance portion thereof) purchased by you to cover damage to: Equipment you borrow from others; or Property loaned to you or personal property in the care, custody or control of the insured arising out of the use of an elevator at premises you own, rent or occupy. (b) Any other primary insurance (including any deductible or self insurance portion thereof) available to the insured covering liability for damages arising out of the premises, operations, products, work or services for which the insured has been granted additional insured status either by policy provision or attachment of any endorsement. Other primary insurance includes any type of self insurance or other mechanism by which an insured arranges for funding of its legal liabilities. (c) Any of the other insurance, whether primary, excess, contingent or on any other basis, available to an additional insured, in which the additional insured on our policy is also covered as an additional insured on another policy providing coverage for the same "occurrence", claim or "suit". This provision does not apply to any policy in which the additional insured is a Named Insured on such other policy and where our policy is required by written contract or written agreement to provide coverage to the additional insured on a primary and non-contributory basis. V. Unintentional Failure to Disclose All Hazards Paragraph 6. Representations of Section IV — Commercial General Liability Conditions is replaced by the following: 6. Representations By accepting this policy, you agree: a. The statements in the Declarations are accurate and complete; b. Those statements are based upon representations you made to us; and c. We have issued this policy in reliance upon your representations. Coverage will continue to apply if you unintentionally: a. Fail to disclose all hazards existing at the inception of this policy; or b. Make an error, omission or improper description of premises or other statement of information stated in this policy. You must notify us as soon as possible after the discovery of any hazards or any other information that was not provided to us prior to inception of this Coverage Part. W. Waiver of Right of Subrogation Paragraph 8. Transfer Of Rights Of Recovery Against Others To Us of Section IV — Commercial General Liability Conditions is replaced by the following: 8. Transfer Of Rights Of Recovery Against Others To Us a. If the insured has rights to recover all or part of any payment we have made under this Coverage Part, those rights are transferred to us. The insured must do nothing after loss to impair them. At our request, the insured will bring "suit" or transfer those rights to us and help us enforce them. b. If the insured waives its right to recover payments for injury or damage from another person or organization in a written contract executed prior to a loss, we waive any right of recovery we may have against such person or organization because of any payment we have made under this Coverage Part. The written contract will U-GL-1345-C CW (03/20) Page 11 of 12 Includes copyrighted material of Insurance Services Office, Inc., with its permission. be considered executed when the insured's performance begins, or when it is signed, whichever happens first. This waiver of rights shall not be construed to be a waiver with respect to any other operations in which the insured has no contractual interest. X. Liberalization Condition The following condition is added to Section IV — Commercial General Liability Conditions: Liberalization Clause If we revise this Coverage Part to broaden coverage without an additional premium charge, your policy will automatically provide the additional coverage as of the day the revision is effective in the state shown in the mailing address of your policy. All other terms, conditions, provisions and exclusions of this policy remain the same. U-GL-1345-C CW (03/20) Page 12 of 12 Includes copyrighted material of Insurance Services Office, Inc., with its permission. Policy # WC0187956-05 WORKERS COMPENSATION AND EMPLOYERS LIABILITY INSURANCE POLICY WC 00 03 13 (Ed. 4-84) WAIVER OF OUR RIGHT TO RECOVER FROM OTHERS ENDORSEMENT We have the right to recover our payments from anyone liable for an injury covered by this policy. We will not enforce our right against the person or organization named in the Schedule. (This agreement applies only to the extent that you perform work under a written contract that requires you to obtain this agreement from us.) This agreement shall not operate directly or indirectly to benefit anyone not named in the Schedule. Schedule ALL PERSONS AND/OR ORGANIZATIONS THAT ARE REQUIRED BY WRITTEN CONTRACT OR AGREEMENT WITH THE INSURED, EXECUTED PRIOR TO THE ACCIDENT OR LOSS, THAT WAIVER OF SUBROGATION BE PROVIDED UNDER THIS POLICY FOR WORK PERFORMED BY YOU FOR THAT PERSON AND/OR ORGANIZATION. WC000313 (Ed.4-84) � 1983 National Council on Compensation Insurance. � Blanket Notification to Others of Cancellation Z U RI C H or Non-Renewal THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. Policy No. GLO 0187959-05 Effective Date: 07/01/2022 This endorsement applies to insurance provided under the: Commercial General Liability Coverage Part A. If we cancel or non-renew this Coverage Part by written notice to the first Named Insured, we will mail or deliver notification that such Coverage Part has been cancelled or non-renewed to each person or organization shown in a list provided to us by the first Named Insured if you are required by written contact or written agreement to provide such notification. Such list: 1. Must be provided to us prior to cancellation or non-renewal; 2. Must contain the names and addresses of only the persons or organizations requiring notification that such Coverage Part has been cancelled or non-renewed; and 3. Must be in an electronic format that is acceptable to us. B. Our notification as described in Paragraph A. of this endorsement will be based on the most recent list in our records as of the date the notice of cancellation or non-renewal is mailed or delivered to the first Named Insured. We will mail or deliver such notification to each person or organization shown in the list: 1. Within 10 days of the effective date of the notice of cancellation, if we cancel for non-payment of premium; or 2. At least 30 days prior to the effective date of: a. Cancellation, if cancelled for any reason other than nonpayment of premium; or b. Non-renewal, but not including conditional notice of renewal, unless a greater number of days is shown in the Schedule of this endorsement for the mailing or delivering of such notification with respect to Paragraph B.1. or Paragraph B.2. above. C. Our mailing or delivery of notification described in Paragraphs A. and B. of this endorsement is intended as a courtesy only. Our failure to provide such mailing or delivery will not: 1. Extend the Coverage Part cancellation or non-renewal date; 2. Negate the cancellation or non-renewal; or 3. Provide any additional insurance that would not have been provided in the absence of this endorsement. U-GL-1521-B CW (01/19) Page 1 of 2 Includes copyrighted material of Insurance Services Office, Inc., with its permission. D. We are not responsible for the accuracy, integrity, timeliness and validity of information contained in the list provided to us as described in Paragraphs A. and B. of this endorsement. SCHEDULE The total number of days for mailing or delivering with respect to Paragraph B.1. of �,; this endorsement is amended to indicate the following number of days: The total number of days for mailing or delivering with respect to Paragraph B.2. of 30** this endorsement is amended to indicate the following number of days: * If a number is not shown here, 10 days continues to apply. ** If a number is not shown here, 30 days continues to apply. All other terms and conditions of this policy remain unchanged. U-GL-1521-B CW (01/19) Page 2 of 2 Includes copyrighted material of Insurance Services Office, Inc., with its permission. Blanket Notification to Others of Cancellation or Non-Renewal Policy No. BAP0187958- Eff. Date of Pol 7/1/22 � ���i�H Exp. Date of Pol. Eff. Date of End. Producer No. Add'I. Prem Return Prem. 7/1/23 %/1/22 50858000 THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. This endorsement modifies insurance provided under the: Commercial Automobile Coverage Part A. If we cancel or non-renew this Coverage Part by written notice to the first Named Insured, we will mail or deliver notification that such Coverage Part has been cancelled or non-renewed to each person or organization shown in a list provided to us by the first Named Insured if you are required by written contact or written agreement to provide such notification. However, such notification will not be mailed or delivered if a conditional notice of renewal has been sent to the first Named Insured. Such list: 1. Must be provided to us prior to cancellation or non-renewal; 2. Must contain the names and addresses of only the persons or organizations requiring notification that such Coverage Part has been cancelled or non-renewed; and 3. Must be in an electronic format that is acceptable to us. B. Our notification as described in Paragraph A. of this endorsement will be based on the most recent list in our records as of the date the notice of cancellation or non-renewal is mailed or delivered to the first Named Insured. We will mail or deliver such notification to each person or organization shown in the list: 1. Within seven days of the effective date of the notice of cancellation, if we cancel for non-payment of premium; or 2. At least 30 days prior to the effective date of: a. Cancellation, if cancelled for any reason other than nonpayment of premium; or b. Non-renewal, but not including conditional notice of renewal. C. Our mailing or delivery of notification described in Paragraphs A. and B. of this endorsement is intended as a courtesy only. Our failure to provide such mailing or delivery will not: 1. Extend the Coverage Part cancellation or non-renewal date; 2. Negate the cancellation or non-renewal; or 3. Provide any additional insurance that would not have been provided in the absence of this endorsement. D. We are not responsible for the accuracy, integrity, timeliness and validity of information contained in the list provided to us as described in Paragraphs A. and B. of this endorsement. All other terms and conditions of this policy remain unchanged. U-CA-832-A CW (01 / 13) Pag e 1 of 1 Includes copyrighted material of Insurance Services Office, Inc., with its permission. WORKERS COMPENSATION AND EMPLOYERS LIABILITY INSURANCE POLICY WC 99 06 43 BLANKET NOTIFICATION TO OTHERS OF CANCELLATION OR NONRENEWAL ENDORSEMENT This endorsement adds the following to Part Six of the policy. PART SIX CONDITIONS Blanket Notffication to Others of Cancellation or Nonrenewal 1. If we cancel or non-renew this policy by written notice to you, we will mail or deliver notification that such policy has been cancelled or non-renewed to each person or organization shown in a list provided to us by you if you are required by written contract or written agreement to provide such notification. However, such notification will not be mailed or delivered if a conditional notice of renewal has been sent to you. Such list: a. Must be provided to us prior to cancellation or non-renewal; b. Must contain the names and addresses of only the persons or organizations requiring notification that such policy has been cancelled or non-renewed; and c. Must be in an electronic format that is acceptable to us. 2. Our notification as described in Paragraph 1. above will be based on the most recent list in our records as of the date the notice of cancellation or non-renewal is mailed or delivered to you. We will mail or deliver such notification to each person or organization shown in the list: a. Within seven days of the effective date of the notice of cancellation, if we cancel for non-payment of premium; or b. At least 30 days prior to the effective date of: (1) Cancellation, if cancelled for any reason other than nonpayment of premium; or (2) Non-renewal, but not including conditional notice of renewal. 3. Our mailing or delivery of notification described in Paragraphs 1. and 2. above is intended as a courtesy only. Our failure to provide such mailing or delivery will not: a. Extend the policy cancellation or non-renewal date; b. Negate the cancellation or non-renewal; or c. Provide any additional insurance that would not have been provided in the absence of this endorsement. 4. We are not responsible for the accuracy, integrity, timeliness and validity of information contained in the list provided to us as described in Paragraphs 1. and 2. above. All other terms and conditions of this policy remain unchanged. This endorsement changes the policy to which it is attached and is effective on the date issued unless otherwise stated. (The information below is required only when this endorsement is issued subsequent to preparation of the policy.) Endorsement Effective �/1/22 Policy No. WC0187956-05 Endorsement No. Premium $ Insurance Company Zurich American Insurance Company WC 99 06 43 Page 1 of 1 (Ed. 01-13) Includes copyright material of the National Council on Compensation Insurance, Inc. used with its permission. �� 2012 Copyright National Council on Compensation Insurance, Inc. All Rights Reserved. THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. TEXAS CONTRACTOR'S BLANKET ADDITIONAL INSURED ENDORSEMENT - FORM A This endorsement modifies insurance provided under the following: COMMERCIAL GENERAL LIABILITY COVERAGE PART Policy Number Agency Number Policy Effective Date c CPP2117851 6 21 21 Policv Expiration Date Date Account Number 6/ai/aa Named Insured Agency Issuing Company . IBTX — LAS COLINAS AMERISURE INSURANCE Moss Utilities, LLC COMPANY 1. a. SECTION II - WHO IS AN INSURED is amended to add as an additional insured any person or organization whom you are required to add as an additional insured on this policy under a written contract or written agreement relating to your business. b. The written contract or written agreement must: (1) Require additional insured status for a time period during the term of this policy; and (2) Be executed prior to the "bodily injury", "property damage", or "personal and advertising injury" leading to a claim under this policy. C. If, however: (1) "Your work" began under a letter of intent or work order; and (2) The letter of intent or work order led to a written contract or written agreement within 30 days of beginning such work; and (3) Your customer's customary contracts require persons or organizations to be named as additional insureds; we will provide additional insured status as specified in this endorsement. 2. The insurance provided under this endorsement is limited as follows: a. That person or organization is an additional insured only with respect to liability caused, in whole or in part, by: (1) Premises you: (a) Own; (b) Rent; (C) Lease; or (d) Occupy; (2) Ongoing operations performed by you or on your behalf. Ongoing operations does not apply to "bodily injury" or "property damage" occurring after: (a) All work to be performed by you or on your behalf for the additional insured(s) at the site of the covered operations is complete, including related materials, parts or equipment (other than service, maintenance or repairs); or (b) That portion of "your work" out of which the injury or damage arises is put to its intended use by any person or organization other than another contractor working for a principal as a part of the same project. Includes copyrighted material of Insurance Services Office, Inc. CG 70 851015 Pages 1 of 3 (3) Completed operations coverage, but only if: (a) The written contract or written agreement requires completed operations coverage or "your work" coverage; and (b) This coverage part provides coverage for "bodily injury" or "property damage" included within the "products-completed operations hazard". However, the insurance afforded to such additional insured only applies to the extent permitted by law. b. If the written contract or written agreement: (1) Requires "arising out of" language; or (2) Requires you to provide additional insured coverage to that person or organization by the use of either or both of the following: (a) Additional Insured — Owners, Lessees or Contractors — Scheduled Person Or Organization endorsement CG 20 10 10 01; or (b) Additional Insured — Owners, Lessees or Contractors — Completed Operations endorsement CG 20 371001; then the phrase "caused, in whole or in part, by" in paragraph 2.a. above is replaced by "arising out of". C. If the written contract or written agreement requires you to provide additional insured coverage to that person or organization by the use of: (1) Additional Insured — Owners, Lessees or Contractors — Scheduled Person Or Organization endorsement CG 20 10 07 04 or CG 20 10 04 13; or (2) Additional Insured — Owners, Lessees or Contractors — Completed Operations endorsement CG 20 37 07 04 or CG 20 37 04 13; or (3) Both those endorsements with either of those edition dates; or (4) Either or both of the following: (a) Additional Insured — Owners, Lessees or Contractors — Scheduled Person Or Organization endorsement CG 20 10 without an edition date specified; or (b) Additional Insured — Owners, Lessees or Contractors — Completed Operations endorsement CG 20 37 without an edition date specified; then paragraph 2.a. above applies. d. Premises, as respects paragraph 2.a.(1) above, include common or public areas about such premises if so required in the written contract or written agreement. e. Additional insured status provided under paragraphs 2.a.(1)(b) or 2.a.(1)(C) above does not extend beyond the end of a premises lease or rental agreement. f. The limits of insurance that apply to the additional insured are the least of those specified in the: (1) Written contract; (2) Written agreement; or (3) Declarations of this policy. The limits of insurance are inclusive of and not in addition to the limits of insurance shown in the Declarations. g. The insurance provided to the additional insured does not apply to "bodily injury", "property damage", or "personal and advertising injury" arising out of an architecYs, engineer's, or surveyor's rendering of, or failure to render, any professional services, including but not limited to: (1) The preparing, approving, or failing to prepare or approve: (a) Maps; (b) Drawings; (C) Opinions; Includes copyrighted material of Insurance Services Office, Inc. Page 2 of 3 CG 70 851015 (d) Reports; (e) Surveys; (f) Change orders; (g) Design specifications; and (2) Supervisory, inspection, or engineering services. h. SECTION IV — COMMERCIAL GENERAL LIABILITY CONDITIONS, paragraph 4. Other Insurance is deleted and replaced with the following: 4. Other Insurance. Coverage provided by this endorsement is excess over any other valid and collectible insurance available to the additional insured whether: a. Primary; b. Excess; C. Contingent; or d. On any other basis; but if the written contract or written agreement requires primary and non-contributory coverage, this insurance will be primary and non-contributory relative to other insurance available to the additional insured which covers that person or organization as a Named Insured, and we will not share with that otherinsurance. If the written contract or written agreement as outlined above requires additional insured status by use of CG 20 10 11 85, then the coverage provided under this CG 70 85 endorsement does not apply except for paragraph 2.h. Other Insurance. Additional insured status is limited to that provided by CG 20 10 1 1 85 shown below and paragraph 2.h. Other InsuranCe shown above. ADDITIONAL INSURED - OWNERS, LESSEES OR CONTRACTORS (FORM B) This endorsement modifies insurance provided under the following: COMMERCIAL GENERAL LIABILITY COVERAGE PART. SCHEDULE Name of Person or Organization: Blanket where required by written contract or written agreement that the terms of CG 20 10 11 85 apply. (If no entry appears above, information required to complete this endorsement will be shown in the Declarations as applicable to this endorsement.) WHO IS AN INSURED (Section II) is amended to include as an insured the person or organization shown in the Schedule, but only with respect to liability arising out of "your work" for that insured by or for you. CG 20 10 11 85 Copyright, Insurance Services Office, Inc., 1984 j. The insurance provided by this endorsement does not apply to any premises or work for which the person or organization is specifically listed as an additional insured on another endorsement attached to this policy. Includes copyrighted material of Insurance Services Office, Inc. CG 70 851015 Pages 3 of 3 Insured: Moss Utilities, LLC PoliCy #CA2117850 THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. TEXAS ADVANTAGE COMMERCIAL AUTOMOBILE BROAD FORM ENDORSEMENT This endorsement modifies insurance provided under the BUSINESSAUTO COVERAGE FORM With respect to coverage provided by this endorsement, the provisions of the Coverage Form apply unless modified by the endorsement. The premium for this endorsement is $ 1. BROAD FORM INSURED SECTION II - LIABILITY COVERAGE, A.1. Who Is An Insured is amended by the addition of the following: d. Any organization you newly acquire or form, other than a partnership, joint venture or limited liability company, and over which you maintain ownership or a majority interest, will qualify as a Named Insured. H oweve r, (1) Coverage under this provision is afforded only until the end of the policy period; (2) Coverage does not apply to "accidents" or "loss" that occurred before you acquired or formed the organization; and (3) Coverage does not apply to an organization that is an "insured" under any other policy or would be an "insured" but for its termination or the exhausting of its limit of insurance. e. Any "employee" of yours using: (1) A covered "auto" you do not own, hire or borrow, or a covered "auto" not owned by the "employee" or a member of his or her household, while performing duties related to the conduct of your business or your personal affairs; or (2) An "auto" hired or rented under a contract or agreement in that "employee's" name, with your permission, while performing duties related to the conduct of your business. However, your "employee" does not qualify as an insured under this paragraph (2) while using a covered "auto" rented from you or from any member of the "employee's" household. Your members, if you are a limited liability company, while using a covered "auto" you do not own, hire or borrow and while performing duties related to the conduct of your business or your personal affairs. g. Any person or organization with whom you agree in a written contract, written agreement or permit, to provide insurance such as is afforded under this policy, but only with respect to your covered "autos". This provision does not apply: (1) Unless the written contract or agreement is executed or the permit is issued prior to the "bodily injury" or "property damage"; (2) To any person or organization included as an insured by an endorsement or in the Declarations; or (3) To any lessor of "autos" unless: (a) The lease agreement requires you to provide direct primary insurance for the lessor; (b) The "auto" is leased without a driver; and Includes copyrighted material of Insurance Services Office, Inc. CA 71 1811 09 Page 1 of 5 (C) The lease had not expired. Leased "autos" covered under this provision will be considered covered "autos" you own and not covered "autos" you hire. h. Any legally incorporated organization or subsidiary in which you own more than 50% of the voting stock on the effective date of this endorsement. This provision does not apply to "bodily injury" or "property damage" for which an "insured" is also an insured under any other automobile policy or would be an insured under such a policy, but for its termination or the exhaustion of its limits of insurance, unless such policywas written to apply specifically in excess of this policy. 2. COVERAGE EXTENSIONS - SUPPLEMENTARY PAYMENTS Under Section II - LIABILITY COVERAGE, A2.a. Supplementary Payments, paragraphs (2) and (4) are deleted and replaced as follows: (2) Up to $2,500 for the cost of bail bonds (including bonds for related traffic law violations) required because of an "accident" we cover. We do not have to furnish these bonds. (4) All reasonable expenses incurred by the "insured" at our request, including actual loss of earnings up to $500 a day because of time off from work. 3. AMENDED FELLOW EMPLOYEE EXCLUSION Under SECTION II - LIABILITY COVERAGE, B. EXCLUSIONS, paragraph 5. Fellow Employee is deleted and replaced by the following: 5. Fellow Employee "Bodily injury" to: a. Any fellow "employee" of the "insured" arising out of and in the course of the fellow "employee's" employment or while performing duties related to the conduct of your business. However, this exclusion does not apply to your "employees" that are officers, managers, supervisors or above. Coverage is excess over any other collectible insurance. b. The spouse, child, parent, brother or sister of that fellow "employee" as a consequence of paragraph a. above. 4. HIRED AUTO PHYSICAL DAMAGE COVERAGE AND LOSS OF USE EXPENSE A. Under SECTION III - PHYSICAL DAMAGE COVERAGE, A. COVERAGE, the following is added: If any of your owned covered "autos" are covered for Physical Damage, we will provide Physical Damage coverage to "autos" that you or your "employees" hire or borrow, under your name or the "employee's" name, for the purpose of doing your work. We will provide coverage equal to the broadest physical damage coverage applicable to any covered "auto" shown in the Declarations, Item Three, Schedule of Covered Autos You Own, or on any endorsements amending this schedule. B. Under SECTION III - PHYSICAL DAMAGE COVERAGE, A.4. Coverage Extensions. paragraph b. Loss Of Use Expenses is deleted and replaced with the following: b. Loss Of Use Expenses For Hired Auto Physical Damage, we will pay expenses for which an "insured" becomes legally responsible to pay for loss of use of a vehicle rented or hired without a driver, under a written rental contract or agreement. We will pay for loss of use expenses if caused by: (1) Other than collision, only if the Declarations indicate that Comprehensive Coverage is provided for any covered "auto"; Includes copyrighted material of Insurance Services Office, Inc. Page 2 of 5 CA 71 1811 09 (2) Specified Causes of Loss, only if the Declarations indicate that Specified Causes Of Loss Coverage is provided for any covered "auto"; or (3) Collision, only if the Declarations indicate that Collision Coverage is provided for any covered "auto". However, the most we will pay for any expenses for loss of use is $30 per day, to a maximum of $2,000. C. Under SECTION IV — BUSINESS AUTO CONDITIONS, B. General Conditions, 5. Other Insurance, paragraph b. is replaced bythe following: b. For Hired Auto Physical Damage, the following are deemed to be covered "autos" you own: Any covered "auto" you lease, hire, rent or borrow; and 2. Any covered "auto" hired or rented by your "employees" under a contract in that individual "employee's" name, with your permission, while performing duties related to the conduct of your business. However, any "auto" that is leased, hired, rented or borrowed with a driver is not a covered "auto", nor is any "auto" you hire from any of your "employees", partners (if you are a partnership), members (if you are a limited liability company), or members of their households. 5. LOAN OR LEASE GAP COVERAGE Under SECTION III — PHYSICAL DAMAGE COVERAGE, A. COVERAGE, the following is added: If a covered "auto" is owned or leased and if we provide Physical Damage Coverage on it, we will pay, in the event of a covered total "loss", any unpaid amount due on the lease or loan for a covered "auto", less: (a) The amount paid under the Physical Damage Section of the policy; and: (b) Any: (1) Overdue lease or loan payments including penalties, interest or other charges resulting from overdue payments at the time of the "loss"; (2) Financial penalties imposed under a lease for excessive use, abnormal wear and tear or high mileage; (3) Costs for extended warranties, Credit Life Insurance, Health, Accident or Disability Insurance purchased with the loan or lease; (4) Security deposits not refunded by a lessor; and (5) Carry-over balances from previous loans or leases. 6. RENTAL REIMBURSEMENT Under SECTION III - PHYSICAL DAMAGE COVERAGE, A.4. Coverage Extensions, paragraph a. Transportation Expenses is deleted and replaced bythe following: a. Transportation Expenses (1) We will pay up to $75 per day to a maximum of $2,000 for transportation expense incurred by you because of covered "loss". We will pay only for those covered "autos" for which you carry Collision Coverage or either Comprehensive Coverage or Specified Causes of Loss Coverage. We will pay for transportation expenses incurred during the period beginning 24 hours after the covered "loss" and ending, regardless of the policy's expiration, when the covered "auto" is returned to use or we pay for its "loss". This coverage is in addition to the otherwise applicable coverage you have on a covered "auto". No deductibles apply to this coverage. Includes copyrighted material of Insurance Services Office, Inc. CA 71 1811 09 Page 3 of 5 (2) This coverage does not apply while there is a spare or reserve "auto" available to you for your operation. 7. AIRBAG COVERAGE Under SECTION III - PHYSICAL DAMAGE, B. EXCLUSIONS, paragraph 3. is deleted and replaced by the following: 3. We will not pay for "loss" caused by or resulting from any of the following unless caused by other "loss" that is covered by this insurance: (1) Wear and tear, freezing, mechanical or electrical breakdown. However, this exclusion does not include the discharge of an airbag. (2) Blowouts, punctures or other road damage to tires. 8. GLASS REPAIR— WAIVER OF DEDUCTIBLE Section III — PHYSICAL DAMAGE COVERAGE, D. Deductible is amended to add the following: No deductible applies to glass damage if the glass is repaired rather than replaced. 9. COLLISION COVERAGE— WAIVER OF DEDUCTIBLE Under Section III - PHYSICAL DAMAGE COVERAGE, D. Deductible is amended to add the following: When there is a loss to your covered "auto" insured for Collision Coverage, no deductible will apply if the loss was caused by a collision with another "auto" insured by us. 10. KNOWLEDGE OF ACCIDENT Under SECTION IV - BUSINESS AUTO CONDITIONS, A. Loss Conditions, 2. Duties In The Event Of ACCident, Claim, Suit Or Loss, paragraph a. is deleted and replaced by the following: a. You must see to it that we are notified as soon as practicable of an "accident", claim, "suiY' or "loss". Knowledge of an "accident", claim, "suiY' or "loss" by your "employees" shall not, in itself, constitute knowledge to you unless one of your partners, executive officers, directors, managers, or members (if you are a limited liabilitycompany) has knowledge of the "accident", claim, "suit" or "loss". Notice should include: (1) How, when and where the "accident" or "loss" occurred; (2) The "insured's" name and address; and (3) To the extent possible, the names and addresses of any injured persons and witnesses. 11. TRANSFER OF RIGHTS (BLANKET WAIVER OF SUBROGATION) Under SECTION IV - BUSINESS AUTO CONDITIONS, A. Loss Conditions paragraph 5. Transfer Of Rights Of Recovery Against Others To Us is deleted and replaced by the following: 5. Transfer Of Rights Of Recovery Against Others To Us If any person or organization to or for whom we make payment under this Coverage Form has rights to recover damages from another, those rights are transferred to us. That person or organization must do everything necessary to secure our rights and must do nothing after "accidenY' or "loss" to impair them. However, if the "insured" has waived rights to recover through a written contract, or if your work was commenced under a letter of intent or work order, subject to a subsequent reduction in writing with customers whose customary contracts require a waiver, we waive any right of recovery we may have under this Coverage Form. Includes copyrighted material of Insurance Services Office, Inc. Page 4 of 5 CA 71 1811 09 12. UNINTENTIONAL FAILURE TO DISCLOSE HAZARDS Under SECTION IV - BUSINESS AUTO CONDITIONS , B. General Conditions , paragraph 2. Concealment, Misrepresentation Or Fraud is amended by the addition of the following: We will not deny coverage under this Coverage Form if you unintentionally fail to disclose all hazards existing as of the inception date of this policy. You must report to us any knowledge of an error or omission in your representations as soon as practicable after its discovery. This provision does not affect our right to collect additional premium or exercise our right of cancellation or non-renewal. 13. BLANKET COVERAGE FOR CERTAIN OPERATIONS IN CONNECTION WITH RAILROADS When required by written contract or written agreement, the definition of "insured contract" is amended as follows: The exception contained in paragraph H.3. relating to construction or demolition operations on or within 50 feet of a railroad; and Paragraph H.a. are deleted with respect to the use of a covered "auto" in operations for, or affecting, a railroad. Includes copyrighted material of Insurance Services Office, Inc. CA 71 1811 09 Page 5 of 5 Insured: Moss Utilities, LLC Policy # PPK2357042 PIC-EVCP-001 (7/17) contamination on, at, under or migrating beyond the legal boundaries of your insured location, provided that: 1. Such contamination first commences during the policy period; 2. Such contamination ceases fully within ten (10) days of its commencement; and 3. The loss or remediation expense is the result of: (i) a claim for bodily injury, property damage or environmental damage that is first made against the insured and reported to us during the policy period, or as expressly provided for in the extended reporting period, if applicable; or (ii) contamination that caused the insured to incur emergency expense during the policy period. E. Image Restoration Coverage We will reimburse you for image restoration expenses incurred because of contamination or an actual or alleged negligent act, error or omission in the performance of your professional services reported to us during the policy period or as expressly provided for in the extended reporting period, if applicable, and that results in bodily injury, property damage, or environmental damage covered under Insuring Agreements I. A., B., C. or D., as applicable. Reimbursement is limited to the costs of restoring your reputation and consumer confidence through image consulting, is subject to the self-insured retention for the applicable coverage part, and will in no event exceed the amount shown in ITEM 5.- E. in the Declarations. II. DEFINITIONS A. Additional insured means: 1. Any individual, organization or entity scheduled to this policy as an additional insured by an endorsement, but solely for their liability specified in such endorsement; or 2. Solely with regard to Coverage B. — Contracting Operations Environmental Liability, any entity required to be an additional insured under this policy in a written contract or agreement for your contracting operations, provided that such contract or agreement was fully executed prior to the date that your contracting operations first commenced. However such entities are included as an additional insured under this policy solely to the extent: a. That the entity is liable for loss or remediation expense to which this insurance applies as a result of your contracting operations performed by or on behalf of an insured other than the entity; and b. Up to and not exceeding any specified limits of insurance as required by the written contract with you or subject to the applicable Coverage B. Contracting Operations Environmental Liability Coverage Limit of Insurance, whichever is less. The entity is not provided any coverage under this policy for any portion of its own negligence or legal liability. B. Bodily injury means: 1. Physical injury, sickness or disease including associated medical or environmental monitoring; and 2. Mental anguish, emotional distress or shock sustained by any person; Page 3 of 27 c0 2017 Philadelphia Consolidated Holding Corp. Insured: Moss Utilities, LLC PoliCy # CPP2117851 THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. TEXAS CONTRACTOR'S GENERAL LIABILITY EXTENSION ENDORSEMENT TABLE OF CONTENTS Pa e 1. Additional Definitions 9 2. A re ate Limits Per Location 7 3. A re ate Limits Per Pro'ect 6 4. Blanket Contractual Liabilit — Railroads 3 5. Broadened Bodil In'ur Covera e 10 6. Broadened Knowled e Of Occurrence 8 7. Broadened Le al Liabilit Covera e For Landlord's Business Personal Pro ert 7 8. Broadened Liabilit Covera e For Dama e To Your Product And Your Work 10 9. Broadened Who Is An Insured 3 10. Co-Employee Bodily Injury Coverage for Managers, Supervisors, Directors or Officers 4 see rovision 9, Broadened Who Is An Insured, ara ra h 2.a. 1 11. Contractual Liabilit — Personal And Advertisin In'ur 3 12. Dama e To Premises Rented To You — S ecific Perils and Increased Limit 7 13. Desi nated Com leted Pro'ects — Amended Limits of Insurance 1 1 14. Extended Notice Of Cancellation And Nonrenewal 8 15. Incidental Mal ractice Liabilit 6 16. Increased Medical Payments Limit 7 17. Mobile E ui ment Redefined 9 18. Nonowned Watercraft 3 19. Product Recall Ex ense 2 20. Pro ert Dama e Liabilit — Alienated Premises 2 21. Pro ert Dama e Liabilit — Elevators And Sidetrack A reements 2 22. Property Damage Liability — Property Loaned To The Insured Or Personal Property In The Care, 2 Custod And Control Of The Insured 23. Reasonable Force — Bodil In'ur or Pro ert Dama e 10 24. Su lementar Pa ments 3 25. Transfer Of Ri hts Blanket Waiver Of Subro ation 8 26. Unintentional Failure To Disclose Hazards 8 Includes copyrighted material of Insurance Services Office, Inc. CG 70 63 04 17 Page 1 of 11 This endorsement modifies insurance provided under the following: COMMERCIAL GENERAL LIABILITY COVERAGE FORM Under SECTION I— COVERAGE A. BODILY INJURY AND PROPERTY DAMAGE LIABILITY, paragraph 2. EXCLUSIONS, provisions 1. through 6. of this endorsement are excess over any valid and collectible insurance (including any deductible) available to the insured, whether primary, excess or contingent (SECTION IV — COMMERCIAL GENERAL LIABILITY CONDITIONS, paragraph 4. Other Insurance is changed accordingly). Provisions 1. through 6. of this endorsement amend the policy as follows: 1. PROPERTY DAMAGE LIABILITY — ALIENATED PREMISES A. Exclusion j. Damage to Property, subparagraph (2) is deleted. B. The following paragraph is deleted from Exclusion j. Damage to Property; Paragraph (2) of this exclusion does not apply if the premises are "your work" and were never occupied, rented or held for rental by you. 2. PROPERTY DAMAGE LIABILITY — ELEVATORS AND SIDETRACK AGREEMENTS A. Exclusion j. Damage to Property, paragraphs (3), (4), and (6) do not apply to the use of elevators. B. Exclusion k. Damage to Your ProduCt does not apply to: 1. The use of elevators; or 2. Liability assumed under a sidetrack agreement. 3. PROPERTY DAMAGE LIABILITY — PROPERTY LOANED TO THE INSURED OR PERSONAL PROPERTY IN THE CARE, CUSTODY AND CONTROL OF THE INSURED A. Exclusion j. Damage to Property, paragraphs (3) and (4) are deleted.. B. Coverage under this provision 3. does not apply to "property damage" that exceeds $25,000 per occurrence or $25,000 annual aggregate. 4. PRODUCT RECALL EXPENSE A. Exclusion n. Recall of Products, Work or Impaired Property does not apply to "product recall expenses" that you incur for the "covered recall" of "your product". This exception to the exclusion does not apply to "product recall expenses" resulting from: 1. Failure of any products to accomplish their intended purpose; 2. Breach of warranties of fitness, quality, durability or performance; 3. Loss of customer approval or any cost incurred to regain customer approval; 4. Redistribution or replacement of "your producY', which has been recalled, by like products or substitutes; 5. Caprice or whim of the insured; 6. A condition likely to cause loss, about which any insured knew or had reason to know at the inception of this insurance; 7. Asbestos, including loss, damage or clean up resulting from asbestos or asbestos containing materials; 8. Recall of "your product(s)" that have no known or suspected defect solely because a known or suspected defect in another of "your product(s)" has been found. B. Under SECTION III — LIMITS OF INSURANCE, paragraph 3. is replaced in its entirety as follows and paragraph 8. is added: 3. The Products-Completed Operations Aggregate Limit is the most we will pay for the sum of: Includes copyrighted material of Insurance Services Office, Inc. Page 2 of 11 CG 70 63 04 17 a. Damages under COVERAGE A BODILY INJURY AND PROPERTY DAMAGE LIABILITY because of "bodily injury" and "property damage" included in the "products-completed operations hazard" and b. "Product recall expenses". 8. Subject to paragraph 5. above [of the CGL Coverage Form], $25,000 is the most we will pay for all "product recall expenses" arising out of the same defect or deficiency. 5. NONOWNED WATERCRAFT Exclusion g. AirCraft, Auto or WaterCraft, paragraph (2) is deleted and replaced with the following: [This exclusion does not apply to:] (2) A watercraft you do not own that is: (a) Less than 75 feet long; and (b) Not being used to carry any person or property for a charge; 6. BLANKET CONTRACTUAL LIABILITY — RAILROADS Under SECTION V— DEFINITIONS, paragraph c. of "Insured ContracY' is deleted and replaced by the following: C. Any easement or license agreement; Under SECTION V— DEFINITIONS, paragraph f.(1) of "Insured ContracY' is deleted. 7. CONTRACTUAL LIABILITY — PERSONAL AND ADVERTISING INJURY Under SECTION I— COVERAGE B., paragraph 2. Exclusions, paragraph e. Contractual Liability is deleted. 8. SUPPLEMENTARY PAYMENTS Under SECTION I— SUPPLEMENTARY PAYMENTS — COVERAGES A AND B, paragraph 1.b. is deleted and replaced with the following: 1. b. Up to $5,000 for cost of bail bonds required because of accidents or traffic law violations arising out of the use of any vehicle to which the Bodily Injury Liability Coverage applies. We do not have to furnish these bonds. 9. BROADENED WHO IS AN INSURED SECTION II — WHO IS AN INSURED is deleted and replaced with the following: If you are designated in the Declarations as: a. An individual, you and your spouse are insureds, but only with respect to the conduct of a business of which you are the sole owner. b. A partnership or joint venture, you are an insured. Your members, your partners, and their spouses are also insureds, but only with respect to the conduct of your business. C. A limited liability company, you are an insured. Your members are also insureds, but only with respect to the conduct of your business. Your managers are insureds, but only with respect to their duties as your managers. d. An organization other than a partnership, joint venture or limited liability company, you are an insured. Your "executive officers" and directors are insureds, but only with respect to their duties as your officers or directors. Your stockholders are also insureds, but only with respect to their liability as stockholders. Includes copyrighted material of Insurance Services Office, Inc. CG 70 63 04 17 Page 3 of 11 2. Each of the following is also an insured: a. Your "volunteer workers" only while performing duties related to the conduct of your business, or your "employees," other than either your "executive officers," (if you are an organization other than a partnership, joint venture or limited liability company) or your managers (if you are a limited liability company), but only for acts within the scope of their employment by you or while performing duties related to the conduct of your business. However, none of these "employees" or "volunteer workers" are insured for: (1) "Bodily injury" or "personal and advertising injury": (a) To you, to your partners or members (if you are a partnership or joint venture), to your members (if you are a limited liability company), to a co-"employee" while in the course of his or her employment or performing duties related to the conduct of your business, or to your other "volunteer workers" while performing duties related to the conduct of your business; (b) To the spouse, child, parent, brother or sister of that co-"employee" or volunteer worker as a consequence of paragraph (1)(a) above; (C) For which there is any obligation to share damages with or repay someone else who must pay damages because of the injury described in paragraphs (1)(a) or (b) above; or (d) Arising out of his or her providing or failing to provide professional health care services except as provided in Provision 10. of this endorsement. Paragraphs (1)(a), (1)(b) and (1)(C) above do not apply to your "employees" who are: (i) Managers; (ii) Supervisors; (iii) Directors; or (iv) Officers; with respect to "bodily injury" to a co-"employee". (2) "Property damage" to property: (a) Owned, occupied or used by; (b) Rented to, in the care, custody or control of, or over which physical control is being exercised for any purpose by you, any of your "employees," "volunteer workers", any partner or member (if you are a partnership or joint venture), or any member (if you are a limited liability company). b. Any person (other than your "employee" or "volunteer worker"), or any organization while acting as your real estate manager. C. Any person or organization having proper temporary custody of your property if you die, but only; (1) With respect to liability arising out of the maintenance or use of that property; and (2) Until your legal representative has been appointed. d. Your legal representative if you die, but only with respect to duties as such. That representative will have all your rights and duties under this Coverage Form. e. Your subsidiaries if: (1) They are legally incorporated entities; and (2) You own more than 50% of the voting stock in such subsidiaries as of the effective date of this policy. If such subsidiaries are not shown in the Declarations, you must report them to us within 180 days of the inception of your original policy. Includes copyrighted material of Insurance Services Office, Inc. Page 4 of 11 CG 70 63 04 17 f. Any person or organization, including any manager, owner, lessor, mortgagee, assignee or receiver of premises, to whom you are obligated under a written contract to provide insurance such as is afforded by this policy, but only with respect to liability arising out of the ownership, maintenance or use of that part of any premises or land leased to you, including common or public areas about such premises or land if so required in the contract. However, no such person or organization is an insured with respect to: (1) Any "occurrence" that takes place after you cease to occupy or lease that premises or land; or (2) Structural alterations, new construction or demolition operations performed by or on behalf of such person or organization. g. Any state or political subdivision but only as respects legal liability incurred by the state or political subdivision solely because it has issued a permit with respect to operations performed by you or on your behalf. However, no state or political subdivision is an insured with respect to: (1) "Bodily injury", "property damage", "personal and advertising injury" arising out of operations performed for the state or municipality; or (2) "Bodily injury" or "property damage" included within the "products-completed operations hazard." h. Any person or organization who is the lessor of equipment leased to you, to whom you are obligated under a written contract to provide insurance such as is afforded by this policy, but only with respect to their liability arising out of the maintenance, operation or use of such equipment by you or a subcontractor on your behalf with your permission and under your supervision. However, if you have entered into a construction contract subject to Subchapter C of Chapter 151 of Subtitle C of Title 2 of the Texas Insurance Code with the additional insured, the insurance afforded to such person(s) or organization(s) only applies to the extent permitted by Subchapter C of Chapter 151 of Subtitle C of Title 2 of the Texas Insurance Code. No such person or organization, however, is an insured with respect to any "occurrence" that takes place after the equipment lease expires. i. Any architect, engineer, or surveyor engaged by you under a written contract but only with respect to liability arising out of your premises or "your work." However, if you have entered into a construction contract subject to Subchapter C of Chapter 151 of Subtitle C of Title 2 of the Texas Insurance Code with the additional insured, the insurance afforded to such person only applies to the extent permitted by Subchapter C of the Chapter 151 of Subtitle C of Title 2 of the Texas Insurance Code. No architect, engineer, or surveyor, however, is an insured with respect to "bodily injury," "property damage," or "personal and advertising injury" arising out of the rendering of or the failure to render any professional services by or for you, including: (1) The preparing, approving, or failing to prepare or approve maps, drawings, opinions, reports, surveys, change orders, designs or specifications; or (2) Supervisory, inspection, or engineering services. This paragraph i. does not apply if a separate Additional Insured endorsement providing liability coverage for architects, engineers, or surveyors engaged by you is attached to the policy. If the written contract or written agreement requires primary and non-contributory coverage, the insurance provided by paragraphs f. through i. above will be primary and non-contributory relative to other insurance available to the additional insured which covers that person or organization as a Named Insured, and we will not share with that other insurance. 3. Any organization you newly acquire or form, other than a partnership, joint venture or limited liability company and over which you maintain ownership or majority interest, will qualify as a Named Insured if there is no other similar insurance available to that organization. However: a. Coverage under this provision is afforded only until the end of the policy period; b. Coverage A does not apply to "bodily injury" or "property damage" that occurred before you acquired or formed the organization; Includes copyrighted material of Insurance Services Office, Inc. CG 70 63 04 17 Page 5 of 11 c. Coverage B does not apply to "personal and advertising injury" arising out of an offense committed before you acquired or formed the organization. d. Coverage A does not apply to "product recall expense" arising out of any withdrawal or recall that occurred before you acquired or formed the organization. 4. Any person or organization (referred to below as vendor) with whom you agreed under a written contract to provide insurance is an insured, but only with respect to "bodily injury" or "property damage" arising out of "your products" that are distributed or sold in the regular course of the vendor's business. However, no such person or organization is an insured with respect to: a. "Bodily injury" or "property damage" for which the vendor is obligated to pay damages by reason of the assumption of liability in a contract or agreement. This exclusion does not apply to liability for damages that the vendor would have in the absence of the contract or agreement. b. Any express warranty unauthorized by you; C. Any physical or chemical change in "your producY' made intentionally by the vendor; d. Repackaging, except when unpacked solely for the purpose of inspection, demonstration, testing, or the substitution of parts under instructions from the manufacturer, and then repackaged in the original container; e. Any failure to make such inspections, adjustments, tests or servicing as the vendor has agreed to make or normally undertakes to make in the usual course of business, in connection with the distribution or sale of "your products"; f. Demonstration, installation, servicing or repair operations, except such operations performed at the vendor's premises in connection with the sale of the "your producY'; g. "Your products" which, after distribution or sale by you, have been labeled or relabeled or used as a container, part or ingredient of any other thing or substance by or for the vendor. h. "Bodily injury" or "property damage" arising out of the sole negligence of the vendor for its own acts or omissions or those of its employees or anyone else acting on its behalf. However, this exclusion does not apply to: (1) The exceptions contained in subparagraphs d. or f.; or (2) Such inspections, adjustments, tests or servicing as the vendor has agreed to make or normally undertakes to make in the usual course of business, in connection with the distribution or sale of the products. This paragraph 4. does not apply to any insured person or organization from which you have acquired "your products", or any ingredient, part, or container, entering into, accompanying or containing "your products". This paragraph 4. also does not apply if a separate Additional Insured endorsement, providing liability coverage for "bodily injury" or "property damage" arising out of "your producY' that is distributed or sold in the regular course of a vendor's business, is attached to the policy. No person or organization is an insured with respect to the conduct of any current or past partnership, joint venture or limited liability company that is not shown as a Named Insured in the Declarations. 10. INCIDENTAL MALPRACTICE LIABILITY As respects provision 9., SECTION II — WHO IS AN INSURED, paragraph 2.a.(1)(d) does not apply to any nurse, emergency medical technician or paramedic employed by you to provide medical or paramedical services, provided that you are not engaged in the business or occupation of providing such services, and your "employee" does not have any other insurance that would also cover claims arising under this provision, whether the other insurance is primary, excess, contingent or on any other basis. Under SECTION III — LIMITS OF INSURANCE, provisions 11. through 14. of this endorsement amend the policy as follows: 11. AGGREGATE LIMITS PER PROJECT The General Aggregate Limit applies separately to each of your construction projects away from premises owned by or rented to you. Includes copyrighted material of Insurance Services Office, Inc. Page 6 of 11 CG 70 63 04 17 12. AGGREGATE LIMITS PER LOCATION The General Aggregate Limit applies separately to each of your locations, but only when required by written contract or written agreement. As respects this provision 12., your locations are premises you own, rent or use involving the same or connecting lots or premises whose connection is interrupted only by a street, roadway, waterway or right-of-way of a railroad. However, your locations do not include any premises where you, or others acting on your behalf, are performing construction operations. 13. INCREASED MEDICAL PAYMENTS LIMITS A. SECTION III — LIMITS OF INSURANCE, paragraph 7., the Medical Expense Limit, is subject to all the terms of SECTION III — LIMITS OF INSURANCE and is the greater of: 1. $10,000; or 2. The amount shown in the Declarations for Medical Expense Limit. B. This provision 13. does not apply if COVERAGE C MEDICAL PAYMENTS is excluded either by the provisions of the Coverage Form or by endorsement. 14. DAMAGE TO PREMISES RENTED TO YOU — SPECIFIC PERILS AND INCREASED LIMIT A. The word fire is changed to "specific perils" where it appears in: 1. The last paragraph of SECTION I— COVERAGE A, paragraph 2. Exclusions; 2. SECTION IV, paragraph 4.b. Excess Insurance. B. The Limits of Insurance shown in the Declarations will apply to all damage proximately caused by the same event, whether such damage results from a"specific peril" or any combination of "specific perils." C. The Damage To Premises Rented To You Limit described in SECTION III — LIMITS OF INSURANCE, paragraph 6., is replaced by a new limit, which is the greater of: 1. $1,000,000; or 2. The amount shown in the Declarations for Damage To Premises Rented To You Limit. D. This provision 14. does not apply if the Damage To Premises Rented To You Limit of SECTION I— COVERAGE A is excluded either by the provisions of the Coverage Form or by endorsement. E. "Specific Perils" means fire; lightning; explosion; windstorm or hail; smoke; aircraft or vehicles; riot or civil commotion; vandalism; leakage from fire extinguishing equipment; weight of snow, ice or sleet; or "water damage". "Water damage" means accidental discharge or leakage of water or steam as the direct result of the breaking or cracking of any part of a system or appliance containing water or steam. 15. BROADENED LEGAL LIABILITY COVERAGE FOR LANDLORD'S BUSINESS PERSONAL PROPERTY Under SECTION I— COVERAGE A BODILY INJURY AND PROPERTY DAMAGE LIABILITY, 2. ExClusions, j. Damage to Property, the first paragraph following paragraph (6) is deleted and replaced with the following: Paragraphs (1), (3) and (4) of this exclusion do not apply to "property damage" (other than damage by fire) to a landlord's business personal property that is subject to, or part of, a premises lease or rental agreement with that landlord. The most we will pay for damages under this provision 15. is $10,000. A$250 deductible applies. Under SECTION IV — COMMERCIAL GENERAL LIABILITY CONDITIONS, provisions 16. through 18. of this endorsement amend the policy as follows: Includes copyrighted material of Insurance Services Office, Inc. CG 70 63 04 17 Page 7 of 11 16. BROADENED KNOWLEDGE OF OCCURRENCE Under 2. Duties In The Event Of Occurrence, Offense, Claim, Or Suit, paragraph a. is deleted and replaced and paragraphs e. and f. are added as follows: a. You must see to it that we are notified as soon as practicable of an "occurrence" or an offense, regardless of the amount, which may result in a claim. Knowledge of an "occurrence" or an offense by your "employee(s)" shall not, in itself, constitute knowledge to you unless one of your partners, members, "executive officers," directors, or managers has knowledge of the "occurrence" or offense. To the extent possible, notice should include: (1) How, when and where the "occurrence" or offense took place; (2) The names and addresses of any injured persons and witnesses; and (3) The nature and location of any injury or damage arising out of the "occurrence" or offense. e. If you report an "occurrence" to your workers compensation carrier that develops into a liability claim for which coverage is provided by this Coverage Form, failure to report such an "occurrence" to us at the time of the "occurrence" shall not be deemed a violation of paragraphs a., b., and c. above. However, you shall give written notice of this "occurrence" to us as soon you become aware that this "occurrence" may be a liability claim rather than a workers compensation claim. You must see to it that the following are done in the event of an actual or anticipated "covered recall" that may result in "product recall expense": (1) Give us prompt notice of any discovery or notification that "your producY' must be withdrawn or recalled. Include a description of "your product" and the reason for the withdrawal or recall; (2) Cease any further release, shipment, consignment or any other method of distribution of like or similar products until it has been determined that all such products are free from defects that could be a cause of loss under the insurance. 17. UNINTENTIONAL FAILURE TO DISCLOSE HAZARDS Paragraph 6. Representations is deleted and replaced with the following: 6. Representations By accepting this policy, you agree: a. The statements in the Declarations are accurate and complete; b. Those statements are based upon representations you made to us; and C. We have issued this policy in reliance upon your representations. We will not deny coverage under this Coverage Form if you unintentionally fail to disclose all hazards existing as of the inception date of this policy. You must report to us any knowledge of an error or omission in the description of any premises or operations intended to be covered by this Coverage Form as soon as practicable after its discovery. However, this provision does not affect our right to collect additional premium or exercise our right of cancellation or nonrenewal. 18. TRANSFER OF RIGHTS (BLANKET WAIVER OF SUBROGATION) Paragraph 8. Transfer of Rights Of Recovery Against Others To Us is deleted and replaced with the following: 8. If the insured has rights to recover all or part of any payment we have made under this Coverage Form, those rights are transferred to us. The insured must do nothing after loss to impair them. At our request, the insured will bring "suiY' or transfer those rights to us and help us enforce them. However, if the insured has waived rights to recover through a written contract, or if "your work" was commenced under a letter of intent or work order, subject to a subsequent reduction to writing with customers whose customary contracts require a waiver, we waive any right of recovery we may have under this Coverage Form. 19. EXTENDED NOTICE OF CANCELLATION AND NONRENEWAL Includes copyrighted material of Insurance Services Office, Inc. Page 8 of 11 CG 70 63 04 17 Paragraph 2.b. of A. Cancellation of the COMMON POLICY CONDITIONS is deleted and replaced with the following: b. 60 days before the effective date of the cancellation if we cancel for any other reason. Under SECTION IV — COMMERCIAL GENERAL LIABILITY CONDITIONS, Paragraph 9. When We Do Not Renew is deleted and replaced with the following: 9. When We Do Not Renew a. We may elect not to renew this policy except, that under the provisions of the Texas Insurance Code, we may not refuse to renew this policy solely because the policyholder is an elected official. b. If we elect not to renew this policy, we may do so by mailing or delivering to the first Named Insured, at the last mailing address known to us, written notice of nonrenewal, stating the reason for nonrenewal, at least 60 days before the expiration date. If notice is mailed or delivered less than 60 days before the expiration date, this policy will remain in effect until the 61 st day after the date on which the notice is mailed or delivered. Earned premium for any period of coverage that extends beyond the expiration date will be computed pro rata based on the previous year's premium. C. If notice is mailed, proof of mailing will be sufficient proof of notice. d. The transfer of a policyholder between admitted companies within the same insurance group is not considered a refusal to renew. 20. MOBILE EQUIPMENT REDEFINED Under SECTION V— DEFINITIONS, paragraph 12. "Mobile equipment", paragraph f. (1) does not apply to self-propelled vehicles of less than 1,000 pounds gross vehicle weight that are not designed for highway use. 21. ADDITIONAL DEFINITIONS 1. SECTION V— DEFINITIONS, paragraph 4. "Coverage territory" is replaced by the following definition: "Coverage territory" means anywhere in the world with respect to liability arising out of "bodily injury," "property damage," or °personal and advertising injury," including "personal and advertising injury" offenses that take place through the Internet or similar electronic means of communication provided the insured's responsibility to pay damages is determined in a settlement to which we agree or in a"suit" on the merits, in the United States of America (including its territories and possessions), Puerto Rico and Canada. 2. SECTION V— DEFINITIONS is amended by the addition of the following definitions: "Covered recall" means a recall made necessary because you or a government body has determined that a known or suspected defect, deficiency, inadequacy, or dangerous condition in "your producY' has resulted or will result in "bodily injury" or "property damage". "Product Recall expenses" mean only reasonable and necessary extra costs, which result from or are related to the recall or withdrawal of "your product" for: a. Telephone and telegraphic communication, radio or television announcements, computer time and newspaper advertising; b. Stationery, envelopes, production of announcements and postage or facsimiles; C. Remuneration paid to regular employees for necessary overtime or authorized travel expense; d. Temporary hiring by you or by agents designated by you of persons, other than your regular employees, to perform necessary tasks; e. Rental of necessary additional warehouse or storage space; f. Packaging of or transportation or shipping of defective products to the location you designate; and g. Disposal of "your products" that cannot be reused. Disposal expenses do not include: (1) Expenses that exceed the original cost of the materials incurred to manufacture or process such product; and Includes copyrighted material of Insurance Services Office, Inc. CG 70 63 04 17 Page 9 of 11 (2) Expenses that exceed the cost of normal trash discarding or disposal, except as are necessary to avoid "bodily injury" or "property damage". 22. REASONABLE FORCE — BODILY INJURY OR PROPERTY DAMAGE Under SECTION I— COVERAGE A., paragraph 2. Exclusions, subparagraph a. Expected Or Intended Injury is deleted and replaced with the following: [This insurance does not apply to:] a. Expected Or Intended Injury "Bodily injury" or "property damage" expected or intended from the standpoint of the insured. This exclusion does not apply to "bodily injury" or "property damage" resulting from the use of reasonable force to protect persons or property. 23. BROADENED LIABILITY COVERAGE FOR DAMAGE TO YOUR PRODUCT AND YOUR WORK A. Under SECTION I— COVERAGE A., paragraph 2. Exclusions, exclusion k. Damage to Your Product and exclusion I. Damage to Your Work are deleted and replaced with the following: [This insurance does not apply to:] k. Damage to Your Product "Property damage" to "your product" arising out of it or any part of it, except when caused by or resulting from: (1) Fire; (2) Smoke; (3) "Collapse"; or (4) Explosion. For purposes of exclusion k. above, "collapse" means an abrupt falling down or caving in of a building or any part of a building with the result that the building or part of the building cannot be occupied for its intended purpose. Damage to Your Work "Property damage" to "your work" arising out of it or any part of it and included in the "products-completed operations hazard". This exclusion does not apply: (1) If the damaged work or the work out of which the damage arises was performed on your behalf by a subcontractor; or (2) If the cause of loss to the damaged work arises as a result of: (a) Fire; (b) Smoke; (c) "Collapse"; or (d) Explosion. For purposes of exclusion I. above, "collapse" means an abrupt falling down or caving in of a building or any part of a building with the result that the building or part of the building cannot be occupied for its intended purpose. B. The following paragraph is added to SECTION III — LIMITS OF INSURANCE: Includes copyrighted material of Insurance Services Office, Inc. Page 10 of 11 CG 70 63 04 17 Subject to 5. above [of the CGL Coverage Form], $100,000 is the most we will pay under Coverage A for the sum of damages arising out of any one "occurrence" because of "property damage" to "your product" and "your work" that is caused by fire, smoke, collapse or explosion and is included within the "product-completed operations hazard". This sublimit does not apply to "property damage" to "your work" if the damaged work, or the work out of which the damage arises, was performed on your behalf by a subcontractor. 24. BROADENED BODILY INJURY COVERAGE Under SECTION V— DEFINITIONS, the definition of "bodily injury" is deleted and replaced with the following: 3. "Bodily injury" a. Means physical: (1) Injury; (2) Disability; (3) Sickness; or (4) Disease; sustained by a person, including death resulting from any of these at any time. b. Includes mental: (5) Anguish; (6) Injury; (7) Humiliation; (8) Fright; or (9) Shock; directly resulting from any "bodily injury" described in paragraph 3.a. C. All "bodily injury" described in paragraph 3.b. shall be deemed to have occurred at the time the "bodily injury" described in paragraph 3.a. occurred. 25. DESIGNATED COMPLETED PROJECTS — AMENDED LIMITS OF INSURANCE When a written contract or written agreement between you and another party requires project-specific limits of insurance exceeding the limits of this policy; A. for "bodily injury" or "property damage" that occurs within any policy period for which we provided coverage;and B. for "your work" performed within the "products-completed operation hazard"; and C. for which we previously issued Amendment Of Limits Of Insurance (Designated Project Or Premises) CG 71 94 either during this policy term or a prior policy term; and D. that designated project is now complete; the limits of insurance shown in the CG 71 94 schedule will replace the limits of insurance of this policy for the designated project and will continue to apply for the amount of time the written contract or written agreement requires, subject to the state statute of repose of the project location. These limits are inclusive of and not in addition to the replaced limits. Includes copyrighted material of Insurance Services Office, Inc. CG 70 63 04 17 Page 11 of 11 Insured: Moss Utilities, LLC P01.k�Y N��+16���: �Azli�sso COM�4fIEF��4A'� A�MS� �A �� 6� Og 11 �HI� Et+1�R�EME�T �HA�I�E� TN� �OLI�1f_ RLEASE REA� IT �AF��Fl�4l.�+_ �����N,�TE� IN�iJI�E� - PRf�111�►�� �+I�N-��NTF�I�L�T�I�Y ��V��4�l�aE I�,FHE�i i�E���J��� �'� II���J F��� ��NT��1�T �F� �EF�T��I��TE flsis ��c1or5�ylMCnl .mocHfi�� in��rl�n�e pY,�MitIE� 1�A[l�� 1�. [3� J SINf•, S� �U I O�:+�VL �2�� �� I�}f�fiA Tne �xpv�s�prr� od ���� C'ra�ne+�cl+e I orm a�rplk �n��5 �r,anc�sl lryr IIxS flrrdnrs�m�fl1 f ts.4 ��ntl�,ts�rr��r�t iri��nti.t� ���n;s� ix a�ar�if,��ran��� wF�n ;�rr�'q'i�U�lxl� «f4d�F [h� 1$41� 13 Rn frMsurod ��iuvi�irw7 � i�t+ ��7�lL*tli�i� F {Sf�1'i Th�*� 4��d�r+s�rr+�nl �han�es ��e �sc�.��r �n alw; �r���lro� sc.ala al �lie pdic�r, unlC�� �t18'11aM dal� rs shoNrn h��uw L• �ior�i�iy4��4i F91� ��:ti�r,� #�1����c'•�� ��s�tir+t�+� Moss Utilities LLC ��� �.�Sn,' r"a� ap��r �t��vu II 5[�, i��lexnnEion la €�irrpl�l� ��5 ��1rl�fs�:�ifinl rs�n th� �7�13��I�i15 M 3�t�rlioiT If -�ifiL�ii+� L`r,��r��_ ��rx,r�r�u{e, 1 tiNhn I5 �1 1��41►�4'S� 1� clfl}ti'�k1�tl Ga tW�I: �+i� ���,^S�n �r crg i ni�$��pti ,n�,pti w�10�n �u Iva�r� an 'ans1+�� ��It#��� vw�ith �equir�s: � �17�1 �i�$ar� trr �,re�tiiw i i,ar� i� �a� ,'4�i{II;�I �.�i �F5 -IIl3LifY'_d- ��,crcr ���s ��s�c� or rrn a�ond�:�,a� nr ins��r��naf, n�itl u llsi5 �ffir�yr [u tx� Frrnn v� a�s[! I�+}fF1;K�r�4�+rxil�ry Lt� Nn� Irk� «�tX���L#} �5V,7if�CrGA 1� fiia p�r�orr �r r�r�i[wratinn. nlail��} �a�li su�lt ���c54f1 4F GE{Jt�Ri�,3[I�5 �S :�n -in��►r[;rJ- lar L ittibilil� �}a'��;F{�� ��iey�r� �n 'Mts1�E'�� ��}� W 1�R �son �u �r��}.�rrr,'�up�i �� �n'IflSlri[.I' UI1tICt ��l �E�,`t�lr I I ul Li�e La�t+ir.at,pn F�err� f hr_ atsnsrr}fl b�'I���Y I lic hl:�r��ecM Li�tiQa�S� t��Ml W�C j'rl'.��f1 lif D�+J3i5it.11iu[h �w au �Rn3ul�eii t��l - �. �eCf�•ti �ti! - Fiusin�ss A�,to �n+ulH�or+s, �+ �r1�r�1 �andiii�ns, F�. f�Y�r Ir��ur� n�e� �ar$grA�� c� i� �j�IQ19d �nil r��qr:� h� �h� ��b�nr1� d�r Itac piar�C �� �Frs CwcJo•r�tme�nl �nly u- ��'_n �-i����� ax�xuxiet! tifn�Ger it�s� C:�sw�rse;� f e�r�� a� alse� }xowrled r��s�� aiti�lht�r Gati.�cr�c� F�rm �r F�'�Y� v� mll �itl� �fiV��7�i�� �rl a Fxi���rg_ rlon�uxY�r��lo� fI�5i5 [ : ne,r,l+�s�i#r�`'d �Y lo�lucft_+S ���p+�r��F�t�� rrw��'� �f Ir1�r�nc�e �ecw'�� ��I��. IrMc. wKF� �[51�rr�ws�n EXCESS LIABILITY XS 233 (0221) XS 233 (0221)Page 1 of 1 Copyright © Starr Indemnity & Liability Company. All rights reserved. Includes copyrighted material of Insurance Services Office, Inc., with its permission. THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. Waiver of Subrogation Endorsement Policy Number: Effective Date: June 21, 2021 at 12:01 A.M. Named Insured: MOSS UTILITIES, LLC This endorsement modifies the insurance coverage form(s) listed below that have been purchased by you and evidenced as such on the declarations page. Please read the endorsement and respective policy(ies) carefully. EXCESS LIABILITY POLICY It is hereby agreed that SECTION IV. CONDITIONS, K. Transfer of Rights of Recovery Against Others to Us is amended to include the following: SCHEDULE Name Of Person(s) Or Organization(s): All as required by written contract. Information required to complete this Schedule, if not shown above, will be shown in the Declarations. We waive any right of recovery against the person(s) or organization(s) shown in the Schedule above because of payments we make under this Policy. Such waiver by us applies only to the extent that the insured has waived its right of recovery against such person(s) or organization(s) prior to loss. This endorsement applies only to the person(s) or organization(s) shown in the Schedule above. All other terms and conditions of this Policy remain unchanged. CXE 03 01 10 17 Copyright, American Alternative Insurance Corporation, 2017 Includes copyrighted material of the Insurance Services Office, Inc., with its permission. Page 2 of 2 (1) The total amount that all such other insurance would pay for the loss in the absence of the insurance provided under this Coverage Part; and (2) The total of all deductible and self-insured amounts under all that other insurance. Insured: Moss Utilities, LLC Policy # PPK2357042 PIC-EVCP-001 (7/17) 2. The supplemental extended reporting period described herein shall commence upon the day that the automatic extended reporting period terminates. 3. For the purpose of any extended reporting period, any change in premium, self-insured retention, Limits of Insurance or other terms or conditions at renewal is not a refusal to renew. 4. Limits of Insurance available during any extended reporting period shall not exceed the balance of the Limits of Insurance in effect at the time the policy terminated. 5. In the event similar insurance is in force covering any claims first made during the automatic extended reporting period, there is no coverage under this policy. 6. In the event similar insurance is in force covering any claims first made during the supplemental extended reporting period, coverage provided by this policy shall be excess over any such other insurance, including any applicable deductible or self-insured retention amounts of such other insurance. For purposes of this provision, other insurance includes all types of self-insurance, indemnification or other funding arrangement or program that is available to compensate an insured for liability. 7. Any extended reporting period does not extend the policy period. Any claim first made against you during an extended reporting period will be deemed to have been first made during the last day of the policy period. X. GENERAL CONDITIONS A. Subrogation If we pay any amount under this policy, we shall be subrogated to the insured's rights of recovery against any person, firm or organization. The insured shall execute and deliver instruments and papers and do whatever is necessary to secure such rights. The insured shall not waive or prejudice such rights subsequent to when a claim is first made or when the insured discovers contamination. Any recovery as a result of a subrogation proceeding arising out of payment of a professional loss, loss or remediation expense covered under this insurance shall accrue first to you to the extent of any payments in excess of the Limits of Insurance; then to us to the extent of our payment under the policy; and then to you to the extent of your deductible. Expenses incurred in such subrogation proceedings will be apportioned among the interested parties in the recovery, in the proportion that each interested party's share in the recovery bears to the total recovery. Notwithstanding the foregoing, we hereby waive our right of subrogation against your client and any entity where required by written contract provided that such contract is fully executed prior to the first commencement of contamination or prior to the rendering or failure to render your professional services, as applicable to which this insurance applies. B. Changes Notwithstanding anything to the contrary, no provision of this policy may be amended, waived or otherwise changed except by endorsement issued by us to form part of this policy. C. Action Against Us No person or organization has a right under this insurance: Page 23 of 27 c0 2017 Philadelphia Consolidated Holding Corp. Insured: Moss Utilities, LLC PoliCy #PPK2357042 PIC-EVCP-001 (7/17) 1. The statements in the Declarations, your application, and any other supplemental information thereto are complete and accurate; 2. The statements in your application and any other supplementary information thereto are your representations and warranties and that those representations and warranties are material; 3. This policy is issued in reliance upon the truth and accuracy of such representations and warranties; 4. The statements in your application and any other supplemental information thereto are incorporated into this policy. This policy embodies all existing agreements between you and us relating to this insurance; 5. Breach of those representations or warranties will result, at our election, forfeiture of coverage for any claim reported to us under the policy, or voiding of the policy from inception. H. Otherinsurance If other valid and collectible insurance is available to the insured for coverage granted under this policy, our obligations are limited as follows: 1. This insurance is primary, and our obligations are not affected unless any other insurance is also primary. In that case, we will share with all such other insurance by the method described in Paragraph 2. below, or this insurance will be primary and non-contributory when Paragraph 3. below applies; and 2. If all of the other insurance permits contribution by equal shares, we will also follow this method. In this approach each insurer contributes equal amounts until it has paid its applicable limit of insurance or none of the loss remains, whichever comes first. If any of the other insurance does not permit contribution by equal shares, we will contribute by limits. In contribution by limits, each insurer's share is based upon the ratio its applicable limit of insurance bears to the total applicable limits of insurance of all insurers. 3. This insurance is primary and non-contributory with other valid and collectible insurance, but only if: (i) the named insured has a written contract or agreement requiring this insurance to be primary and non-contributory; and (ii) such contract or agreement was executed prior to the date that your contracting operations or your professional services, as applicable first commenced. For purposes of this provision, other insurance includes all types of self-insurance, indemnification or other funding arrangement or program that is available to compensate an insured for liability. I. Headings The descriptions in the headings of this policy and any endorsements attached hereto are solely for convenience, and form no part of the terms and conditions of coverage. J. Consent Where consent by us or an insured is required under this policy, such consent shall not be unreasonably withheld, delayed, conditioned or denied. Page 25 of 27 c0 2017 Philadelphia Consolidated Holding Corp. Insured: Moss Utilities, LLC PoliCy # 8E-A7-XL-0002016-00 COMMERCIAL EXCESS LIABILITY CXE 03 25 10 17 THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. LIMITED WAIVER OF TRANSFER OF RIGHTS OF RECOVERY AGAINST OTHERS TO US This endorsement modifies insurance provided under the following: COMMERCIAL EXCESS LIABILITY COVERAGE PART SCHEDULE Name Of Person�s) Or Organization�s): Any person or organization when you and such person or organization have agreed in writing in a contract or agreement that you will waive any right of recovery against such person or organization. (If no entry appears above, information required to complete this endorsement will be shown in the Declarations as applicable to this endorsement.) The following is added to Section III — Conditions: Transfer Of Rights Of Recovery Against Others To Us a. If the insured has rights to recover all or part of any payment we have made under this Coverage Part, those rights are transferred to us. The insured must do nothing after loss to impair them. At our request, the insured will bring suit or transfer those rights to us and help us enforce them. b. However, we waive any right of recovery we may have against the person(s) or organization(s) shown in the Schedule above because of payments we make for "injury or damage" that the insured is legally obligated to pay as damages, only if and to the extent: (1) The insured agreed to waive such rights under a written contract with the person(s) or organization(s) shown in the Schedule above prior to the "event", and only for the liability specified within such contract; and (2) The valid and applicable "controlling underlying insurance" providing coverage for the same "injury or damage" exists or would have existed but for the exhaustion of the limits of "controlling underlying insurance", has also waived their such rights of recovery against the person(s) or organization(s) shown in the Schedule above prior to the "event". CXE 03 25 10 17 Copyright, American Alternative Insurance Corporation, 2017 Page 1 of 1 Includes copyrighted material of the Insurance Services Office, Inc., with its permission. XS 373 (0219)Page 1 of 1 Copyright © Starr Indemnity & Liability Company. All rights reserved. Includes copyrighted material of Insurance Services Office, Inc., with its permission. Other Insurance – Primary and Noncontributory for Additional Insured Amendatory Endorsement Policy Number: Effective Date: Named Insured: This endorsement modifies insurance provided under the following: EXCESS LIABILITY POLICY It is hereby agreed that SECTION IV. CONDITIONS,I. Other Insurance is deleted in its entirety and replaced by the following: I. Other Insurance If other insurance applies to “Ultimate Net Loss” that is also covered by this Policy, this Policy will apply excess of, and will not contribute to, the other insurance. Nothing herein will be construed to make this Policy subject to the terms, conditions and limitations of such other insurance. However, other insurance does not include: 1. “Underlying Insurance”; 2. Insurance that is specifically written as excess over this Policy; or 3. Insurance held by a person(s) or organization(s) qualifying as an additional insured in “Underlying Insurance,” but only when the written contract or agreement that mandates such additional insured status: a.Requires a specific limit of insurance that is in excess of the Underlying Limits of Insurance; b.Requires that your insurance be primary and not contribute with that of the additional insured; and c.Is executed prior to the loss. In such case as described in subparagraph 3.above, we shall not seek contribution from the additional insured’s primary or excess insurance for which they are a named insured for amounts payable under this insurance. The Limits of Insurance afforded the additional insured pursuant to subparagraph 3.above shall be the lesser of the following: a.The minimum limits of insurance required in the contract or agreement; or b.The Limits of Insurance shown in the Declarations of this Policy. Other insurance includes any type of self-insurance or other mechanism by which an Insured arranges for the funding of legal liabilities. All other terms and conditions of this Policy remain unchanged. COMMERCIAL EXCESS LIABILITY CXE 03 01 10 17 THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. CXE 03 01 10 17 Copyright, American Alternative Insurance Corporation, 2017 Page 1 of 2 Includes copyrighted material of the Insurance Services Office, Inc., with its permission. PRIMARY AND NONCONTRIBUTORY ENDORSEMENT This endorsement modifies insurance provided under the following: COMMERCIAL EXCESS LIABILITY COVERAGE PART SCHEDULE Name of Designated Additional Insured Person(s) Or Organizations: Any person or organization for whom you are performing operations when you and such person or organization have agreed in writing in a contract or agreement that such person or organization be added as an additional insured on your policy. Information required to complete this Schedule, if not shown above, will be shown in the Declarations. Paragraph 8. Other Insurance of Section III – Conditions is deleted and replaced by the following: 8. Other Insurance a. This insurance is excess over, and shall not contribute with any of the other insurance, whether primary, excess, contingent or on any other basis. However: (1) This condition will not apply to other insurance specifically written as excess over this Coverage Part. (2) The insurance provided under this Coverage Part will be on a primary basis and will not seek contribution from any other insurance available to an additional insured, provided that: (a) The additional insured is a Named Insured under such other insurance; (b) The additional insured is specifically listed in the Schedule above and for whom coverage is provided in this policy under Paragraph 1.d. Insuring Agreement of Section I – Coverages; (c) You have agreed in writing in a contract or agreement with such designated additional insured listed in the Schedule to provide additional insured coverage on a primary and noncontributory basis; and (d) Only if the applicable "controlling underlying insurance" also provides such coverage and on a primary and noncontributory basis specifically for such designated additional insured listed in the Schedule, and only once the applicable limits of "controlling underlying insurance" have been exhausted in the payment of judgments, settlements and other expenses as applicable. Subject to Section II – Limits Of Insurance, the most we will pay on behalf of such additional insured is the amount of insurance required by the contract or agreement for the coverage afforded under this policy, or the available Limits of Insurance afforded under this policy that are applicable, whichever is less. When this insurance is excess, we will have no duty to defend the insured or designated additional insured against any suit if any other insurer has a duty to defend the insured or designated additional insured against that suit. If no other insurer defends, we may undertake to do so, but we will be entitled to the insured's or designated additional insured’s rights against all those other insurers. b. When this insurance is excess over the other insurance, we will pay only our share of the "ultimate net loss" that exceeds the sum of: Insured: Moss Utilities, LLC Policy #8E-A7-XL-0002016-00 CXE 03 01 10 17 Copyright, American Alternative Insurance Corporation, 2017 Includes copyrighted material of the Insurance Services Office, Inc., with its permission. Page 2 of 2 (1) The total amount that all such other insurance would pay for the loss in the absence of the insurance provided under this Coverage Part; and (2) The total of all deductible and self-insured amounts under all that other insurance. WORKERS COMPENSATION AND EMPLOYERS LIABILITY INSURANCE POLICY WC 42 03 04 B (Ed. 6-14) TEXAS WAIVER OF OUR RIGHT TO RECOVER FROM OTHERS ENDORSEMENT This endorsement applies only to the insurance provided by the policy because Texas is shown in Item 3.A. of the Information Page. We have the right to recover our payments from anyone liable for an injury covered by this policy. We will not enforce our right against the person or organization named in the Schedule, but this waiver applies only with respect to bodily injury arising out of the operations described in the Schedule where you are required by a written contract to obtain this waiver from us. L This endorsement shall not operate directly or indirectly to benefit anyone not named in the Schedule. � The premium for this endorsement is shown in the Schedule. Schedule 1. Specific Waiver Name of person or organization x Blanket Waiver Any person or organization for whom the Named Insured has agreed by written contract to furnish this waiver. � � 2. Operations: Al1 Texas Operations 3. Premium The premium charge for this endorsement shall be 2 percent of the premium developed on payroll in connection with work performed for the above person(s) or organization(s) arising out of the operations described. 4. Advance Premium WC 42 03 04 B (Ed. 6-14) 1of2 �' Copyright 2014 National Council on Compensation Insurance, Inc. All Rights Reserved. WC 42 03 04 B WORKERS COMPENSATION AND EMPLOYERS LIABILITY INSURANCE POLICY (Ed. 6-14) This endorsement changes the policy to which it is attached and is effective on the date issued unless otherwise stated. (The information below is required only when this endorsement is issued subsequent to preparation of the policy.) Endorsement Effective Policy Effective 6/21/21 State Policy No. wcaii�ssz Insured Moss utiiities, LLC Insurance Company Amerisure Insurance Co. WC 42 03 04 B (Ed. 6-14) Endorsement No. Premium Countersigned by 2 of 2 � Copyright 2014 National Council on Compensation Insurance, Inc. All Rights Reserved. THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. EARLIER NOTICE OF CANCELLATION PROVIDED BY US Number of Days Notice For any statutorily permitted reason other than nonpayment of premium, the number of days required for notice of cancellation is increased to the number of days shown in the Schedule above. If this policy is cancelled by us we will send the Named Insured and any party listed in the following schedule notice of cancellation based on the number of days notice shown above. SCHEDULE Name of Person or Organization Mailing Address IL 70 45 05 07 Insured: Moss Utilities, LLC PoliCy #CPP2117851 & CA2117850 THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. NOTICE OF CANCELLATION, NONRENEWAL OR MATERIAL CHANGE - THIRD PARTY This endorsement modifies insurance provided underthe following: AUTO DEALERS COVERAGE FORM BU51NE55AUT0 COVERAGE FORM BU51NE55AUT0 PHY5ICAL DAMAGE COVERAGE FORM COMMERCIAL GENERAL LIABILITY COVERAGE FORM COMMERCIAL UMBRELLA LIABILITY COVERAGE FORM GARAGECOVERAGEFORM MOTOR CARRIER COVERAGE FORM PRODUCT5ICOMPLETED OPERATIONS LIABILITY COVERAGE FORM TRUCKERS COVERAGE FORM 5ubject to the cancellation provisions of the Coverage Form to which this endorsement is attached, we will not: 1. Cancel; 2. Nonrenew; or, 3. Materially change (reduce or restrict) this Coverage Form, except for nonpayment of premium, until we provide at least 6 o days written notice of such cancellation, nonrenewal or material change. Written notice will be to the person or organization named in the Schedule. 5uch notice will be by certified mail with return receipt requested. This notification of cancellation, nanrenewal or material change to the person or organiaation named in the Schedule is intended as a courtesy only. Our failure to provide such notification will not: 1. Extend any Coverage Form cancellation date; 2. Negate the cancellation as to any insured or any certificate holder; 3. Provide any additional insurance that would not have been provided in the absence of this endorsement; or 4. Impose liability of any kind upon us. This endorsement does not entitle the person or organization named in the Schedule to any benefits, rights or protection underthis Coverage Form. SCHEDULE Name Of Persan Or Organization Mailing Address Any person or organization holding a certificate of insurance issued The address shown for that person or organization in for you, provided the certificate: that certificate of insurance 1. Refers to this policy; 2. 5tates that notice of: a. Cancellation; b. Nonrenewal; or c. Material change reducing or restricting coverage; will be provided to that person or organization; 3. Is in efFect at the time of the: a. Cancellation; b. Nonrenewal; or c. Material change reducing or restricting coverage; and 4. Is on file at your agent or broker's office for this policy IL70660714 26th April 26th April 26th April 26th April 26th April ao 6a i9 - 2 MAINTENANCE BflND Page 2 of 3 WI-LEREAS, Principal binds itself to repair or reconstruct the Work in whole or in part upon receiving notice from the Developer andlor City of the naed thereof at any time within the Maintenance Period. NOW THEREFORE, the condition of this obligation is such that if Principal shall remedy any defective Work, for which timely notice was provided by Developer or City, to a completion satisfactory to the City, ttien this obligation shall become nuil and void; otherwise to remain in fu11 force and effect. PROVIDED, HOWEVER, if Priricipal shall fail so to repair or reconstruct any timely noticed defective Work, it is agreed that the Developer or City may cause any and alj such defecti�e Work to be repaired and/or reconstructed with all associated cos#s thereof being borne by the Principal and the Surety under this Maintenance Bond; and PROVIDED FURTHER, that if any legal action be filed on this Bond, venue shall lie in Tarrant County, Texas ar the United States District Court for the Narthern District of Texas, Fort Worth Division; and PROVIDED FUIZTHER, that this obligation shall be cantinuous in nature and successive recoveries may be had hereon for successive breaches. C1TY OF FORT WORTH Texas industries Addition No 3, Lot 2 Block 2 STANDAKD CITY COND]"1'[ONS —DEVEL4PER AWAR17Ei� PROdECTS City Project #103784 Re�ised January 31, 2012 26th April 26th April �� � �RAY SURETY The Gray Insurance Company The Gray Casualty & Surety Gompany Statutary Complain# Notice To o6tain informafian or to make a cornplaint: You rnay contact the Surety via telephone for information or to make a complaint at: 1-504- 754-6711. You may also write to the Surety at: Gray 5urety P.O. Box 6202 Metairie, LA 70009-6202 You may also contact the Texas Department of Insurance ta obtain information on campanies, coverage, rights or complaints at 1-800-252-3439, You may write to the Texas Department of Insurance at: P.O. Box 149104 Austin, TX �8i14-9104 Fax: 512-475-1771 PREMIIlM OR CLAIM DISPUTES: Should you have a dispute concerning your premium or about a claim, you shauld contact the Surety first. If the dispute is not resoived, you may contact the Texas Department of Insurance. ATTACH THIS NOTICE TD YOUR POLlCY: This notice is for information only and does not become part of condition of the attached document. This notice is wri'tten under a complete reservation of rights. Na�hing herein shall be deemed to be an estoppel, waiver or modificatiar� of any of Gray's rights or defenses, and Gray hereby reserves all of i�s rights and defenses under any general agreement of indemnity, con�racts, agreements, bonds, or applicable law. PAVING 60 00 45 26 - 1 CONTRACTOR COMPLIANCE WITH WORKER'S COMP�NSATION LAW Page 1 of 1 SECTION 00 45 26 CONTRACTOR COMPLIANCE WITH WORKER'S COMPENSATION LAW Pursuant to Texas Labor Code Section 406.096(a), as amended, Contractor certifies that it provides worker's compensation insurance coverage for all of its employees employed on City Project No. 103784 . Contractor further certifies that, pursuant to Texas Labor Code, Section 406.096(b), as amended, it will provide to City its subcontractor's certificates of compliance with worker's compensation coverage. CONTRACTOR: Osburn Contractors Company 5800 Democracv Dr Address Plano, TX 75024 Ciry/State/Zip By: !'�� �` � v� � ��:� Signature: � � � Title: �� �c. ��'e�� �:.�� THE STATE OF TEXAS COUNTY OF TARRANT BEFORE ME, the undersigned authority, on this day personally appeared , known to me to be the person whose name is subscribed to e foregoing i strument, and acknowledged to me that he/she executed the same as the act and deed of ps�,a,r� c�J-crr�►�-�o�.s, �..� for the puiposes and consideration therein expressed and in the capacity therein stated. GIVEN LTNDER MY HAND AND SEAL OF OFFICE this ZS day of �or� , 2022. � ,,ti�vp;;e , DIANA LOPEZ : i;' �: Notary Public, State of Texas Notaty Public in and for the State of Texas =a,,�.�r'Q; Comm. Expires 08-17-2025 %%�'oF�; ` Notar ,,,,,,,� y ID 133284079 OF SECTION CITY OF FORT WORTH Texas Industries Addition No 3, Lot 2 Block 2 STANDARD CONSTRUCTION SPECIFICATION DOCUM�NTS City Project #103784 Revised April 2, 2014 April 26, 2022 00 52 43 - 2 Developer Awarded Project Agreement Page 2 of 4 Article 4. CONTRACT PRICE Developer agrees to pay Contractor for performance of the Worlc in accordance with the Contract Docurnents an amount in current funds of Twentv Two Thousand Five Hundred 5ixtv Two & Ib/100 Dollars ($22,562.161 . Article 5. CONTRACT DOCUMENTS 5.1 CONTENTS: A. The Contract Docu.ments which comprise the entire agreement between Developer and Contractor concerning the Work consist of the following: 1. This Agreement. 2. AttacYunents to this Agreement: a. Bid Form (As provided by Developer} 1) Proposal Form (DAP Version) 2} Prequalification Statement 3) State and Federal documents (project specific) b. Ins�.uance ACORD Form(s) c. Payment Bond (DAP Version) d. Performance Bond (DAP Version) e. Maintenance Bond (DAP Version) f. Power of Attorney for the Bonds g, Worker's Compensation Affidavit h, MBE and/or SBE Committnent Form (If required) 3. Standard City General Conditions of the Const�uction Contract for Developer Awarded Projects. 4. Supplemen#ary Conditions. 5. Specificatioils specifically made a part of the Contract Documents by attachment or, if not attached, as iiicorporated by reference and described in the Tabie of Contents of the Project's Contract DocutnenCs. 6. Drawings. 7. Addenda. 8. Docurnentation submitted by Contractor prior to Notice of Award. 9. The following which may be delivered or issued after the Effective Date of the Agreement and, if issued, become an incorporated part of tlie Contract Documents: a. Natice to Proceed. b. Field Orders. a Change Orders. d. Letter of Final Acceptance. CITY OF FORT WORTH Texas Industries Addition No 3, Lot 2 Bloek 2 STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS —DAP City Project #103784 Revised 7une 16, 2016 00 52 43 - 3 Developer Awurded Project Agreemeut Page 3 of 4 Article 6. INDEMNLFICATION 6.1 Contractor covenants and agrees to indemnify, hold harmless and defend, at its own expense, the city, its offcers, servants and employees, from and against any and all claims arising ont of, or alleged to arise out of, the work and services to be performed by the contractor, its ofticers, agents, employees, subcontracfiors, licenses or invitees under this contract. This indemnificatian arovision is snecilicallv intended to oaerate and be effective even if ii is alleged or proven that all or some of the dama�es being sought were caused, in whole or in nart, bv anv act, omission or neslieence of the citv. This indemnity provision is intended to inclnde, without limiiaiion, indemnity for costs, expenses and Iegai fees incurred by the city in defending against such claims and causes of actions. 6.2 Contractor covenants and agrees to indemnify and hold harmless, at its own expense, the city, its officers, servants and employees, from and against any and all lass, damage or destrnction of property of the city, arising out of, or alleged to arise out of, the work and services to be performed by the contractor, its officers, agents, empioyees, subcontractors, licensees or invitees under this contract. This indemnification provision is snecificallv intended to aperate and be effective even if it is alte�ed or proven that all ar s4me of the damages bein$ sought were caused, in whole or in nart, by anv ac� omission or neslieence of the citv. Article 7. MISCELLANEOUS 7.1 Terms. Terrns used in this Agreement are defined in Article 1 of the Standard City Conditions of the Construction Contract for Developer Awarded Projects. 7.2 Assignment of Contract. This Agreement, including all of the Conh•act Documents may not be assigned by the Conhactor without the advanced express written consent of the Developer. 7.3 Successors and Assigns. Developer and Contractor each binds itself, its partners, snccessars, assigns and legal representatives to the other party hereto, in respect to all covenants, agreements and obligations contained in the Contract Documents. 7.4 Severability. Any provision or part af the Contract Dacuments held to be unconstitutional, void or unenforceable by a court of competent jurisdiciion shall be deemed strrcken, and alI remaining provisions shall continue to be valid and binding upon DEVELOPER and CONTRACTOR. 7.5 Governing Law and Venue. This Agreement, including all of the Contract Documents is perfortnable in tlie State of Texas, Venue shall be Tarrant County, Texas, or the United States District Court for the Northern Dis�rict of Texas, Fort Worth Division. CI1`Y OF FORT WORTH Texas Indnstries AddiHon No 3, Lot 2 Block 2 STANDARD CONSTRUCTION SPECXFICATION DOCLTMENTS —DAP City Project #103784 Rcviscd June 16, 2016 04/26/2022 COMMERCIAL AUTOMOBILE HA 99 16 03 12 THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. COMMERCIAL AUTOMOBILE BROAD FORM ENDORSEMENT This endorsement modifies insurance provided under the following: BUSINESS AUTO COVERAGE FORM To the extent that the provisions of this endorsement provide broader benefits to the "insured" than other provisions of the Coverage Form, the provisions of this endorsement apply. 1. BROAD FORM INSURED d. Any "employee" of yours while using a covered "auto" you don't own, hire orA. Subsidiaries and Newly Acquired or borrow in your business or yourFormed Organizations personal affairs.The Named Insured shown in the C. Lessors as InsuredsDeclarations is amended to include: Paragraph A.1. - WHO IS AN INSURED - of(1) Any legal business entity other than a Section II - Liability Coverage is amended topartnership or joint venture, formed as a add:subsidiary in which you have an ownership interest of more than 50% on e. The lessor of a covered "auto" while the the effective date of the Coverage Form."auto" is leased to you under a written However, the Named Insured does not agreement if: include any subsidiary that is an (1) The agreement requires you to"insured" under any other automobile provide direct primary insurance forpolicy or would be an "insured" under the lessor andsuch a policy but for its termination or (2) The "auto" is leased without a driver.the exhaustion of its Limit of Insurance. Such a leased "auto" will be considered a (2) Any organization that is acquired or covered "auto" you own and not a covered formed by you and over which you "auto" you hire.maintain majority ownership. However, the Named Insured does not include any D. Additional Insured if Required by Contract newly formed or acquired organization:(1) Paragraph A.1. - WHO IS AN INSURED (a) That is a partnership or joint - of Section II - Liability Coverage is venture,amended to add: (b) That is an "insured" under any other f. When you have agreed, in a writtenpolicy,contract or written agreement, that a (c) That has exhausted its Limit of person or organization be added as Insurance under any other policy, or an additional insured on your business auto policy, such person or(d) 180 days or more after its organization is an "insured", but onlyacquisition or formation by you, to the extent such person orunless you have given us notice of organization is liable for "bodilythe acquisition or formation. injury" or "property damage" causedCoverage does not apply to "bodily by the conduct of an "insured" underinjury" or "property damage" that results paragraphs a. or b. of Who Is Anfrom an "accident" that occurred before Insured with regard to theyou formed or acquired the organization. ownership, maintenance or use of aB. Employees as Insureds covered "auto." Paragraph A.1. - WHO IS AN INSURED - of SECTION II - LIABILITY COVERAGE is amended to add: © 2011, The Hartford (Includes copyrighted material Form HA 99 16 03 12 Page 1 of 5of ISO Properties, Inc., with its permission.) Policy Number: 21UEADH4087 Policy Term: 5/1/22 to 5/1/23 WM5S9TXYPage 3 of 10 E.Primary and Non-Contributory ifTheinsuranceaffordedtoanysuch Required by Contractadditionalinsuredappliesonlyifthe "bodily injury"or "property damage"Only with respect to insurance provided to occurs:an additional insured in 1.D.-Additional (1)During the policy period, and Insured If Required by Contract,the following provisions apply:(2)Subsequent to the execution of such written contract, and (3)Primary Insurance When Required By Contract(3)Prior to the expiration of the period of time that the written contract This insurance is primary if you have requires such insurance be provided agreed in a written contract or written to the additional insured.agreement that this insurance be primary.If other insurance is also (2)How Limits Apply primary,we will share with all that otherIfyouhaveagreedinawrittencontractinsurancebythemethoddescribedinorwrittenagreementthatanother Other Insurance 5.d.person or organization be added as an (4)Primary And Non-Contributory To Otheradditionalinsuredonyourpolicy,the Insurance When Required By Contractmostwewillpayonbehalfofsuch additional insured is the lesser of:If you have agreed in a written contract or written agreement that this insurance(a)The limits of insurance specified in is primary and non-contributory with the the written contract or written additional insured's own insurance,this agreement; or insurance is primary and we will not(b)The Limits of Insurance shown in seek contribution from that otherthe Declarations.insurance. Such amount shall be a part of and not (3)(4)Paragraphs and do not apply to other in addition to Limits of Insurance shown insurance to which the additional insuredintheDeclarationsanddescribedinthishasbeen added as an additional insured.Section. When this insurance is excess,we will have no (3)Additional Insureds Other Insurance duty to defend the insured against any "suit"if If we cover a claim or "suit"under this any other insurer has a duty to defend the Coverage Part that may also be covered insured against that "suit".If no other insurer by other insurance available to an defends,we will undertake to do so,but we will additional insured,such additional be entitled to the insured's rights against all insured must submit such claim or "suit"those other insurers. to the other insurer for defense and When this insurance is excess over otherindemnity. insurance,we will pay only our share of the However,this provision does not apply amount of the loss,if any,that exceeds the sum to the extent that you have agreed in a of: written contract or written agreement (1)The total amount that all such otherthatthisinsuranceisprimaryandnon-insurance would pay for the loss in thecontributorywiththeadditionalinsured's absence of this insurance; andowninsurance. (2)The total of all deductible and self-insured (4)Duties in The Event Of Accident,Claim,amounts under all that other insurance.Suit or Loss We will share the remaining loss,if any,by the If you have agreed in a written contract method described in Other Insurance 5.d.or written agreement that another 2.AUTOS RENTED BY EMPLOYEESpersonororganizationbeaddedasan additional insured on your policy,the Any "auto"hired or rented by your "employee" additional insured shall be required to on your behalf and at your direction will be comply with the provisions in LOSS considered an "auto"you hire. CONDITIONS 2.-DUTIES IN THE The OTHER INSURANCE Condition is amended EVENT OF ACCIDENT,CLAIM ,SUIT by adding the following: OR LOSS –OF SECTION IV – BUSINESS AUTO CONDITIONS,in the same manner as the Named Insured. © 2011, The Hartford (Includes copyrighted material Form HA 99 16 03 12 Page 2 of 5of ISO Properties,Inc.,with its permission.) WM5S9TXYPage 4 of 10 5 PHYSICAL DAMAGE -ADDITIONALIfan"employee’s"personal insurance also . TEMPORARY TRANSPORTATION EXPENSE applies on an excess basis to a covered "auto" COVERAGEhiredorrentedbyyour"employee"on your behalf and at your direction,this insurance will Paragraph A.4.a.of SECTION III -PHYSICAL be primary to the "employee’s"personal DAMAGE COVERAGE is amended to provide a insurance.limit of $50 per day and a maximum limit of 3.AMENDED FELLOW EMPLOYEE EXCLUSION $1,000. 6.LOAN/LEASE GAP COVERAGEEXCLUSION5.-FELLOW EMPLOYEE -of SECTION II -LIABILITY COVERAGE does not Under SECTION III -PHYSICAL DAMAGE apply if you have workers'compensation COVERAGE,in the event of a total "loss"to a insurance in-force covering all of your covered "auto",we will pay your additional legal "employees".obligation for any difference between the actual Coverage is excess over any other collectible cash value of the "auto"at the time of the "loss" insurance.and the "outstanding balance"of the loan/lease. 4.HIRED AUTO PHYSICAL DAMAGE COVERAGE "Outstanding balance"means the amount you owe on the loan/lease at the time of "loss"less If hired "autos"are covered "autos"for Liability any amounts representing taxes;overdueCoverageandifComprehensive,Specified payments;penalties,interest or chargesCausesofLoss,or Collision coverages are resulting from overdue payments;additionalprovidedunderthisCoverageFormforany mileage charges;excess wear and tear charges;"auto"you own,then the Physical Damage lease termination fees;security deposits not Coverages provided are extended to "autos" you returned by the lessor;costs for extendedhire or borrow,subject to the following limit. warranties,credit life Insurance,health,accidentThemostwewillpayfor"loss"to any hired or disability insurance purchased with the loan or "auto"is:lease;and carry-over balances from previous (1)$100,000;loans or leases. (2)The actual cash value of the damaged or 7.AIRBAG COVERAGE stolen property at the time of the "loss"; or Under Paragraph B.EXCLUSIONS -of (3)The cost of repairing or replacing the SECTION III -PHYSICAL DAMAGE damaged or stolen property,COVERAGE, the following is added: whichever is smallest,minus a deductible.The The exclusion relating to mechanical breakdown deductible will be equal to the largest deductible does not apply to the accidental discharge of an applicable to any owned "auto"for that airbag. coverage. No deductible applies to "loss"caused 8.ELECTRONIC EQUIPMENT -BROADENEDby fire or lightning. Hired Auto Physical Damage COVERAGEcoverageisexcessoveranyothercollectible a.The exceptions to Paragraphs B.4 -insurance.Subject to the above limit,deductible EXCLUSIONS -of SECTION III -PHYSICAL and excess provisions,we will provide coverage DAMAGE COVERAGE are replaced by the equal to the broadest coverage applicable to any following:covered "auto"you own. 4.c.4.d.Exclusions and do not apply to We will also cover loss of use of the hired "auto" equipment designed to be operated solelyifitresultsfroman"accident",you are legally by use of the power from the "auto's"liable and the lessor incurs an actual financial electrical system that,at the time of "loss", loss,subject to a maximum of $1000 per is:"accident". (1)Permanently installed in or upon This extension of coverage does not apply to the covered "auto";any "auto"you hire or borrow from any of your "employees",partners (if you are a partnership),(2)Removable from a housing unit members (if you are a limited liability company),which is permanently installed in or members of their households.or upon the covered "auto"; (3)An integral part of the same unit housing any electronic equipment described in Paragraphs (1)and (2)above;or © 2011, The Hartford (Includes copyrighted material Form HA 99 16 03 12 Page 3 of 5of ISO Properties,Inc.,with its permission.) WM5S9TXYPage 5 of 10 (4)Necessary for the normal If another Hartford Financial Services Group, operation of the covered "auto"or Inc.company policy or coverage form that is not the monitoring of the covered an automobile policy or coverage form applies to "auto's"operating system.the same "accident", the following applies: b.Section III –Version CA 00 01 03 10 of the (1)If the deductible under this Business Auto Business Auto Coverage Form,Physical Coverage Form is the smaller (or smallest) Damage Coverage,Limit of Insurance,deductible,it will be waived; Paragraph C.2 and Version CA 00 01 10 01 of (2)If the deductible under this Business Auto the Business Auto Coverage Form,Physical Coverage Form is not the smaller (or Damage Coverage,Limit of Insurance, smallest)deductible,it will be reduced by Paragraph C are each amended to add the the amount of the smaller (or smallest) following:deductible. $1,500 is the most we will pay for "loss"in 12.AMENDED DUTIES IN THE EVENT OF any one "accident"to all electronic ACCIDENT, CLAIM,SUIT OR LOSS equipment (other than equipment designed The requirement in LOSS CONDITIONS 2.a.-solely for the reproduction of sound,and DUTIES IN THE EVENT O F ACCIDENT,CLAIM,accessories used with such equipment)SUIT OR LOSS -of SECTION IV -BUSINESSthatreproduces,receives or transmits AUTO CONDITIONS that you must notify us of audio,visual or data signals which,at the an "accident"applies only when the "accident" istime of "loss", is:known to: (1)Permanently installed in or upon (1)You, if you are an individual;the covered "auto"in a housing, (2)A partner, if you are a partnership;opening or other location that is not normally used by the "auto"(3)A member,if you are a limited liability manufacturer for the installation of company;or such equipment; (4)An executive officer or insurance manager, if (2)Removable from a permanently you are a corporation. installed housing unit as described 13.UNINTENTIONAL FAILURE TO DISCLOSE in Paragraph 2.a.above or is an HAZARDSintegral part of that equipment; or If you unintentionally fail to disclose any hazards(3)An integral part of such equipment.existing at the inception date of your policy,we c.For each covered "auto",should loss be limited will not deny coverage under this Coverage to electronic equipment only,our obligation to Form because of such failure. pay for,repair,return or replace damaged or 14.HIRED AUTO -COVERAGE TERRITORYstolenelectronicequipmentwillbereducedby Paragraph e.of GENERAL CONDITIONS 7.-the applicable deductible shown in the POLICY PERIOD,COVERAGE TERRITORY -Declarations,or $250,whichever deductible is of SECTION IV -BUSINESS AUTO less. CONDITIONS is replaced by the following:9.EXTRA EXPENSE -BROADENED e.For short-term hired "autos",the coverageCOVERAGE territory with respect to Liability Coverage isUnderParagraphA.- COVERAGE -of SECTION anywhere in the world provided that if theIII-PHYSICAL DAMAGE COVERAGE,we will "insured's"responsibility to pay damages for pay for the expense of returning a stolen covered "bodily injury"or "property damage"is "auto"to you.determined in a "suit," the "suit" is brought in 10.GLASS REPAIR -WAIVER OF DEDUCTIBLE the United States of America,the territories and possessions of the United States ofUnderParagraphD.-DEDUCTIBLE -of SECTION America,Puerto Rico or Canada or in a III -PHYSICAL DAMAGE COVERAGE,the settlement we agree to.following is added: 15.WAIVER OF SUBROGATIONNodeductibleappliestoglassdamageifthe glass is repaired rather than replaced.TRANSFER OF RIGHTS OF RECOVERY AGAINST OTHERS TO US -of SECTION IV -11.TWO OR MORE DEDUCTIBLES BUSINESS AUTO CONDITIONS is amended byUnderParagraphD.-DEDUCTIBLE -of SECTION adding the following:III -PHYSICAL DAMAGE COVERAGE,the following is added: © 2011, The Hartford (Includes copyrighted material Form HA 99 16 03 12 Page 4 of 5of ISO Properties,Inc.,with its permission.) WM5S9TXYPage 6 of 10 We waive any right of recovery we may have c.Regardless of the number of autos deemed a against any person or organization with whom total loss,the most we will pay under this you have a written contract that requires such Hybrid,Electric,or Natural Gas Vehicle waiver because of payments we make for Payment Coverage provision for any one damages under this Coverage Form."loss"is $10,000. 16.RESULTANT MENTAL ANGUISH COVERAGE For the purposes of the coverage provision, The definition of "bodily injury"in SECTION V-a.A "non-hybrid"auto is defined as an auto that DEFINITIONS is replaced by the following:uses only an internal combustion engine to move the auto but does not include autos"Bodily injury"means bodily injury,sickness or powered solely by electricity or natural gas.disease sustained by any person,including mental anguish or death resulting from any of b.A "hybrid"auto is defined as an auto with an these.internal combustion engine and one or more electric motors;and that uses the internal17.EXTENDED CANCELLATION CONDITION combustion engine and one or more electric Paragraph 2.of the COMMON POLICY motors to move the auto,or the internal CONDITIONS -CANCELLATION -applies combustion engine to charge one or more except as follows:electric motors, which move the auto. If we cancel for any reason other than 19.VEHICLE WRAP COVERAGEnonpaymentofpremium,we will mail or deliver In the event of a total loss to an "auto"for whichtothefirstNamedInsuredwrittennoticeof Comprehensive,Specified Causes of Loss,orcancellationatleast60daysbeforetheeffective Collision coverages are provided under thisdate of cancellation. Coverage Form,then such Physical Damage18.HYBRID,ELECTRIC,OR NATURAL GAS Coverages are amended to add the following:VEHICLE PAYMENT COVERAGE In addition to the actual cash value of the "auto", In the event of a total loss to a "non-hybrid"auto we will pay up to $1,000 for vinyl vehicle wraps for which Comprehensive,Specified Causes of which are displayed on the covered "auto"at theLoss,or Collision coverages are provided under time of total loss.Regardless of the number ofthisCoverageForm,then such Physical autos deemed a total loss,the most we will pay Damage Coverages are amended as follows:under this Vehicle Wrap Coverage provision for a.If the auto is replaced with a "hybrid"auto or any one "loss"is $5,000.For purposes of this an auto powered solely by electricity or natural coverage provision,signs or other graphics gas,we will pay an additional 10%,to a painted or magnetically affixed to the vehicle are maximum of $2,500,of the "non-hybrid"auto’s not considered vehicle wraps. actual cash value or replacement cost, whichever is less, b.The auto must be replaced and a copy of a bill of sale or new lease agreement received by us within 60 calendar days of the date of "loss," © 2011, The Hartford (Includes copyrighted material Form HA 99 16 03 12 Page 5 of 5of ISO Properties,Inc.,with its permission.) WM5S9TXYPage 7 of 10 THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. Form HS 30 06 03 17 Page 1 of 2 © 2017, The Hartford BLANKET ADDITIONAL INSURED – AS REQUIRED BY WRITTEN CONTRACT – OPTION V This endorsement modifies insurance provided under the following: COMMERCIAL GENERAL LIABILITY COVERAGE PART SECTION II — WHO IS AN INSURED,Paragraph 6. Additional Insureds When Required by Written Contract, Written Agreement or Permit, Subparagraph f. Any Other Party is deleted and replaced with the following: A.Any other person or organization who is not an additional insured under Paragraphs a.through e.above and has not been added as an additional insured by separate endorsement under this Coverage Part, but only with respect to liability for "bodily injury'', "property damage" or ''personal and advertising injury" as described in Paragraph (1),(2),or (3)below, whichever applies: (1)If the "written contract" specifically requires you to provide additional insured coverage to that person or organization by the use of the Additional Insured – Owners, Lessees or Contractors endorsement CG 20 10 11 85, or Additional Insured – Owners, Lessees or Contractors – Scheduled Person Or Organization endorsement CG 20 10 10 01, or the Additional Insured – Owners, Lessees or Contractors - Completed Operations endorsement CG 20 37 10 01, then such person or organization is an additional insured, but only with respect to liability arising out of “your work” to which the “written contract” applies; or (2)If the "written contract" specifically requires you to provide additional insured coverage to that person or organization by the use of: a.The Additional Insured — Owners, Lessees or Contractors — Scheduled Person or Organization endorsement CG 20 10 07 04 or CG 20 10 04 13, the Additional Insured — Owners, Lessees or Contractors — Completed Operations endorsement CG 20 37 07 04 or CG 20 37 04 13, or both of such endorsements with either of those edition dates; or b.Either or both of the following: the Additional Insured — Owners, Lessees or Contractors — Scheduled Person Or Organization endorsement CG 20 10, or the Additional Insured —Owners, Lessees or Contractors —Completed Operations endorsement CG 20 37, without an edition date of such endorsement specified; then such person or organization is an additional insured, but only with respect to liability caused, in whole or in part, by “your work” to which the “written contract” applies; or (3)If neither Paragraph (1)nor (2)above ap- plies, then the person or organization is an additional insured only if, and to the extent that, the injury or damage is caused by "your work" to which the "written contract" applies. B.The insurance afforded to the additional insured under this endorsement: (1)Applies only if the "bodily injury" or "property damage" occurs, or the "personal and advertising injury" offense is committed: (a)During the policy period; and (b)Subsequent to the execution of the "written contract"; and (c)Prior to the expiration of the period of time that the "written contract" requires such insurance be provided to the additional insured; and (d)Only to the extent permitted by law; and (e)Will not be broader than that which the "written contract" requires. C.The following additional exclusion applies to any person or organization that qualifies as an additional insured under this endorsement: (1)This insurance does not apply to "bodily injury", "property damage" or "personal and advertising injury" arising out of the rendering of, or the failure to render, any professional architectural, engineering or surveying services, including: Policy Number: 21UEADH3917 Policy Term: 5/1/22 to 5/1/23 WM5S9TXYPage 8 of 10 Page 2 of 2 Form HS 30 06 03 17 (a)The preparing, approving, or failing to prepare or approve maps, shop drawings, opinions, reports, surveys, field orders, change orders, designs or specifications; or (b)Supervisory, inspection, architectural or engineering activities. D. SECTION IV – COMMERCIAL GENERAL LIABLIITY CONDITIONS,Paragraph 4. Other Insurance,Paragraph b. Excess Insurance, Subparagraph (7)When You Add Others As An Additional Insured To This Insurance is deleted and replaced with the following: (7) When You Add Others As An Additional Insured To This Insurance Any other insurance available to an additional insured. However, the following provisions apply to other insurance available to any person or organization who is an additional insured under this endorsement for this Coverage Part. (a) Primary Insurance This insurance is primary if you have agreed in the "written contract" that this insurance be primary. If other insurance is also primary, we will share with all that other insurance by the method described in Paragraph (c)below. This insurance does not apply to other insurance to which the additional insured has been added as an additional insured. (b) Primary And Non-Contributory To Other Insurance This insurance is primary to and will not seek contribution from any other insurance available to an additional insured under your policy provided that: (i)The additional insured under this endorsement is a Named Insured under such other insurance; and (ii)You have agreed in the "written contract" that this insurance would be primary and would not seek contribution from any other insurance available to such additional insured. (c) Method of Sharing If all of the other insurance permits contribution by equal shares, we will follow this method also. Under this approach, each insurer contributes equal amounts until it has paid its applicable limit of insurance or none of the loss remains, whichever comes first. If any of the other insurance does not permit contribution by equal shares, we will contribute by limits. Under this method, each insurer's share is based on the ratio of its applicable limit of insurance to the total applicable limits of insurance of all insurers. E.With respect to insurance provided to the person or organization that is an additional insured under this endorsement,SECTION IV – COMMERCIAL GENERAL LIABILITY CONDITIONS,Paragraph 2. Duties In The Event Of Occurrence, Offense, Claim or Suit is amended to include the following: The additional insured must tender the defense and indemnity of any claim or “suit” to any other insurer or self-insurer whose policy or program applies to a loss we cover under this endorsement. However, if the "written contract" requires this insurance to be primary and non- contributory, then this provision does not apply to insurance to which the additional insured is the Named Insured. F.The insurance provided to the additional insured does not apply to “bodily injury”, “property damage” or “personal and advertising injury” included in the “products-completed operations hazard”, unless the “written contract” specifically requires such coverage be provided for the additional insured. If additional insured coverage during the “products-completed operation hazard” is required by the “written contract”, then such coverage will be provided for either: (1)The number of years as required by the “written contract”, but in no event greater than the applicable state’s statute of repose; or (2)If the “written contract” is silent on the number of years required for “products- completed operations coverage”, then such coverage will be provided for 2 years from the date this policy expires, cancels or terminates. G.Only for the purpose of this endorsement, “written contract” means a written contract or written agreement that requires you to include a person or organization as an additional insured on this Coverage Part, provided that: a.The “bodily injury”, “property damage” or “personal advertising injury” is caused by an “occurrence” or offense during the policy period; and b.The “written contract” was executed prior to the inception of the policy period and in effect during such “bodily injury”, “property damage” or “personal advertising injury”. All other terms and conditions in the policy remain unchanged. WM5S9TXYPage 9 of 10 1exasMutuaI® WORKERS' COMPENSATION INSURANCE WORKERS' CO MPENSATION AND EMPLOYERS LIABILI TY POLICY WC 42 03 04 B Insured copy TEXAS WAIVER OF OUR RIGHT TO RECOVER FROM OTHERS ENDORSEMENT This endorsement applies only to the insurance provided by the policy because Te xas is shown in item 3.A. of the Information Page. We have the right to recover our payments from anyone liable for an injury covered by this policy. We will not enforce our right against the person or organization named in the Schedule, but this waiver applies only with respect to bodily injury arising out of the operations described in the schedule where you are required by a written contract to obtain this waiver from us. This endorsement shall not operate directly or indirectly to benefit anyone not named in the Schedule. The premium for this endorsement is shown in the Schedule. 1.( ) Specific Waiver Name of person or organization (X)Blanket Waiver Schedule Any person or organization for whom the Named Insured has agreed by written contract to furnish this waiver. 2. Operations:All Te xas operations 3.Premium: The premium charge for this endorsement shall be 2.00 percent of the premium developed on payroll in connection with work performed for the above person(s) or organization(s) arising out of the operations described. 4. Advance Premium: Included, see Information Page This endorsement changes the policy to which it is attached effective on the inception date of the policy unless a different date is indicated below. (The following "attaching clause" need be completed only when this endorsement is issued subsequent to preparation of the policy.) This endorsement, effective on 5/1/22 at 12:01 a.m. standard time, forms a part of: Policy no. 0002014140 of Texas Mutual Insurance Company effective on 5/1/22 Issued to: OSBURN CONTRACTORS LLC NCCI Carrier Code: 29939 1 of 1 This is not a bill PO Box 12058, Austin, TX 78711-2058 texasmutual.com I (800) 859-5995 I Fax (800) 359-0650 Authorized representative 5/4/22 WC 42 03 04 B WM5S9TXYPage 10 of 10 COMMERCIAL AUTOMOBILE HA 99 16 03 12 THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. COMMERCIAL AUTOMOBILE BROAD FORM ENDORSEMENT This endorsement modifies insurance provided under the following: BUSINESS AUTO COVERAGE FORM To the extent that the provisions of this endorsement provide broader benefits to the "insured" than other provisions of the Coverage Form, the provisions of this endorsement apply. 1. BROAD FORM INSURED d. Any "employee" of yours while using a covered "auto" you don't own, hire orA. Subsidiaries and Newly Acquired or borrow in your business or yourFormed Organizations personal affairs.The Named Insured shown in the C. Lessors as InsuredsDeclarations is amended to include: Paragraph A.1. - WHO IS AN INSURED - of(1) Any legal business entity other than a Section II - Liability Coverage is amended topartnership or joint venture, formed as a add:subsidiary in which you have an ownership interest of more than 50% on e. The lessor of a covered "auto" while the the effective date of the Coverage Form."auto" is leased to you under a written However, the Named Insured does not agreement if: include any subsidiary that is an (1) The agreement requires you to"insured" under any other automobile provide direct primary insurance forpolicy or would be an "insured" under the lessor andsuch a policy but for its termination or (2) The "auto" is leased without a driver.the exhaustion of its Limit of Insurance. Such a leased "auto" will be considered a (2) Any organization that is acquired or covered "auto" you own and not a covered formed by you and over which you "auto" you hire.maintain majority ownership. However, the Named Insured does not include any D. Additional Insured if Required by Contract newly formed or acquired organization:(1) Paragraph A.1. - WHO IS AN INSURED (a) That is a partnership or joint - of Section II - Liability Coverage is venture,amended to add: (b) That is an "insured" under any other f. When you have agreed, in a writtenpolicy,contract or written agreement, that a (c) That has exhausted its Limit of person or organization be added as Insurance under any other policy, or an additional insured on your business auto policy, such person or(d) 180 days or more after its organization is an "insured", but onlyacquisition or formation by you, to the extent such person orunless you have given us notice of organization is liable for "bodilythe acquisition or formation. injury" or "property damage" causedCoverage does not apply to "bodily by the conduct of an "insured" underinjury" or "property damage" that results paragraphs a. or b. of Who Is Anfrom an "accident" that occurred before Insured with regard to theyou formed or acquired the organization. ownership, maintenance or use of aB. Employees as Insureds covered "auto." Paragraph A.1. - WHO IS AN INSURED - of SECTION II - LIABILITY COVERAGE is amended to add: © 2011, The Hartford (Includes copyrighted material Form HA 99 16 03 12 Page 1 of 5of ISO Properties, Inc., with its permission.) Policy Number: 21UEADH4087 Policy Term: 5/1/22 to 5/1/23 3AQTNSF6Page 3 of 10 E.Primary and Non-Contributory ifTheinsuranceaffordedtoanysuch Required by Contractadditionalinsuredappliesonlyifthe "bodily injury"or "property damage"Only with respect to insurance provided to occurs:an additional insured in 1.D.-Additional (1)During the policy period, and Insured If Required by Contract,the following provisions apply:(2)Subsequent to the execution of such written contract, and (3)Primary Insurance When Required By Contract(3)Prior to the expiration of the period of time that the written contract This insurance is primary if you have requires such insurance be provided agreed in a written contract or written to the additional insured.agreement that this insurance be primary.If other insurance is also (2)How Limits Apply primary,we will share with all that otherIfyouhaveagreedinawrittencontractinsurancebythemethoddescribedinorwrittenagreementthatanother Other Insurance 5.d.person or organization be added as an (4)Primary And Non-Contributory To Otheradditionalinsuredonyourpolicy,the Insurance When Required By Contractmostwewillpayonbehalfofsuch additional insured is the lesser of:If you have agreed in a written contract or written agreement that this insurance(a)The limits of insurance specified in is primary and non-contributory with the the written contract or written additional insured's own insurance,this agreement; or insurance is primary and we will not(b)The Limits of Insurance shown in seek contribution from that otherthe Declarations.insurance. Such amount shall be a part of and not (3)(4)Paragraphs and do not apply to other in addition to Limits of Insurance shown insurance to which the additional insuredintheDeclarationsanddescribedinthishasbeen added as an additional insured.Section. When this insurance is excess,we will have no (3)Additional Insureds Other Insurance duty to defend the insured against any "suit"if If we cover a claim or "suit"under this any other insurer has a duty to defend the Coverage Part that may also be covered insured against that "suit".If no other insurer by other insurance available to an defends,we will undertake to do so,but we will additional insured,such additional be entitled to the insured's rights against all insured must submit such claim or "suit"those other insurers. to the other insurer for defense and When this insurance is excess over otherindemnity. insurance,we will pay only our share of the However,this provision does not apply amount of the loss,if any,that exceeds the sum to the extent that you have agreed in a of: written contract or written agreement (1)The total amount that all such otherthatthisinsuranceisprimaryandnon-insurance would pay for the loss in thecontributorywiththeadditionalinsured's absence of this insurance; andowninsurance. (2)The total of all deductible and self-insured (4)Duties in The Event Of Accident,Claim,amounts under all that other insurance.Suit or Loss We will share the remaining loss,if any,by the If you have agreed in a written contract method described in Other Insurance 5.d.or written agreement that another 2.AUTOS RENTED BY EMPLOYEESpersonororganizationbeaddedasan additional insured on your policy,the Any "auto"hired or rented by your "employee" additional insured shall be required to on your behalf and at your direction will be comply with the provisions in LOSS considered an "auto"you hire. CONDITIONS 2.-DUTIES IN THE The OTHER INSURANCE Condition is amended EVENT OF ACCIDENT,CLAIM ,SUIT by adding the following: OR LOSS –OF SECTION IV – BUSINESS AUTO CONDITIONS,in the same manner as the Named Insured. © 2011, The Hartford (Includes copyrighted material Form HA 99 16 03 12 Page 2 of 5of ISO Properties,Inc.,with its permission.) 3AQTNSF6Page 4 of 10 5 PHYSICAL DAMAGE -ADDITIONALIfan"employee’s"personal insurance also . TEMPORARY TRANSPORTATION EXPENSE applies on an excess basis to a covered "auto" COVERAGEhiredorrentedbyyour"employee"on your behalf and at your direction,this insurance will Paragraph A.4.a.of SECTION III -PHYSICAL be primary to the "employee’s"personal DAMAGE COVERAGE is amended to provide a insurance.limit of $50 per day and a maximum limit of 3.AMENDED FELLOW EMPLOYEE EXCLUSION $1,000. 6.LOAN/LEASE GAP COVERAGEEXCLUSION5.-FELLOW EMPLOYEE -of SECTION II -LIABILITY COVERAGE does not Under SECTION III -PHYSICAL DAMAGE apply if you have workers'compensation COVERAGE,in the event of a total "loss"to a insurance in-force covering all of your covered "auto",we will pay your additional legal "employees".obligation for any difference between the actual Coverage is excess over any other collectible cash value of the "auto"at the time of the "loss" insurance.and the "outstanding balance"of the loan/lease. 4.HIRED AUTO PHYSICAL DAMAGE COVERAGE "Outstanding balance"means the amount you owe on the loan/lease at the time of "loss"less If hired "autos"are covered "autos"for Liability any amounts representing taxes;overdueCoverageandifComprehensive,Specified payments;penalties,interest or chargesCausesofLoss,or Collision coverages are resulting from overdue payments;additionalprovidedunderthisCoverageFormforany mileage charges;excess wear and tear charges;"auto"you own,then the Physical Damage lease termination fees;security deposits not Coverages provided are extended to "autos" you returned by the lessor;costs for extendedhire or borrow,subject to the following limit. warranties,credit life Insurance,health,accidentThemostwewillpayfor"loss"to any hired or disability insurance purchased with the loan or "auto"is:lease;and carry-over balances from previous (1)$100,000;loans or leases. (2)The actual cash value of the damaged or 7.AIRBAG COVERAGE stolen property at the time of the "loss"; or Under Paragraph B.EXCLUSIONS -of (3)The cost of repairing or replacing the SECTION III -PHYSICAL DAMAGE damaged or stolen property,COVERAGE, the following is added: whichever is smallest,minus a deductible.The The exclusion relating to mechanical breakdown deductible will be equal to the largest deductible does not apply to the accidental discharge of an applicable to any owned "auto"for that airbag. coverage. No deductible applies to "loss"caused 8.ELECTRONIC EQUIPMENT -BROADENEDby fire or lightning. Hired Auto Physical Damage COVERAGEcoverageisexcessoveranyothercollectible a.The exceptions to Paragraphs B.4 -insurance.Subject to the above limit,deductible EXCLUSIONS -of SECTION III -PHYSICAL and excess provisions,we will provide coverage DAMAGE COVERAGE are replaced by the equal to the broadest coverage applicable to any following:covered "auto"you own. 4.c.4.d.Exclusions and do not apply to We will also cover loss of use of the hired "auto" equipment designed to be operated solelyifitresultsfroman"accident",you are legally by use of the power from the "auto's"liable and the lessor incurs an actual financial electrical system that,at the time of "loss", loss,subject to a maximum of $1000 per is:"accident". (1)Permanently installed in or upon This extension of coverage does not apply to the covered "auto";any "auto"you hire or borrow from any of your "employees",partners (if you are a partnership),(2)Removable from a housing unit members (if you are a limited liability company),which is permanently installed in or members of their households.or upon the covered "auto"; (3)An integral part of the same unit housing any electronic equipment described in Paragraphs (1)and (2)above;or © 2011, The Hartford (Includes copyrighted material Form HA 99 16 03 12 Page 3 of 5of ISO Properties,Inc.,with its permission.) 3AQTNSF6Page 5 of 10 (4)Necessary for the normal If another Hartford Financial Services Group, operation of the covered "auto"or Inc.company policy or coverage form that is not the monitoring of the covered an automobile policy or coverage form applies to "auto's"operating system.the same "accident", the following applies: b.Section III –Version CA 00 01 03 10 of the (1)If the deductible under this Business Auto Business Auto Coverage Form,Physical Coverage Form is the smaller (or smallest) Damage Coverage,Limit of Insurance,deductible,it will be waived; Paragraph C.2 and Version CA 00 01 10 01 of (2)If the deductible under this Business Auto the Business Auto Coverage Form,Physical Coverage Form is not the smaller (or Damage Coverage,Limit of Insurance, smallest)deductible,it will be reduced by Paragraph C are each amended to add the the amount of the smaller (or smallest) following:deductible. $1,500 is the most we will pay for "loss"in 12.AMENDED DUTIES IN THE EVENT OF any one "accident"to all electronic ACCIDENT, CLAIM,SUIT OR LOSS equipment (other than equipment designed The requirement in LOSS CONDITIONS 2.a.-solely for the reproduction of sound,and DUTIES IN THE EVENT O F ACCIDENT,CLAIM,accessories used with such equipment)SUIT OR LOSS -of SECTION IV -BUSINESSthatreproduces,receives or transmits AUTO CONDITIONS that you must notify us of audio,visual or data signals which,at the an "accident"applies only when the "accident" istime of "loss", is:known to: (1)Permanently installed in or upon (1)You, if you are an individual;the covered "auto"in a housing, (2)A partner, if you are a partnership;opening or other location that is not normally used by the "auto"(3)A member,if you are a limited liability manufacturer for the installation of company;or such equipment; (4)An executive officer or insurance manager, if (2)Removable from a permanently you are a corporation. installed housing unit as described 13.UNINTENTIONAL FAILURE TO DISCLOSE in Paragraph 2.a.above or is an HAZARDSintegral part of that equipment; or If you unintentionally fail to disclose any hazards(3)An integral part of such equipment.existing at the inception date of your policy,we c.For each covered "auto",should loss be limited will not deny coverage under this Coverage to electronic equipment only,our obligation to Form because of such failure. pay for,repair,return or replace damaged or 14.HIRED AUTO -COVERAGE TERRITORYstolenelectronicequipmentwillbereducedby Paragraph e.of GENERAL CONDITIONS 7.-the applicable deductible shown in the POLICY PERIOD,COVERAGE TERRITORY -Declarations,or $250,whichever deductible is of SECTION IV -BUSINESS AUTO less. CONDITIONS is replaced by the following:9.EXTRA EXPENSE -BROADENED e.For short-term hired "autos",the coverageCOVERAGE territory with respect to Liability Coverage isUnderParagraphA.- COVERAGE -of SECTION anywhere in the world provided that if theIII-PHYSICAL DAMAGE COVERAGE,we will "insured's"responsibility to pay damages for pay for the expense of returning a stolen covered "bodily injury"or "property damage"is "auto"to you.determined in a "suit," the "suit" is brought in 10.GLASS REPAIR -WAIVER OF DEDUCTIBLE the United States of America,the territories and possessions of the United States ofUnderParagraphD.-DEDUCTIBLE -of SECTION America,Puerto Rico or Canada or in a III -PHYSICAL DAMAGE COVERAGE,the settlement we agree to.following is added: 15.WAIVER OF SUBROGATIONNodeductibleappliestoglassdamageifthe glass is repaired rather than replaced.TRANSFER OF RIGHTS OF RECOVERY AGAINST OTHERS TO US -of SECTION IV -11.TWO OR MORE DEDUCTIBLES BUSINESS AUTO CONDITIONS is amended byUnderParagraphD.-DEDUCTIBLE -of SECTION adding the following:III -PHYSICAL DAMAGE COVERAGE,the following is added: © 2011, The Hartford (Includes copyrighted material Form HA 99 16 03 12 Page 4 of 5of ISO Properties,Inc.,with its permission.) 3AQTNSF6Page 6 of 10 We waive any right of recovery we may have c.Regardless of the number of autos deemed a against any person or organization with whom total loss,the most we will pay under this you have a written contract that requires such Hybrid,Electric,or Natural Gas Vehicle waiver because of payments we make for Payment Coverage provision for any one damages under this Coverage Form."loss"is $10,000. 16.RESULTANT MENTAL ANGUISH COVERAGE For the purposes of the coverage provision, The definition of "bodily injury"in SECTION V-a.A "non-hybrid"auto is defined as an auto that DEFINITIONS is replaced by the following:uses only an internal combustion engine to move the auto but does not include autos"Bodily injury"means bodily injury,sickness or powered solely by electricity or natural gas.disease sustained by any person,including mental anguish or death resulting from any of b.A "hybrid"auto is defined as an auto with an these.internal combustion engine and one or more electric motors;and that uses the internal17.EXTENDED CANCELLATION CONDITION combustion engine and one or more electric Paragraph 2.of the COMMON POLICY motors to move the auto,or the internal CONDITIONS -CANCELLATION -applies combustion engine to charge one or more except as follows:electric motors, which move the auto. If we cancel for any reason other than 19.VEHICLE WRAP COVERAGEnonpaymentofpremium,we will mail or deliver In the event of a total loss to an "auto"for whichtothefirstNamedInsuredwrittennoticeof Comprehensive,Specified Causes of Loss,orcancellationatleast60daysbeforetheeffective Collision coverages are provided under thisdate of cancellation. Coverage Form,then such Physical Damage18.HYBRID,ELECTRIC,OR NATURAL GAS Coverages are amended to add the following:VEHICLE PAYMENT COVERAGE In addition to the actual cash value of the "auto", In the event of a total loss to a "non-hybrid"auto we will pay up to $1,000 for vinyl vehicle wraps for which Comprehensive,Specified Causes of which are displayed on the covered "auto"at theLoss,or Collision coverages are provided under time of total loss.Regardless of the number ofthisCoverageForm,then such Physical autos deemed a total loss,the most we will pay Damage Coverages are amended as follows:under this Vehicle Wrap Coverage provision for a.If the auto is replaced with a "hybrid"auto or any one "loss"is $5,000.For purposes of this an auto powered solely by electricity or natural coverage provision,signs or other graphics gas,we will pay an additional 10%,to a painted or magnetically affixed to the vehicle are maximum of $2,500,of the "non-hybrid"auto’s not considered vehicle wraps. actual cash value or replacement cost, whichever is less, b.The auto must be replaced and a copy of a bill of sale or new lease agreement received by us within 60 calendar days of the date of "loss," © 2011, The Hartford (Includes copyrighted material Form HA 99 16 03 12 Page 5 of 5of ISO Properties,Inc.,with its permission.) 3AQTNSF6Page 7 of 10 THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. Form HS 30 06 03 17 Page 1 of 2 © 2017, The Hartford BLANKET ADDITIONAL INSURED – AS REQUIRED BY WRITTEN CONTRACT – OPTION V This endorsement modifies insurance provided under the following: COMMERCIAL GENERAL LIABILITY COVERAGE PART SECTION II — WHO IS AN INSURED,Paragraph 6. Additional Insureds When Required by Written Contract, Written Agreement or Permit, Subparagraph f. Any Other Party is deleted and replaced with the following: A.Any other person or organization who is not an additional insured under Paragraphs a.through e.above and has not been added as an additional insured by separate endorsement under this Coverage Part, but only with respect to liability for "bodily injury'', "property damage" or ''personal and advertising injury" as described in Paragraph (1),(2),or (3)below, whichever applies: (1)If the "written contract" specifically requires you to provide additional insured coverage to that person or organization by the use of the Additional Insured – Owners, Lessees or Contractors endorsement CG 20 10 11 85, or Additional Insured – Owners, Lessees or Contractors – Scheduled Person Or Organization endorsement CG 20 10 10 01, or the Additional Insured – Owners, Lessees or Contractors - Completed Operations endorsement CG 20 37 10 01, then such person or organization is an additional insured, but only with respect to liability arising out of “your work” to which the “written contract” applies; or (2)If the "written contract" specifically requires you to provide additional insured coverage to that person or organization by the use of: a.The Additional Insured — Owners, Lessees or Contractors — Scheduled Person or Organization endorsement CG 20 10 07 04 or CG 20 10 04 13, the Additional Insured — Owners, Lessees or Contractors — Completed Operations endorsement CG 20 37 07 04 or CG 20 37 04 13, or both of such endorsements with either of those edition dates; or b.Either or both of the following: the Additional Insured — Owners, Lessees or Contractors — Scheduled Person Or Organization endorsement CG 20 10, or the Additional Insured —Owners, Lessees or Contractors —Completed Operations endorsement CG 20 37, without an edition date of such endorsement specified; then such person or organization is an additional insured, but only with respect to liability caused, in whole or in part, by “your work” to which the “written contract” applies; or (3)If neither Paragraph (1)nor (2)above ap- plies, then the person or organization is an additional insured only if, and to the extent that, the injury or damage is caused by "your work" to which the "written contract" applies. B.The insurance afforded to the additional insured under this endorsement: (1)Applies only if the "bodily injury" or "property damage" occurs, or the "personal and advertising injury" offense is committed: (a)During the policy period; and (b)Subsequent to the execution of the "written contract"; and (c)Prior to the expiration of the period of time that the "written contract" requires such insurance be provided to the additional insured; and (d)Only to the extent permitted by law; and (e)Will not be broader than that which the "written contract" requires. C.The following additional exclusion applies to any person or organization that qualifies as an additional insured under this endorsement: (1)This insurance does not apply to "bodily injury", "property damage" or "personal and advertising injury" arising out of the rendering of, or the failure to render, any professional architectural, engineering or surveying services, including: Policy Number: 21UEADH3917 Policy Term: 5/1/22 to 5/1/23 3AQTNSF6Page 8 of 10 Page 2 of 2 Form HS 30 06 03 17 (a)The preparing, approving, or failing to prepare or approve maps, shop drawings, opinions, reports, surveys, field orders, change orders, designs or specifications; or (b)Supervisory, inspection, architectural or engineering activities. D. SECTION IV – COMMERCIAL GENERAL LIABLIITY CONDITIONS,Paragraph 4. Other Insurance,Paragraph b. Excess Insurance, Subparagraph (7)When You Add Others As An Additional Insured To This Insurance is deleted and replaced with the following: (7) When You Add Others As An Additional Insured To This Insurance Any other insurance available to an additional insured. However, the following provisions apply to other insurance available to any person or organization who is an additional insured under this endorsement for this Coverage Part. (a) Primary Insurance This insurance is primary if you have agreed in the "written contract" that this insurance be primary. If other insurance is also primary, we will share with all that other insurance by the method described in Paragraph (c)below. This insurance does not apply to other insurance to which the additional insured has been added as an additional insured. (b) Primary And Non-Contributory To Other Insurance This insurance is primary to and will not seek contribution from any other insurance available to an additional insured under your policy provided that: (i)The additional insured under this endorsement is a Named Insured under such other insurance; and (ii)You have agreed in the "written contract" that this insurance would be primary and would not seek contribution from any other insurance available to such additional insured. (c) Method of Sharing If all of the other insurance permits contribution by equal shares, we will follow this method also. Under this approach, each insurer contributes equal amounts until it has paid its applicable limit of insurance or none of the loss remains, whichever comes first. If any of the other insurance does not permit contribution by equal shares, we will contribute by limits. Under this method, each insurer's share is based on the ratio of its applicable limit of insurance to the total applicable limits of insurance of all insurers. E.With respect to insurance provided to the person or organization that is an additional insured under this endorsement,SECTION IV – COMMERCIAL GENERAL LIABILITY CONDITIONS,Paragraph 2. Duties In The Event Of Occurrence, Offense, Claim or Suit is amended to include the following: The additional insured must tender the defense and indemnity of any claim or “suit” to any other insurer or self-insurer whose policy or program applies to a loss we cover under this endorsement. However, if the "written contract" requires this insurance to be primary and non- contributory, then this provision does not apply to insurance to which the additional insured is the Named Insured. F.The insurance provided to the additional insured does not apply to “bodily injury”, “property damage” or “personal and advertising injury” included in the “products-completed operations hazard”, unless the “written contract” specifically requires such coverage be provided for the additional insured. If additional insured coverage during the “products-completed operation hazard” is required by the “written contract”, then such coverage will be provided for either: (1)The number of years as required by the “written contract”, but in no event greater than the applicable state’s statute of repose; or (2)If the “written contract” is silent on the number of years required for “products- completed operations coverage”, then such coverage will be provided for 2 years from the date this policy expires, cancels or terminates. G.Only for the purpose of this endorsement, “written contract” means a written contract or written agreement that requires you to include a person or organization as an additional insured on this Coverage Part, provided that: a.The “bodily injury”, “property damage” or “personal advertising injury” is caused by an “occurrence” or offense during the policy period; and b.The “written contract” was executed prior to the inception of the policy period and in effect during such “bodily injury”, “property damage” or “personal advertising injury”. All other terms and conditions in the policy remain unchanged. 3AQTNSF6Page 9 of 10 1exasMutuaI® WORKERS' COMPENSATION INSURANCE WORKERS' CO MPENSATION AND EMPLOYERS LIABILI TY POLICY WC 42 03 04 B Insured copy TEXAS WAIVER OF OUR RIGHT TO RECOVER FROM OTHERS ENDORSEMENT This endorsement applies only to the insurance provided by the policy because Te xas is shown in item 3.A. of the Information Page. We have the right to recover our payments from anyone liable for an injury covered by this policy. We will not enforce our right against the person or organization named in the Schedule, but this waiver applies only with respect to bodily injury arising out of the operations described in the schedule where you are required by a written contract to obtain this waiver from us. This endorsement shall not operate directly or indirectly to benefit anyone not named in the Schedule. The premium for this endorsement is shown in the Schedule. 1.( ) Specific Waiver Name of person or organization (X)Blanket Waiver Schedule Any person or organization for whom the Named Insured has agreed by written contract to furnish this waiver. 2. Operations:All Te xas operations 3.Premium: The premium charge for this endorsement shall be 2.00 percent of the premium developed on payroll in connection with work performed for the above person(s) or organization(s) arising out of the operations described. 4. Advance Premium: Included, see Information Page This endorsement changes the policy to which it is attached effective on the inception date of the policy unless a different date is indicated below. (The following "attaching clause" need be completed only when this endorsement is issued subsequent to preparation of the policy.) This endorsement, effective on 5/1/22 at 12:01 a.m. standard time, forms a part of: Policy no. 0002014140 of Texas Mutual Insurance Company effective on 5/1/22 Issued to: OSBURN CONTRACTORS LLC NCCI Carrier Code: 29939 1 of 1 This is not a bill PO Box 12058, Austin, TX 78711-2058 texasmutual.com I (800) 859-5995 I Fax (800) 359-0650 Authorized representative 5/4/22 WC 42 03 04 B 3AQTNSF6Page 10 of 10 26th April 22 \�>►1 {�{i itE'i'(IKF, tt�eeon�i�tic�n n�ihs nhf��ter�n � such!i:a: rfl'r�ci, alshali .,. _ • . .�• ,. . •, . � �::ch '�r�.clv �nt•cc •,� :s; ; r: �tic�. �:►� t'; y t�.� .:. ��� .;�:r'. . • •,r!f•�;l�!;��i. ;�:CI . .':C;.:iIESt��'�S�AIIi��S��j;:}JCC�1T:.�,kiSL'..a..�'CT'p�.AiiiCi'%:SC�� f�:�".dC:i:'. • i'..1 f..�f. r df�� cr'e.' 1'I�� 1� 1 E3F]'f, Flflt� fti'�.F2, �'�:riripsi shal! :ar! su :�, repa�r ar recor.ct-uc: ar�� :u-:el�: . .. '., _ .. > .. ._ .... 's.: (: r,�J•. . ;�..sc as:v s�:�! 3?4 c.:c h .:e°r, :�r'.=. -�. •��. '+ �'c TC�a+rc.l ,v.^.�•,,r re.isr.ssr.���r � ti. �,}� all aas .�. ia•ed �os:, thrrc f hrmg hnrnr hv �hr :'ru:� orai sn.1 '�r �:i-er. ..-t�3cr �I�.is 1�T•��^trrar.ce hn:l.i. ar.d F'Kt�� Il1F:i) F[ kIN}'l� •t��a: Ef a^,v IeKa� ac��ar ftr fwcd ar.tn�s Ei�n�i. �cn,�c��a:�;tc ;ca � , . . � � .�. . .. �.e , ��.�:e� 1)+S�rsc' t'.� dF[ fCf •hc �iar.hcrr. U�x:r�;� o' + �r.as. E��� }.: ll'i�r�'),tic�� r. a.r;,' F'Kci11iJI11 iZ Ft1NFk, ;ra;•h��ah�E�rar�u^ �Fall�eior�in�o.�s:r,na'�.rca.;r! , , . . . .. ... .. � , h t. �,crc,,, f��: ,.�e.:�:.n�r ��r�a. ..r� � t, �. • -��� . x x•.,� , !,- 26th April 26th April22 IMPORTANT NOTICE TQ ALL TEXAS POLICYHOLDERS IMPORTANT NOTICE AVISO IMPORTANTE To obtain information or make a camplaint Para obtener informacion o para someter una queja: You rr�ay call Arch fnsurance Group's toll-free tefepl�one numE�er for fnformatron or to make a complai�t at: 7-86fi-413-5550 You may also write to Arch Insurance Group at Arch Insurance Group Harborside 3 210 Hudson Street, Suite 304 Jersey City, !�J 0731'�-11Q7 You may contact thE Texas Department of Insurance to obtain fnformation on companies, coverages, rights or complaints at: 1-800-252-3439 You may wrfte the Texas Department of Insurance: �.0. Box 149091 Austin, TX 78714-9091 Fax: (512} 490-1007 Web: http:l/www.tdi.#exas.gov E-mai€: ConsumerPratection@tdi.texas.go� PREMIUM OR CLAIM DISPUTES: 5hould you ha�e a dispute cancerning your premium or a�out a claim you shauld contact the Arch lnsurance Group first. If the dispute is not resolved, you may contact the Texas Department of Insurance. ATiACH THIS NOTfCE TO YOUR POLICY: This notice is for informatian only and does not become a part ar condition of the attached document. Usted pUede Ilamar al numero de telefono gratis de Arch Insurance Group para informacron o para sqmeter una queja al: 1-866-413-5550 Usted tambien puede escribir a Arch Insurance Group: Arch Insurance Group Harborside 3 21Q Hudson Street, 5uite 300 Jersey City, NJ 07311-1107 Pued� comunicarse con el Departamento de Seguros de Texas para obtener informacian acerca de companias. coberturas, d�rechos o quejas al: 1-8Q0-252-3439 Puede escribir al Departamento de 5eguros de Texas: P.O. Box 149091 Austin, TX 787i4-9091 Fax: (512) 490-1 Q07 Web: http:l/www.ttli.texas.go� E-mail: ConsumerProtectian@tdi.texas.go� DISPUTAS SOBRE PRIMAS 0 REC�AMOS: Si tiene una disputa concerniente a su prima o a un reclamo, debe comunicarse con el Arch Insurance Group primero. Si no se resuelve la disputa, puede entonces comunicarse con el departarrsento (TDI). UNA ESTE AVISO A SU POLIZA: Este aviso es sola para proposito de informacian y no se convierte en parte o condicion del c�ocumento adjunto. p0 ML.0042 44 04 16 Page 1 of 1 LIGHTING SECTIO� 00 42 43 Developer Awarded Projccis - PROPOS�L PORM Tezas Industries Addition No. 3 Lot 3. Block 3 Cin• Projeci =103784 UNIT PRICE BID Project Item InFonnation Bidlist Speciticalion Unit ol' Bid Item Descripiion Seciion No. Mcasure Unil Price Bid Value Quantih� Street Li ht Facilities 36 344�.1637 Light Pole Assembly - Type 1 � Pole, Single 33A Artn, ATBO LED Luminaire 37 2605.3015 2" CONDUIT PVC SCH 80 T 38 3441.1405 #2 XHHW CONDR 39 3441.1501 Ground Box T e 8 40 2605.3014 2" CONDT RM (Riser) 41 3441.1772 Furnish/Install 240-480 Volt Sin le Phase Metered Pedestal Street Light Facilities Subtotal BId Summa Street Liqht Facilities S This bid is submitted by the entity listed below: Company: 9ean Electrical, Inc Slreet Address: 821 E Enon City, State, Zip Code: Everman, Texas 76140 Phone: 817 561 7400 Grend Total 34 41 20 EA 6 26 O5 33 LF 997 34 41 20 LF 2,99� 34 41 20 EA 2 26 OS 33 LF 20 34 41 20 EA 1 n � By: Roy B "n II / j' , / �./ ` Signature 57,333.41 $26.25 $7.69 51, 606.25 $150.00 10.625.00 Tille: Presidenl Date: 3/3/2022 Contraclor ngrecs �o complele ��'OR6 for FI\AL ACCEPT.4NC6 within 12 Q xorking dnys xf�er Ihe dnle when ihe CON'PRA(T commmces Io rnn as prorided in Ihe Ceneral Conditions. E�D OF SECI'ION $44,000.46 $26.171.25 $23,000.79 $3, 212.50 $3.000.00 $110 i�n'vurr�nri �cnn�m Ilul.�i Iniia.l`h.�r.'' .1'I'ANI)�\lil l C'� �N117114"Il(/N 1111J I`Iltll'l 1�A1: Ill(V I�:I.t �I`I�:li .1ti.\Illll�:l) I�ILt IJI'L'I % Cm IT��.ci �I! ::I �: I�onn li.•�ia�J J�num "1.'I��u ' .)J_ai IliJl'n.R..�l 04/22/2022 00 45 26 - 1 CONTRACTOR COMPLIANCL WITH WORKER'S COMPENSATION LAW Page 1 of 1 SECTION 00 45 26 CONTRACTOR COMPLIANCE WITH WORKER'S COMPENSATION LAW Pursuant to Texas Labor Code Section 406.096(a), as amended, Contractor certifies that it provides worker's compensation insurance coverage for all of its employees employed on City Project No. 103784 . Contractor further certifies that, pursuant to Te;cas Labor Code, Section 406.096(b), as amended, it will provide to City its subcontractor's certificates of compliance with worker's compensation coverage. CONTRACTOR: Bean Electrical. Inc. Company 82l E. Enon Address By: Ro ean II f' Signature: %� Everman. TX 76140 City/State/Zip THE STATE OF TEXAS COUNTY OF /` �'i�� § Title: President �.�``av���., JAMES MICHAEL HUGHES ���.....a�. :?;' ��Notary Public, State of Texas �-�:�•'Q� Comm. Expires 10-26-2022 ,�,�;...•�;� ���,°;,,��� Notary ID 131774249 BEFORE ME, the undersigned authority, on this day personally appeared Rov E. Bean, II, known to me to be the person whose name is subscribed to the foregoing instrument, and acknowledged to me that he/she executed the same as the act and deed of Bean Electrical, Inc. for the purposes and consideration therein expressed and in the capacity therein stated. GIVEN UNDER MY HAND AND SEAL OF OFFICE this � day of ,i'� / I 2022. END OF SECT: CITY OF FORT WORTH Texas Industries Addition No 3, Lot Z Block 2 STANDARD CONSTRUCTION SP�CIFICATION DOCUMGNTS City Project #103784 Revised April 2, 2014 April 26, 2022 005243-2 Developer Awarded Project Agreement Page 2 of 4 Article 4. CONTRACT PRICE Developer agrees to pay Contractor for performance of the Work in accordance with the Contract Documents an amount in current funds of One Iiundred Ten Thousand Ten & 00/100 Dollars ($110,010.001 Article 5. CONTRACT DOCUMENTS 5.1 CONTENTS: A. The Contract Documents which comprise the entite agreement between Developer and Contractor concerning the Work consist of the following: l. This Agreement, 2. Attachments to this Agreement: a. Bid Form (As provided by Developer) 1) Proposal Form (DAP Version) 2) Prequalification Statement 3) State and Fedsral documents (project specific) b. Insurance ACORD Form(s) c. Payment Bond (DAP Version) d. Performance Bond (DAP Version) e. Maintenance Bond (DAP Version) f. Power of Attorney for the Bonds g. Worker's Compensation Affidavit h. MBE and/or SBE Commitment Form (If required) 3. Standard City General Conditions of the Construction Contract for Developer Awarded Projects. 4. Supplementary Conditions. 5. Specifications specifically made a part of the Contract Documents by attachment or, if not attached, as incorporated by reference and described in the Table of Contents of the Project's Gontract Documents. 6. Drawings. 7. Addenda. 8. Documentation submitted by Contractor prior to Notice of Award. 9. The following which may be delivered or issued after the Effective Date of the Agreement and, if issued, become an incorporated part of the Contract Documents: a. Notice to Proceed. b. Field Orders. a Change Orders. d. Letter of Final Acceptance. CITY OF FORT WORTH Texas IndusMes Addition No 3, Lot 2 Block 2 STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS —DAP City Project # 103784 Revised June 16, 2016 005243-3 Develope� Awarded:Project Agreement Page 3 of 4 Article 6. IlYDEMNIFI�ATION 6.1 Contractor covenants and agrees to indemnify, hold harmless and defend, at its own expense, the city, its officers, servants and employees, from and against any and all claims arising out of, or alleged to arise out af, the work and services to be perfo"med by the contractar, its officers, agents, employees, subcontractors, licenses or invitees under this contract. This 'indemni�ication nrovision .is sqecificallv intended to oaerate and be effective even if it is alleged or aroven that a1L or some of the damages beins southt were caused, in whole or in aart. bv anv act. omission or ne�ligenee of the citv. This indemnity provision is intended to include, without limitatian, indemnity for costs, expenses and legal fees incurred by the city in defending againsY sueh claims and causes ofactions. b.2 Contractor covenants and agrees to indemnify and hold harmless, at its own expense, the city, its officers, servants and employees, from and against any and all loss, damage or destruction of property of the city, arising out of, or alleged' to arise out of, the work and services to be performed by the contractor, its ofticers, agents, employees, subcontractors, licensees or invitees under this contract. This indemnification nrovision is specificallv intended to operate and be effective even if it is alleged or proven that al! or some of fhe dama¢es beinS sought were caused, in whole or in part, bv anv act, omission or neEli�ence of the citv. Article 7. MiSCELLANEOUS 7.1 Terms. Terms used in this Agreement are defined in Article 1 of tl�e Standard City Conditions of the Construction Gontraei for Developer Awarded Projects. 7.2 Assignment of Contract. This Agreement, including all of the Contract Documents may not be assigned by the Contractor without the advanced express written consent of the Developer. 7'.3 Successors and Assigns: Developer and Contraetor eacl� binds itself, its partners, successors, assigns and legal representatives to the other party hereto, in respect to all covenants, agreements and obligations contained in the Contract Documents. 7".4 Severability. Any provision or part of the Contract Documents held to be unconstitutional, void or unenforceable by a court of competent jurisdiction shall be deemed stricken, and all remaining provisions sfiall continue to be valid and binding upon DEVELOPER and CONTRACTOR. 7.5 Governing Law and Venue. This Agreemenf, including all of the Contract Documents is performable in the State of Texas. Venue shail be Tarrant County, Texas, or the United States District Court for the Northern District of Te�cas, Fort Worth Division. CITY OF FORT WORTH Texas Industries Addition No 3, Lot 2 Biock 3 STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS —DAP City Projecf #10378A Revised June 16, 2016 04/26/202204/22/2022 POLICY NUMBER: COMMERCIAL GENERAL LIABILITY CG 20 10 12 19 THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. CG 20 10 12 19 © Insurance Services Office, Inc., 2018 Page 1 of 2 ADDITIONAL INSURED – OWNERS, LESSEES OR CONTRACTORS – SCHEDULED PERSON OR ORGANIZATION This endorsement modifies insurance provided under the following: COMMERCIAL GENERAL LIABILITY COVERAGE PART SCHEDULE Name Of Additional Insured Person(s) Or Organization(s) Location(s) Of Covered Operations Information required to complete this Schedule, if not shown above, will be shown in the Declarations. A. Section II – Who Is An Insured is amended to include as an additional insured the person(s) or organization(s) shown in the Schedule, but only with respect to liability for "bodily injury", "property damage" or "personal and advertising injury" caused, in whole or in part, by: 1.Your acts or omissions; or 2.The acts or omissions of those acting on your behalf; in the performance of your ongoing operations for the additional insured(s) at the location(s) designated above. However: 1.The insurance afforded to such additional insured only applies to the extent permitted by law; and 2.If coverage provided to the additional insured is required by a contract or agreement, the insurance afforded to such additional insured will not be broader than that which you are required by the contract or agreement to provide for such additional insured. B.With respect to the insurance afforded to these additional insureds, the following additional exclusions apply: This insurance does not apply to "bodily injury" or "property damage" occurring after: 1.All work, including materials, parts or equipment furnished in connection with such work, on the project (other than service, maintenance or repairs) to be performed by or on behalf of the additional insured(s) at the location of the covered operations has been completed; or 2.That portion of "your work" out of which the injury or damage arises has been put to its intended use by any person or organization other than another contractor or subcontractor engaged in performing operations for a principal as a part of the same project. TB2-Z91-471905-021 Blanket as required by written contract or agreement All Locations Page 2 of 2 © Insurance Services Office, Inc., 2018 CG 20 10 12 19 C.With respect to the insurance afforded to these additional insureds, the following is added to Section III – Limits Of Insurance: If coverage provided to the additional insured is required by a contract or agreement, the most we will pay on behalf of the additional insured is the amount of insurance: 1.Required by the contract or agreement; or 2.Available under the applicable limits of insurance; whichever is less. This endorsement shall not increase the applicable limits of insurance. POLICY NUMBER: COMMERCIAL GENERAL LIABILITY CG 20 37 12 19 THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. CG 20 37 12 19 © Insurance Services Office, Inc., 2018 Page 1 of 1 ADDITIONAL INSURED – OWNERS, LESSEES OR CONTRACTORS – COMPLETED OPERATIONS This endorsement modifies insurance provided under the following: COMMERCIAL GENERAL LIABILITY COVERAGE PART PRODUCTS/COMPLETED OPERATIONS LIABILITY COVERAGE PART SCHEDULE Name Of Additional Insured Person(s) Or Organization(s) Location And Description Of Completed Operations Information required to complete this Schedule, if not shown above, will be shown in the Declarations. A. Section II – Who Is An Insured is amended to include as an additional insured the person(s) or organization(s) shown in the Schedule, but only with respect to liability for "bodily injury" or "property damage" caused, in whole or in part, by "your work" at the location designated and described in the Schedule of this endorsement performed for that additional insured and included in the "products-completed operations hazard". However: 1.The insurance afforded to such additional insured only applies to the extent permitted by law; and 2.If coverage provided to the additional insured is required by a contract or agreement, the insurance afforded to such additional insured will not be broader than that which you are required by the contract or agreement to provide for such additional insured. B.With respect to the insurance afforded to these additional insureds, the following is added to Section III – Limits Of Insurance: If coverage provided to the additional insured is required by a contract or agreement, the most we will pay on behalf of the additional insured is the amount of insurance: 1.Required by the contract or agreement; or 2.Available under the applicable limits of insurance; whichever is less. This endorsement shall not increase the applicable limits of insurance. TB2-Z91-471905-021 Blanket as required by written contract or agreement All locations LC 20 8 11 18 © 2018 Liberty Mutual Insurance Page 1 of 4 Includes copyrighted material of Insurance Services Office, Inc., with its permission. Policy Number Issued by THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. COMMERCIAL GENERAL LIABILITY ADDITIONAL INSURED ENHANCEMENT FOR CONTRACTORS This endorsement modifies insurance provided under the following: COMMERCIAL GENERAL LIABILITY COVERAGE PART Index of modified items: Item 1. B an et Additiona Insured here Re uired B ritten Agreement Lessors of Leased Equipment Managers or Lessors of Premises Mortgagees, Assignees or Receivers Owners, Lessees or Contractors Architects, Engineers or Surveyors Any Person or Organization Item 2. B an et Additiona Insured – Grantor Of Permits Item 3. Other Insurance Amendment Item 1. B an et Additiona Insured here Re uired B ritten Agreement Paragraph 2.of Section II – ho Is An Insured is amended to add the following: Additiona Insured B ritten Agreement The following are insureds under the Policy when you have agreed in a written agreement to provide them coverage as additional insureds under your policy: 1. Lessors of Leased E ui ment The person(s) or organization(s) from whom you lease equipment, but only with respect to liability for "bodily injury", "property damage" or "personal and advertising injury" caused, in whole or in part, by your maintenance, operation or use of equipment leased to you by such person(s) or organization(s). This insurance does not apply to any "occurrence" which takes place after the equipment lease expires. 2. Managers or Lessors of Premises Any manager(s) or lessor(s) of premises leased to you in which the written lease agreement obligates you to procure additional insured coverage. The coverage afforded to the additional insured is limited to liability in connection with the ownership, maintenance or use of the premises leased to you and caused, in whole or in part, by some negligent act(s) or omission(s) of you, your "employees", your agents or your subcontractors. There is no coverage for the additional insured for liability arising out of the sole negligence of the additional insured or those acting on behalf of the additional insured, except as provided below. If the written agreement obligates you to procure additional insured coverage for the additional insured's sole negligence, then the coverage for the additional insured shall conform to the agreement, but only if the applicable law would allow you to indemnify the additional insured for liability arising out of the additional insured's sole negligence. TB2-Z91-471905-021 LC 20 8 11 18 © 2018 Liberty Mutual Insurance Page 2 of 4 Includes copyrighted material of Insurance Services Office, Inc., with its permission. This insurance does not apply to: a.Any "occurrence" which takes place after you cease to be a tenant in that premises or to lease that land; b.Structural alterations, new construction or demolition operations performed by or on behalf of that manager or lessor; or c.Any premises for which coverage is excluded by endorsement. 3. Mortgagees Assignees or Receivers Any person(s) or organization(s) with respect to their liability as mortgagee, assignee or receiver and arising out of your ownership, maintenance or use of the premises. This insurance does not apply to structural alterations, new construction and demolition operations performed by or on behalf of such person(s) or organization(s). . O ners Lessees or Contractors Any person(s) or organization(s) to whom you are obligated to procure additional insured coverage, but only with respect to liability for "bodily injury", "property damage" or "personal and advertising injury" caused, in whole or in part, by your act(s) or omission(s) or the act(s) or omission(s) of your "employees", your agents, or your subcontractors, in the performance of your ongoing operations. This insurance does not apply to "bodily injury", "property damage", or "personal and advertising injury" arising out of "your work" included in the "products-completed operations hazard" unless you are required to provide such coverage for the additional insured by the written agreement, and then only for the period of time required by the written agreement and only for liability caused, in whole or in part, by your act(s) or omission(s) or the act(s) or omission(s) of your "employees", your agents, or your subcontractors. There is no coverage for the additional insured for liability arising out of the sole negligence of the additional insured or those acting on behalf of the additional insured, except as provided below. If the written agreement obligates you to procure additional insured coverage for the additional insured's sole negligence, then the coverage for the additional insured shall conform to the agreement, but only if the applicable law would allow you to indemnify the additional insured for liability arising out the additional insured's sole negligence. This insurance does not apply to "bodily injury", "property damage" or "personal and advertising injury" arising out of the rendering of, or failure to render, any professional architectural, engineering or surveying services, including: a.The preparing, approving, or failing to prepare or approve, maps, shop drawings, opinions, reports, surveys, field orders, change orders or drawings and specifications; or b.Supervisory, inspection, architectural or engineering activities. This exclusion applies even if the claims against any insured allege negligence or other wrongdoing in the supervision, hiring, employment, training or monitoring of others by that insured, if the "occurrence" which caused the "bodily injury" or "property damage", or the offense which caused the "personal and advertising injury", involved the rendering of or failure to render any professional services. . Architects Engineers or Surve ors Any architect, engineer, or surveyor engaged by you but only with respect to liability for "bodily injury", "property damage" or "personal and advertising injury" caused, in whole or in part, by your act(s) or omission(s) or the act(s) or omission(s) of those acting on your behalf: a.In connection with your premises; or b.In the performance of your ongoing operations. This insurance does not apply to "bodily injury", "property damage" or "personal and advertising injury" arising out of the rendering of or failure to render any professional services by or for you, including: LC 20 8 11 18 © 2018 Liberty Mutual Insurance Page 3 of 4 Includes copyrighted material of Insurance Services Office, Inc., with its permission. a.The preparing, approving, or failing to prepare or approve, maps, shop drawings, opinions, reports, surveys, field orders, change orders or drawings and specifications; or b.Supervisory, inspection, architectural or engineering activities. This exclusion applies even if the claims against any insured allege negligence or other wrongdoing in the supervision, hiring, employment, training or monitoring of others by that insured, if the "occurrence" which caused the "bodily injury" or "property damage", or the offense which caused the "personal and advertising injury", involved the rendering of or failure to render any professional services by or for you. . An Person or Organi ation Other Than a oint enture Any person(s) or organization(s) (other than a joint venture of which you are a member) for whom you are obligated to procure additional insured coverage, but only with respect to liability for "bodily injury", "property damage" or "personal and advertising injury" caused, in whole or in part, by your act(s) or omission(s) or the act(s) or omission(s) of those acting on your behalf: a.In the performance of your ongoing operations; or b.In connection with premises owned by or rented to you. This insurance does not apply to: a.Any person(s) or organization(s) more specifically covered in Paragraphs 1.through .above; b.Any construction, renovation, demolition or installation operations performed by or on behalf of you, or those operating on your behalf; or c.Any person(s) or organization(s) whose profession, business or occupation is that of an architect, surveyor or engineer with respect to liability arising out of the rendering of, or failure to render, any professional architectural, engineering or surveying services, including: (1)The preparing, approving or failing to prepare or approve, maps, drawings, opinions, reports, surveys, field orders, change orders, designs and specifications; or (2)Supervisory, inspection, architectural or engineering activities. This exclusion applies even if the claims against any insured allege negligence or other wrongdoing in the supervision, hiring, employment, training or monitoring of others by that insured, if the "occurrence" which caused the "bodily injury" or "property damage", or the offense which caused the "personal and advertising injury", involved the rendering of or failure to render any professional services by or on behalf of you, or those operating on your behalf. The insurance afforded to any person(s) or organization(s) as an insured under this Item 1. 1.Applies to the extent permitted by law; 2.Applies only to the scope of coverage and the minimum limits of insurance required by the written agreement, but in no event exceeds either the scope of coverage or the limits of insurance provided by this Policy; 3.Does not apply to any person(s) or organization(s) for any "bodily injury", "property damage" or "personal and advertising injury" if any other additional insured endorsement attached to this Policy applies to such person(s) or organization(s) with regard to the "bodily injury", "property damage" or "personal and advertising injury"; .Applies only if the "bodily injury" or "property damage" occurs, or the offense giving rise to the "personal and advertising injury" is committed, subsequent to the execution of the written agreement; and .Applies only if the written agreement is in effect at the time the "bodily injury" or "property damage" occurs, or at the time the offense giving rise to the "personal and advertising injury" is committed. LC 20 8 11 18 © 2018 Liberty Mutual Insurance Page 4 of 4 Includes copyrighted material of Insurance Services Office, Inc., with its permission. Item 2. B an et Additiona Insured – Grantor Of Permits Paragraph 2.of Section II – ho Is An Insured is amended to add the following: Any state, municipality or political subdivision that has issued you a permit in connection with any operations performed by you or on your behalf, or in connection with premises you own, rent or control, and to which this insurance applies, but only to the extent that you are required to provide additional insured status to the state, municipality or political subdivision as a condition of receiving and maintaining the permit. Such state, municipality or political subdivision that has issued you a permit is an insured only with respect to their liability as grantor of such permit to you. However, with respect to the state, municipality or political subdivision: 1.Coverage will be no broader than required; and 2.Limits of insurance will not exceed the minimum limits of insurance required as a condition for receiving or maintaining the permit; but neither the scope of coverage nor the limits of insurance will exceed those provided by this Policy. This insurance does not apply to: 1."Bodily injury", "property damage" or "personal and advertising injury" arising out of operations performed for the state, municipality or political subdivision; 2.Any "bodily injury" or "property damage" included within the "products-completed operations hazard", except when required by written agreement initiated prior to loss; or 3."Bodily injury", "property damage" or "personal and advertising injury", unless negligently caused, in whole or in part, by you or those acting on your behalf. Item 3. Other Insurance Amendment If you are obligated under a written agreement to provide liability insurance on a primary, excess, contingent, or any other basis for any person(s) or organization(s) that qualifies as an additional insured on this Policy, this Policy will apply solely on the basis required by such written agreement and Paragraph . Other Insurance of Section I – Commercia Genera Liabi it Conditions will not apply. Where the applicable written agreement does not specify on what basis the liability insurance will apply, the provisions of Paragraph . Other Insurance of Section I – Commercia Genera Liabi it Conditions will apply. However, this insurance is excess over any other insurance available to the additional insured for which it is also covered as an additional insured for the same "occurrence", claim or "suit". LC 32 1 11 18 © 2018 Liberty Mutual Insurance Page 1 of 5 Includes copyrighted material of Insurance Services Office, Inc., with its permission. Policy Number Issued by THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. COMMERCIAL GENERAL LIABILITY ENHANCEMENT FOR CONTRACTORS This endorsement modifies insurance provided under the following: COMMERCIAL GENERAL LIABILITY COVERAGE PART Index of modified items: Item 1. Reasonab e Force Item 2. Non O ned atercraft E tension Item 3.Damage To Premises Rented To You – E anded Coverage Item .Bodi In ur To Co Em o ees Item . Hea th Care Professiona s As Insureds Item . no edge Of Occurrence Or Offense Item 7. Notice Of Occurrence Or Offense Item 8. Unintentiona Fai ure To Disc ose Item . Bodi In ur Redefined Item 10. Su ementar Pa ments – Increased Limits Item 11. Pro ert In Your Care Custod Or Contro Item 12. Mobi e E ui ment Redefined Item 13. Ne Formed Or Ac uired Entities Item 1 . aiver Of Right Of Recover B ritten Contract Or Agreement Item 1. Reasonab e Force Exclusion a.of Section I – Coverage A – Bodi In ur And Pro ert Damage Liabi it is replaced by the following: a. E ected Or Intended In ur "Bodily injury" or "property damage" expected or intended from the standpoint of the insured. This exclusion does not apply to "bodily injury" or "property damage" resulting from the use of reasonable force to protect persons or property. Item 2. Non O ned atercraft E tension Paragraph (2)of Exclusion g.of Section I – Coverage A – Bodi In ur And Pro ert Damage Liabi it is replaced by the following: (2)A watercraft you do not own that is: (a)Less than 55 feet long; and (b)Not being used to carry persons or property for a charge; Item 3. Damage To Premises Rented To You – E anded Coverage A.The final paragraph of 2. E c usions of Section I – Coverage A – Bodi In ur And Pro ert Damage Liabi it is replaced by the following: TB2-Z91-471905-021 LC 32 1 11 18 © 2018 Liberty Mutual Insurance Page 2 of 5 Includes copyrighted material of Insurance Services Office, Inc., with its permission. Exclusions c. through n.do not apply to damage by fire, lightning or explosion or subsequent damages resulting from such fire, lightning or explosion including water damage to premises while rented to you or temporarily occupied by you with permission of the owner. A separate limit of insurance applies to this coverage as described in Section III – Limits Of Insurance. B.Paragraph .of Section III – Limits Of Insurance is replaced by the following: .Subject to Paragraph .above, the Damage To Premises Rented To You Limit is the most we will pay under Coverage A for damages because of "property damage" to any one premises, while rented to you, or in the case of damage by fire, lightning, explosion or subsequent damages resulting from such fire, lightning or explosion including water damage to premises while rented to you or temporarily occupied by you with permission of the owner. The Damage To Premises Rented To You Limit is the greater of: a.$300,000; or b.The Damage To Premises Rented To You Limit shown on the Declarations. C.Paragraph .a.of the definition of "insured contract" in Section – Definitions is replaced by the following: a.A contract for a lease of premises. However, that portion of the contract for a lease of premises that indemnifies any person or organization for damage by fire, lightning, explosion or subsequent damages resulting from such fire, lightning or explosion including water damage to premises while rented to you or temporarily occupied by you with permission of the owner is not an "insured contract"; D.The paragraph immediately following Paragraph ()of Exclusion .of Section I – Coverage A – Bodi In ur And Pro ert Damage Liabi it is replaced by the following: Paragraphs (1),(3)and ()of this exclusion do not apply to "property damage" (other than damage by fire, lightning or explosion or subsequent damages resulting from such fire, lightning or explosion including water damage) to premises, including the contents of such premises, rented to you for a period of seven or fewer consecutive days. A separate limit of insurance applies to Damage To Premises Rented To You as described in Section III – Limits of Insurance. Item . Bodi In ur To Co Em o ees A.Paragraph 2.of Section II – ho Is An Insured is amended to include: Each of the following is also an insured: Your "employees" (other than either your "executive officers" (if you are an organization other than a partnership, joint venture or limited liability company) or your managers (if you are a limited liability company)) or "volunteer workers" are insureds while in the course of their employment or while performing duties related to the conduct of your business with respect to "bodily injury": (1)To you; (2)To your partners or members (if you are a partnership or joint venture); (3)To your members (if you are a limited liability company); or ()To a co-"employee" or "volunteer worker" while that co-"employee" or "volunteer worker" is either in the course of his or her employment by you or while performing duties related to the conduct of your business (including participation in any recreational activities sponsored by you). Paragraph 2.a.(1)(a)of Section II – ho Is An Insured does not apply to "bodily injury" for which insurance is provided by this paragraph. LC 32 1 11 18 © 2018 Liberty Mutual Insurance Page 3 of 5 Includes copyrighted material of Insurance Services Office, Inc., with its permission. B.The insurance provided by this Item .for "bodily injury" to a co-"employee" or "volunteer worker" will not apply if the injured co-"employee's" or "volunteer worker's" sole remedy for such injury is provided under a workers' compensation law or any similar law. C. Other Insurance The insurance provided by this Item .is excess over any other valid and collectible insurance available to the insured, whether primary, excess, contingent or on any other basis. Item . Hea th Care Professiona s As Insureds A.Paragraph 2.a.(1)(d)of Section II – ho Is An Insured is replaced by the following: (d)Arising out of his or her providing or failure to provide professional health care services. However, any "employee" or "volunteer worker" of the Named Insured who is acting as a Good Samaritan in response to a public or medical emergency or who is a "designated health care provider" is an insured with respect to "bodily injury" and "personal and advertising injury" that: (i)Arises out of the providing of or failure to provide professional health care services; and (ii)Occurs in the course of and within the scope of such "employee's" or "volunteer worker's" employment by the Named Insured. B.With respect to "employees" and "volunteer workers" providing professional health care services, the following exclusions are added to Paragraph 2. E c usions of Section I – Coverage A – Bodi In ur And Pro ert Damage Liabi it and Paragraph 2. E c usions of Section I – Coverage B – Persona And Advertising In ur Liabi it This insurance does not apply to: (1)Liability assumed under an "insured contract" or any other contract or agreement; (2)Liability arising out of the providing of professional health care services in violation of law; (3)Liability arising out of the providing of any professional health care services while in any degree under the influence of intoxicants or narcotics; ()Liability arising out of any dishonest, fraudulent, malicious or knowingly wrongful act or failure to act; or ()Punitive or exemplary damages, fines or penalties. C.The following definition is added to Section – Definitions: "Designated health care provider" means any "employee" or "volunteer worker" of the Named Insured whose duties include providing professional health care services, including but not limited to doctors, nurses, emergency medical technicians or designated first aid personnel. D. Other Insurance The insurance provided by this Item .is excess over any other valid and collectible insurance available to the insured, whether primary, excess, contingent or on any other basis. Item . no edge Of Occurrence Or Offense Knowledge of an "occurrence" or offense by your agent, servant or "employee" will not in itself constitute knowledge by you unless your "executive officer" or "employee" designated by you to notify us of an "occurrence" or offense has knowledge of the "occurrence" or offense. LC 32 1 11 18 © 2018 Liberty Mutual Insurance Page 4 of 5 Includes copyrighted material of Insurance Services Office, Inc., with its permission. Item 7. Notice Of Occurrence Or Offense For purposes of Paragraph 2.a.of Section I – Commercia Genera Liabi it Conditions, you refers to your "executive officer" or "employee" that you have designated to give us notice. Item 8. Unintentiona Fai ure To Disc ose Unintentional failure of the Named Insured to disclose all hazards existing at the inception of this Policy shall not be a basis for denial of any coverage afforded by this Policy. However, you must report such an error or omission to us as soon as practicable after its discovery. This provision does not affect our right to collect additional premium or exercise our right of cancellation or non- renewal. Item .Bodi In ur Redefined The definition of "bodily injury" in Section – Definitions is replaced by the following: "Bodily injury" means: a.Bodily injury, sickness or disease sustained by a person, including death resulting from any of these at any time; and b.Mental anguish, shock or humiliation arising out of injury as defined in Paragraph a.above. Mental anguish means any type of mental or emotional illness or distress. Item 10. Su ementar Pa ments – Increased Limits Paragraphs 1.b.and 1.d.of Section I – Su ementar Pa ments – Coverages A And B are replaced by the following: b.Up to $3,000 for the cost of bail bonds required because of accidents or traffic law violations arising out of the use of any vehicle to which Bodily Injury Liability Coverage applies. We do not have to furnish these bonds. d.All reasonable expenses incurred by the insured at our request to assist in the investigation or defense of the claim or "suit", including actual loss of earnings up to $500 a day because of time off from work. Item 11. Pro ert In Your Care Custod Or Contro A.Paragraphs (3)and ()of Exclusion .of Section I – Coverage A – Bodi In ur And Pro ert Damage Liabi it are deleted. B. Additiona E c usion Coverage provided by this endorsement does not apply to "property damage" to property while in transit. C. Limits of Insurance Subject to Paragraphs 2.,3., and .of Section III – Limits Of Insurance, the most we will pay for insurance provided by Paragraph A.above is: $10,000 Each Occurrence Limit $75,000 Aggregate Limit The Each Occurrence Limit for this coverage applies to all damages as a result of any one "occurrence" regardless of the number of persons or organizations who sustain damage because of that "occurrence". The Aggregate Limit is the most we will pay for the sum of all damages under this Item 11. LC 32 1 11 18 © 2018 Liberty Mutual Insurance Page 5 of 5 Includes copyrighted material of Insurance Services Office, Inc., with its permission. D. Other Insurance This insurance does not apply to any portion of a loss for which the insured has available any other valid and collectible insurance, whether primary, excess, contingent, or on any other basis, unless such other insurance was specifically purchased by the insured to apply in excess of this Policy. Item 12. Mobi e E ui ment Redefined The definition of "mobile equipment" in Section – Definitions is amended to include self-propelled vehicles with permanently attached equipment less than 1000 pounds gross vehicle weight that are primarily designed for: (1)Snow removal; (2)Road maintenance, but not construction or resurfacing; or (3)Street cleaning. However, "mobile equipment" does not include land vehicles that are subject to a compulsory or financial responsibility law or other motor vehicle insurance law where such vehicles are licensed or principally garaged. Land vehicles subject to a compulsory or financial responsibility law or other motor vehicle insurance law are considered "autos". Item 13. Ne Formed Or Ac uired Entities A.Paragraph 3.of Section II – ho Is An Insured is replaced by the following: 3.Any organization you newly acquire or form, other than a partnership or joint venture, and over which you maintain majority ownership or majority interest, will qualify as a Named Insured if there is no other similar insurance available to that organization. However: a.Coverage under this provision is afforded only until: (1)The 180th day after you acquire or form the organization; (2)Separate coverage is purchased for the organization; or (3)The end of the policy period whichever is earlier; b. Section I – Coverage A – Bodi In ur And Pro ert Damage Liabi it does not apply to "bodily injury" or "property damage" that occurred before you acquired or formed the organization; and c. Section I – Coverage B – Persona And Advertising In ur Liabi it does not apply to "personal and advertising injury" arising out of an offense committed before you acquired or formed the organization. B.The insurance afforded to any organization as a Named Insured under this Item 13. does not apply if a Broad Form Named Insured endorsement attached to this Policy applies to that organization. Item 1 . aiver Of Right Of Recover B ritten Contract Or Agreement The following is added to Paragraph 8.Transfer Of Rights Of Recovery Against Others To Us of Section I – Commercia Genera Liabi it Conditions We waive any right of recovery because of payments we make under this Policy for injury or damage arising out of your ongoing operations or "your work" included in the "products-completed operations hazard" that we may have against any person or organization with whom you have agreed in a written contract or agreement to waive your rights of recovery but only if the "bodily injury" or "property damage" occurs, or offense giving rise to "personal and advertising injury" is committed subsequent to the execution of the written contract or agreement. AC 8 07 11 17 © 2017 Liberty Mutual Insurance Page 1 of 10 Includes copyrighted material of Insurance Services Office, Inc., with its permission. Policy Number Issued by THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. AUTO ENHANCEMENT ENDORSEMENT This endorsement modifies insurance provided under the following: BUSINESS AUTO COVERAGE FORM I. Newly Acquired or Formed Organizations II. Employees as Insureds III. Lessor - Additional Insured and Loss Payee IV. Supplementary Payments - Increased Limits V. Fellow Employee Coverage VI. Personal Property of Others VII. Additional Transportation Expense and Cost to Recover Stolen Auto VIII. Airbag Coverage IX. Tapes, Records and Discs Coverage X. Physical Damage Deductible - Single Deductible XI. Physical Damage Deductible - Glass XII. Physical Damage Deductible - Vehicle Tracking System XIII. Duties in Event of Accident, Claim, Suit or Loss XIV. Unintentional Failure to Disclose Hazards XV. Worldwide Liability Coverage - Hired and Nonowned Autos XVI. Hired Auto Physical Damage XVII. Auto Medical Payments Coverage Increased Limits XVIII. Drive Other Car Coverage - Broadened Coverage for Designated Individuals XIX. Rental Reimbursement Coverage XX. Notice of Cancellation or Nonrenewal XXI. Loan/Lease Payoff Coverage XXII. Limited Mexico Coverage XXIII. Waiver of Subrogation I. NE LY AC UIRED OR FORMED ORGANI ATIONS Throughout this policy, the words "you" and "your" also refer to any organization you newly acquire or form, other than a partnership or joint venture, and over which you maintain ownership of more than 50 percent interest, provided: A.There is no similar insurance available to that organization; B.Unless you notify us to add coverage to your policy, the coverage under this provision is afforded only until: 1.The 90th day after you acquire or form the organization; or 2.The end of the policy period, whichever is earlier; and C.The coverage does not apply to an "accident" which occurred before you acquired or formed the organization. AS2-Z91-471905-031 AC 8 07 11 17 © 2017 Liberty Mutual Insurance Page 2 of 10 Includes copyrighted material of Insurance Services Office, Inc., with its permission. II. EMPLOYEES AS INSUREDS Paragraph A.1. ho Is An Insured of SECTION II CO ERED AUTOS LIABILITY CO ERAGE is amended to add the following: Your "employee" is an "insured" while using with your permission a covered "auto" you do not own, hire or borrow in your business or your personal affairs. III. LESSOR ADDITIONAL INSURED AND LOSS PAYEE A.Any "leased auto" will be considered an "auto" you own and not an "auto" you hire or borrow. The coverages provided under this section apply to any "leased auto" until the expiration date of this policy or until the lessor or his or her agent takes possession of the "leased auto" whichever occurs first. B.For any "leased auto" that is a covered "auto" under SECTION II CO ERED AUTOS LIABILITY CO ERAGE, Paragraph A.1. ho Is An Insured provision is changed to include as an "insured" the lessor of the "leased auto". However, the lessor is an "insured" only for "bodily injury" or "property damage" resulting from the acts or omissions by: 1.You. 2.Any of your "employees" or agents; or 3.Any person, except the lessor or any "employee" or agent of the lessor, operating a "leased auto" with the permission of any of the above. C. Loss Pa ee C ause 1.We will pay, as interests may appear, you and the lessor of the "leased auto" for "loss" to the covered "leased auto". 2.The insurance covers the interest of the lessor of the "leased auto" unless the "loss" results from fraudulent acts or omissions on your part. 3.If we make any payment to the lessor of a "leased auto", we will obtain his or her rights against any other party. D. Cance ation 1.If we cancel the policy, we will mail notice to the lessor in accordance with the Cancellation Common Policy Condition. 2.If you cancel the policy, we will mail notice to the lessor. 3.Cancellation ends this agreement. E.The lessor is not liable for payment of your premiums. F.For purposes of this endorsement, the following definitions apply: "Leased auto" means an "auto" which you lease for a period of six months or longer for use in your business, including any "temporary substitute" of such "leased auto". "Temporary substitute" means an "auto" that is furnished as a substitute for a covered "auto" when the covered "auto" is out of service because of its breakdown, repair, servicing, "loss" or destruction. AC 8 07 11 17 © 2017 Liberty Mutual Insurance Page 3 of 10 Includes copyrighted material of Insurance Services Office, Inc., with its permission. I . SUPPLEMENTARY PAYMENTS INCREASED LIMITS Subparagraphs A.2.a.(2)and A.2.a.( )of SECTION II CO ERED AUTOS LIABILITY CO ERAGE are deleted and replaced by the following: (2)Up to $3,000 for cost of bail bonds (including bonds for related traffic law violations) required because of an "accident" we cover. We do not have to furnish these bonds. ()All reasonable expenses incurred by the "insured" at our request, including actual loss of earnings up to $500 a day because of time off from work. . FELLO EMPLOYEE CO ERAGE A.Exclusion B. .of SECTION II CO ERED AUTOS LIABILITY CO ERAGE does not apply. B.For the purpose of Fellow Employee Coverage only, Paragraph B. .of SECTION I BUSINESS AUTO CONDITIONS is changed as follows: This Fellow Employee Coverage is excess over any other collectible insurance. I. PERSONAL PROPERTY OF OTHERS Exclusion .in SECTION II CO ERED AUTOS LIABILITY CO ERAGE for a covered "auto" is amended to add the following: This exclusion does not apply to "property damage" or "covered pollution cost or expense" involving "personal property" of your "employees" or others while such property is carried by the covered "auto". The Limit of Insurance for this coverage is $5,000 per "accident". Payment under this coverage does not increase the Limit of Insurance. For the purpose of this section of this endorsement, "personal property" is defined as any property that is not used in the individual's trade or business or held for the production or collection of income. II. ADDITIONAL TRANSPORTATION EXPENSE AND COST TO RECO ER STOLEN AUTO A.Paragraph A. .a.of SECTION III PHYSICAL DAMAGE CO ERAGE is amended as follows: The amount we will pay is increased to $50 per day and to a maximum limit of $1,000. B.Paragraph A. .a.of SECTION III PHYSICAL DAMAGE CO ERAGE is amended to add the following: If your business is shown in the Declarations as something other than an auto dealership, we will also pay up to $1,000 for reasonable and necessary costs incurred by you to return a stolen covered "auto" from the place where it is recovered to its usual garaging location. III. AIRBAG CO ERAGE Exclusion B.3.a.in SECTION III PHYSICAL DAMAGE CO ERAGE is amended to add the following: This exclusion does not apply to the accidental discharge of an airbag. IX. TAPES RECORDS AND DISCS CO ERAGE Exclusion B. .a.of SECTION III PHYSICAL DAMAGE CO ERAGE is deleted and replaced by the following: a.Tapes, records, discs or other similar audio, visual or data electronic devices designed for use with audio, visual or data electronic equipment except when the tapes, records, discs or other similar audio, visual or data electronic devices: AC 8 07 11 17 © 2017 Liberty Mutual Insurance Page 4 of 10 Includes copyrighted material of Insurance Services Office, Inc., with its permission. (1)Are your property or that of a family member; and (2)Are in a covered "auto" at the time of "loss". The most we will pay for "loss" is $200. No Physical Damage Coverage deductible applies to this coverage. X. PHYSICAL DAMAGE DEDUCTIBLE SINGLE DEDUCTIBLE Paragraph D.in SECTION III PHYSICAL DAMAGE CO ERAGE is deleted and replaced by the following: D. Deductib e For each covered "auto", our obligation to pay for, repair, return or replace damaged or stolen property will be reduced by the applicable deductible shown in the Declarations. Any Comprehensive Coverage deductible shown in the Declarations does not apply to "loss" caused by fire or lightning. When two or more covered "autos" sustain "loss" in the same collision, the total of all the "loss" for all the involved covered "autos" will be reduced by a single deductible, which will be the largest of all the deductibles applying to all such covered "autos". XI. PHYSICAL DAMAGE DEDUCTIBLE – GLASS Paragraph D.in SECTION III PHYSICAL DAMAGE CO ERAGE is amended to add the following: No deductible applies to "loss" to glass if you elect to patch or repair it rather than replace it. XII. PHYSICAL DAMAGE DEDUCTIBLE EHICLE TRAC ING SYSTEM Paragraph D.in SECTION III PHYSICAL DAMAGE CO ERAGE is amended to add: Any Comprehensive Coverage Deductible shown in the Declarations will be reduced by 50% for any "loss" caused by theft if the vehicle is equipped with a vehicle tracking device such as a radio tracking device or a global positioning device and that device was the method of recovery of the vehicle. XIII. DUTIES IN E ENT OF ACCIDENT CLAIM SUIT OR LOSS Subparagraphs A.2.a.and A.2.b.of SECTION I BUSINESS AUTO CONDITIONS are changed to: a.In the event of "accident", claim, "suit" or "loss", your insurance manager or any other person you designate must notify us as soon as reasonably possible of such "accident", claim, "suit" or "loss". Such notice must include: (1)How, when and where the "accident" or "loss" occurred; (2)The "insured's" name and address; and (3)To the extent possible, the names and addresses of any injured persons and witnesses. Knowledge of an "accident", claim, "suit" or "loss" by your agent, servant or "employee" shall not be considered knowledge by you unless you, your insurance manager or any other person you designate has received notice of the "accident", claim, "suit" or "loss" from your agent, servant or "employee". b.Additionally, you and any other involved "insured" must: (1)Assume no obligation, make no payment or incur no expense without our consent, except at the "insured's" own cost. AC 8 07 11 17 © 2017 Liberty Mutual Insurance Page 5 of 10 Includes copyrighted material of Insurance Services Office, Inc., with its permission. (2)Immediately send us copies of any request, demand, order, notice, summons or legal paper received concerning the claim or "suit". (3)Cooperate with us in the investigation or settlement of the claim or defense against the "suit". ()Authorize us to obtain medical records or other pertinent information. ()Submit to examination, at our expense, by physicians of our choice, as often as we reasonably require. XI . UNINTENTIONAL FAILURE TO DISCLOSE HA ARDS Paragraph B.2.in SECTION I BUSINESS AUTO CONDITIONS is amended to add the following: Any unintentional failure to disclose all exposures or hazards existing as of the effective date of the Business Auto Coverage Form or at any time during the policy period will not invalidate or adversely affect the coverage for such exposure or hazard. However, you must report the undisclosed exposure or hazard to us as soon as reasonably possible after its discovery. X . ORLD IDE LIABILITY CO ERAGE HIRED AND NONO NED AUTOS Condition B.7.in SECTION I BUSINESS AUTO CONDITIONS is amended to add the following: For "accidents" resulting from the use or operation of covered "autos" you do not own, the coverage territory means all parts of the world subject to the following provisions: a.If claim is made or "suit" is brought against an "insured" outside of the United States of America, its territories and possessions, Puerto Rico and Canada, we shall have the right, but not the duty to investigate, negotiate, and settle or defend such claim or "suit". If we do not exercise that right, the "insured" shall have the duty to investigate, negotiate, and settle or defend the claim or "suit" and we will reimburse the "insured" for the expenses reasonably incurred in connection with the investigation, settlement or defense. Reimbursement will be paid in the currency of the United States of America at the rate of exchange prevailing on the date of reimbursement. The "insured" shall provide us with such information we shall reasonably request regarding such claim or "suit" and its investigation, negotiation, and settlement or defense. The "insured" shall not agree to any settlement of the claim or "suit" without our consent. We shall not unreasonably withhold consent. b.We are not licensed to write insurance outside of the United States of America, its territories or possessions, Puerto Rico and Canada. We will not furnish certificates of insurance or other evidence of insurance you may need for the purpose of complying with the laws of other countries relating to auto insurance. Failure to comply with the auto insurance laws of other countries may result in fines or penalties. This insurance does not apply to such fines or penalties. X I. HIRED AUTO PHYSICAL DAMAGE If no deductibles are shown in the Declarations for Physical Damage Coverage for Hired or Borrowed Autos, the following will apply: A.We will pay for "loss" under Comprehensive and Collision coverages to a covered "auto" of the private passenger type hired without an operator for use in your business: AC 8 07 11 17 © 2017 Liberty Mutual Insurance Page 6 of 10 Includes copyrighted material of Insurance Services Office, Inc., with its permission. 1.The most we will pay for coverage afforded by this endorsement is the lesser of: a.The actual cost to repair or replace such covered "auto" with other property of like kind and quality; or b.The actual cash value of such covered "auto" at the time of the "loss". 2.An adjustment for depreciation and physical condition will be made in determining actual cash value in the event of a total "loss". 3.If a repair or replacement results in better than like kind or quality, we will not pay for the amount of the betterment. B.For each covered "auto", our obligation to pay for, repair, return or replace the covered "auto" will be reduced by any deductible shown in the Declarations that applies to private passenger "autos" that you own. If no applicable deductible is shown in the Declarations, the deductible will be $250. If the Declarations show other deductibles for Physical Damage Coverages for Hired or Borrowed Autos, this Section XVI of this endorsement does not apply. C.Paragraph A. .b.of SECTION III PHYSICAL DAMAGE CO ERAGE is replaced by the following: b. Loss of Use E enses For Hired Auto Physical Damage provided by this endorsement, we will pay expenses for which an "insured" becomes legally responsible to pay for loss of use of a private passenger vehicle rented or hired without a driver, under a written rental contract or agreement. We will pay for loss of use expenses caused by: (1)Other than collision only if the Declarations indicate that Comprehensive Coverage is provided for any covered "auto"; (2)Specified Causes of Loss only if the Declarations indicate that Specified Causes of Loss Coverage is provided for any covered "auto"; or (3)Collision only if the Declarations indicate that Collision Coverage is provided for any covered "auto". However, the most we will pay under this coverage is $30 per day, subject to a maximum of $900. X II. AUTO MEDICAL PAYMENTS CO ERAGE INCREASED LIMITS For any covered "loss", the Limit of Insurance for Auto Medical Payments will be double the limit shown in the Declarations if the "insured" was wearing a seat belt at the time of the "accident". This is the maximum amount we will pay for all covered medical expenses, regardless of the number of covered "autos", "insureds", premiums paid, claims made, or vehicles involved in the "accident". If no limit of insurance for Auto Medical Payments is shown on the Declarations, this paragraph Section XVII of this endorsement does not apply. X III. DRI E OTHER CAR CO ERAGE BROADENED CO ERAGE FOR DESIGNATED INDI IDUALS A.This endorsement amends only those coverages indicated with an "X" in the Drive Other Car section of the Schedule to this endorsement. B. SECTION II CO ERED AUTOS LIABILITY CO ERAGE is amended as follows: 1.Any "auto" you don't own, hire or borrow is a covered "auto" for Liability Coverage while being used by any individual named in the Drive Other Car section of the Schedule to this endorsement or by his or her spouse while a resident of the same household except: AC 8 07 11 17 © 2017 Liberty Mutual Insurance Page 7 of 10 Includes copyrighted material of Insurance Services Office, Inc., with its permission. a.Any "auto" owned by that individual or by any member of his or her household; or b.Any "auto" used by that individual or his or her spouse while working in a business of selling, servicing, repairing or parking "autos". 2.The following is added to ho Is An Insured: Any individual named in the Drive Other Car section of the Schedule to this endorsement and his or her spouse, while a resident of the same household, are "insureds" while using any covered "auto" described in Paragraph B.1.of this endorsement. C.Auto Medical Payments, Uninsured Motorist, and Underinsured Motorist Coverages are amended as follows: The following is added to ho Is An Insured: Any individual named in the Drive Other Car section of the Schedule to this endorsement and his or her "family members" are "insured" while "occupying" or while a pedestrian when struck by any "auto" you don't own except: Any "auto" owned by that individual or by any "family member". D. SECTION III PHYSICAL DAMAGE CO ERAGE is changed as follows: Any private passenger type "auto" you don't own, hire or borrow is a covered "auto" while in the care, custody or control of any individual named in the Drive Other Car section of the Schedule to this endorsement or his or her spouse while a resident of the same household except: 1.Any "auto" owned by that individual or by any member of his or her household; or 2.Any "auto" used by that individual or his or her spouse while working in a business of selling, servicing, repairing or parking "autos". E.For purposes of this endorsement, SECTION DEFINITIONS is amended to add the following: "Family member" means a person related to the individual named in the Drive Other Car section of the Schedule to this endorsement by blood, marriage or adoption who is a resident of the individual's household, including a ward or foster child. XIX. RENTAL REIMBURSEMENT CO ERAGE A.For any owned covered "auto" for which Collision and Comprehensive Coverages are provided, we will pay for rental reimbursement expenses incurred by you for the rental of an "auto" because of a covered physical damage "loss" to an owned covered "auto". Such payment applies in addition to the otherwise applicable amount of physical damage coverage you have on a covered "auto". No deductibles apply to this coverage. B.We will pay only for those expenses incurred during the policy period beginning 24 hours after the "loss" and ending with the earlier of the return or repair of the covered "auto", or the exhaustion of the coverage limit. C.Our payment is limited to the lesser of the following amounts: 1.Necessary and actual expenses incurred; or 2.$30 per day with a maximum of $900 in any one period. AC 8 07 11 17 © 2017 Liberty Mutual Insurance Page 8 of 10 Includes copyrighted material of Insurance Services Office, Inc., with its permission. D.This coverage does not apply: 1.While there are spare or reserve "autos" available to you for your operations; or 2.If coverage is provided by another endorsement attached to this policy. E.If a covered "loss" results from the total theft of a covered "auto" of the private passenger type, we will pay under this coverage only that amount of your rental reimbursement expenses which is not already provided for under Paragraph A. .Coverage Extensions of SECTION III – PHYSICAL DAMAGE CO ERAGE of the Business Auto Coverage Form or Section VII of this endorsement. XX. NOTICE OF CANCELLATION OR NONRENE AL A.Paragraph A.2.of the COMMON POLICY CONDITIONS is changed to: 2.We may cancel or non-renew this policy by mailing written notice of cancellation or non-renewal to the Named Insured, and to any name(s) and address(es) shown in the Cancellation and Non-renewal Schedule: a.For reasons of non-payment, the greater of: (1)10 days; or (2)The number of days specified in any other Cancellation Condition attached to this policy; or b.For reasons other than non-payment, the greater of: (1)60 days; (2)The number of days shown in the Cancellation and Non-renewal Schedule; or (3)The number of days specified in any other Cancellation Condition attached to this policy, prior to the effective date of the cancellation or non-renewal. B.All other terms of Paragraph A. of the COMMON POLICY CONDITIONS, and any amendments thereto, remain in full force and effect. XXI. LOAN LEASE PAYOFF CO ERAGE The following is added to Paragraph C. Limits Of Insurance of SECTION III PHYSICAL DAMAGE CO ERAGE: In the event of a total "loss" to a covered "auto" of the private passenger type shown in the schedule or declarations for which Collision and Comprehensive Coverage apply, we will pay any unpaid amount due on the lease or loan for that covered "auto", less: 1.The amount paid under the PHYSICAL DAMAGE CO ERAGE SECTION of the policy; and 2.Any: a.Overdue lease/loan payments at the time of the "loss"; b.Financial penalties imposed under a lease for excessive use, abnormal wear and tear or high mileage; c.Security deposits not returned by the lessor; d.Costs for extended warranties, Credit Life Insurance, Health, Accident or Disability Insurance purchased with the loan or lease; and AC 8 07 11 17 © 2017 Liberty Mutual Insurance Page 9 of 10 Includes copyrighted material of Insurance Services Office, Inc., with its permission. e.Carry-over balances from previous loans or leases. This coverage is limited to a maximum of $1,500 for each covered "auto". XXII.LIMITED MEXICO CO ERAGE ARNING AUTO ACCIDENTS IN MEXICO ARE SUBJECT TO THE LAWS OF MEXICO ONLY - NOT THE LAWS OF THE UNITED STATES OF AMERICA. THE REPUBLIC OF MEXICO CONSIDERS ANY AUTO ACCIDENT A CRIMINAL OFFENSE AS WELL AS A CIVIL MATTER. IN SOME CASES THE COVERAGE PROVIDED UNDER THIS ENDORSEMENT MAY NOT BE RECOGNI ED BY THE MEXICAN AUTHORITIES AND WE MAY NOT BE ALLOWED TO IMPLEMENT THIS COVERAGE AT ALL IN MEXICO. YOU SHOULD CONSIDER PURCHASING AUTO COVERAGE FROM A LICENSED MEXICAN INSURANCE COMPANY BEFORE DRIVING INTO MEXICO. THIS ENDORSEMENT DOES NOT APPLY TO ACCIDENTS OR LOSSES WHICH OCCUR BEYOND 25 MILES FROM THE BOUNDARY OF THE UNITED STATES OF AMERICA. A. Coverage 1.Paragraph B.7.of SECTION I BUSINESS AUTO CONDITIONS is amended by the addition of the following: The coverage territory is extended to include Mexico but only if all of the following criteria are met: a.The "accidents" or "loss" occurs within 25 miles of the United States border; and b.While on a trip into Mexico for 10 days or less. 2.For coverage provided by this section of the endorsement, Paragraph B..Other Insurance in SECTION I BUSINESS AUTO CONDITIONS is replaced by the following: The insurance provided by this endorsement will be excess over any other collectible insurance. B. Ph sica Damage Coverage is amended by the addition of the following: If a "loss" to a covered "auto" occurs in Mexico, we will pay for such "loss" in the United States. If the covered "auto" must be repaired in Mexico in order to be driven, we will not pay more than the actual cash value of such "loss" at the nearest United States point where the repairs can be made. C. Additiona E c usions The following additional exclusions are added: This insurance does not apply: 1.If the covered "auto" is not principally garaged and principally used in the United States. 2.To any "insured" who is not a resident of the United States. XXIII. AI ER OF SUBROGATION Paragraph A. .in SECTION I BUSINESS AUTO CONDITIONS does not apply to any person or organization where the Named Insured has agreed, by written contract executed prior to the date of "accident", to waive rights of recovery against such person or organization. AC 8 07 11 17 © 2017 Liberty Mutual Insurance Page 10 of 10 Includes copyrighted material of Insurance Services Office, Inc., with its permission. Schedu e Premium Liability Physical Damage Total Premium X III. Drive Other Car Name of Individua LIAB MP UM UIM COMP COLL XX. Notice of Cance ation or Nonrene a Name and Address Number of Da s AC 84 23 08 11 © 2010, Liberty Mutual Group of Companies. All rights reserved. Includes copyrighted material of Insurance Services Office, Inc. with its permission. Page 1 of 1 Policy Number: Issued by: THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. DESIGNATED INSURED - NONCONTRIBUTING This endorsement modifies insurance provided under the following: BUSINESS AUTO COVERAGE FORM GARAGE COVERAGE FORM MOTOR CARRIERS COVERGE FORM TRUCKERS COVERAGE FORM With respect to coverage provided by this endorsement, the provisions of the Coverage Form apply unless modified by this endorsement. This endorsement identifies person(s) or organization(s) who are "insureds" under the Who Is An Insured Provision of the Coverage Form. This endorsement does not alter coverage provided in the Coverage form. Schedule Name of Person(s) or Organizations(s): Regarding Designated Contract or Project: Each person or organization shown in the Schedule of this endorsement is an "insured" for Liability Coverage, but only to the extent that person or organization qualifies as an "insured" under the Who Is An Insured Provision contained in Section II of the Coverage Form. The following is added to the Other Insurance Condition: If you have agreed in a written agreement that this policy will be primary and without right of contribution from any insurance in force for an Additional Insured for liability arising out of your operations, and the agreement was executed prior to the "bodily injury" or "property damage", then this insurance will be primary and we will not seek contribution from such insurance. AS2-Z91-471905-031 LIM 99 01 05 11 © 2011 Liberty Mutual Group of Companies. All rights reserved. Includes copyrighted material of Insurance Services Office, Inc., with its permission. Page 1 of 1 Policy Number Issued by THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. NOTICE OF CANCELLATION TO THIRD PARTIES This endorsement modifies insurance provided under the following: BUSINESS AUTO COVERAGE PART MOTOR CARRIER COVERAGE PART GARAGE COVERAGE PART TRUCKERS COVERAGE PART EXCESS AUTOMOBILE LIABILITY INDEMNITY COVERAGE PART SELF-INSURED TRUCKER EXCESS LIABILITY COVERAGE PART COMMERCIAL GENERAL LIABILITY COVERAGE PART EXCESS COMMERCIAL GENERAL LIABILITY COVERAGE PART PRODUCTS/COMPLETED OPERATIONS LIABILITY COVERAGE PART LIQUOR LIABILITY COVERAGE PART Schedule Name of Other Person(s) / Organization(s): Email Address or mailing address:Number Days Notice: A. If we cancel this policy for any reason other than nonpayment of premium, we will notify the persons or organizations shown in the Schedule above. We will send notice to the email or mailing address listed above at least 10 days, or the number of days listed above, if any, before the cancellation becomes effective. In no event does the notice to the third party exceed the notice to the first named insured. B. This advance notification of a pending cancellation of coverage is intended as a courtesy only. Our failure to provide such advance notification will not extend the policy cancellation date nor negate cancellation of the policy. All other terms and conditions of this policy remain unchanged. AS2-Z91-471905-031 OR ERS COMPENSATION AND EMPLOYERS LIABILITY POLICY C 2 03 0 B Insured copy This endorsement changes the policy to which it is attached effective on the inception date of the policy unless a different date is indicated below. (The following "attaching clause" need be completed only when this endorsement is issued subsequent to preparation of the policy.) This endorsement, effective on 6/15/21 at 12 01 a.m. standard time, forms a part of: Policy no. 0002063431 of Texas Mutual Insurance Company effective on 6/15/21 Issued to: BEAN ELECTRICAL INC This is not a bill NCCI Carrier Code: 29939 Authori ed re resentative 6/9/21 1 of 1 PO Box 12058, Austin, TX 78711-2058 texasmutual.com | (800) 859-5995 | Fax (800) 359-0650 WC 42 03 04 B TEXAS AI ER OF OUR RIGHT TO RECO ER FROM OTHERS ENDORSEMENT This endorsement applies only to the insurance provided by the policy because Texas is shown in item 3.A. of the Information Page. We have the right to recover our payments from anyone liable for an injury covered by this policy. We will not enforce our right against the person or organization named in the Schedule, but this waiver applies only with respect to bodily injury arising out of the operations described in the schedule where you are required by a written contract to obtain this waiver from us. This endorsement shall not operate directly or indirectly to benefit anyone not named in the Schedule. The premium for this endorsement is shown in the Schedule. Schedu e 1. ( ) Specific Waiver Name of person or organization (X)Blanket Waiver Any person or organization for whom the Named Insured has agreed by written contract to furnish this waiver. 2. Operations: All Texas operations 3. Premium: The premium charge for this endorsement shall be 2.00 percent of the premium developed on payroll in connection with work performed for the above person(s) or organization(s) arising out of the operations described. 4. Advance Premium: Included, see Information Page POLICY NUMBER: COMMERCIAL GENERAL LIABILITY CG 20 10 12 19 THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. CG 20 10 12 19 © Insurance Services Office, Inc., 2018 Page 1 of 2 ADDITIONAL INSURED – OWNERS, LESSEES OR CONTRACTORS – SCHEDULED PERSON OR ORGANIZATION This endorsement modifies insurance provided under the following: COMMERCIAL GENERAL LIABILITY COVERAGE PART SCHEDULE Name Of Additional Insured Person(s) Or Organization(s) Location(s) Of Covered Operations Information required to complete this Schedule, if not shown above, will be shown in the Declarations. A. Section II – Who Is An Insured is amended to include as an additional insured the person(s) or organization(s) shown in the Schedule, but only with respect to liability for "bodily injury", "property damage" or "personal and advertising injury" caused, in whole or in part, by: 1.Your acts or omissions; or 2.The acts or omissions of those acting on your behalf; in the performance of your ongoing operations for the additional insured(s) at the location(s) designated above. However: 1.The insurance afforded to such additional insured only applies to the extent permitted by law; and 2.If coverage provided to the additional insured is required by a contract or agreement, the insurance afforded to such additional insured will not be broader than that which you are required by the contract or agreement to provide for such additional insured. B.With respect to the insurance afforded to these additional insureds, the following additional exclusions apply: This insurance does not apply to "bodily injury" or "property damage" occurring after: 1.All work, including materials, parts or equipment furnished in connection with such work, on the project (other than service, maintenance or repairs) to be performed by or on behalf of the additional insured(s) at the location of the covered operations has been completed; or 2.That portion of "your work" out of which the injury or damage arises has been put to its intended use by any person or organization other than another contractor or subcontractor engaged in performing operations for a principal as a part of the same project. TB2-Z91-471905-021 Blanket as required by written contract or agreement All Locations Page 2 of 2 © Insurance Services Office, Inc., 2018 CG 20 10 12 19 C.With respect to the insurance afforded to these additional insureds, the following is added to Section III – Limits Of Insurance: If coverage provided to the additional insured is required by a contract or agreement, the most we will pay on behalf of the additional insured is the amount of insurance: 1.Required by the contract or agreement; or 2.Available under the applicable limits of insurance; whichever is less. This endorsement shall not increase the applicable limits of insurance. POLICY NUMBER: COMMERCIAL GENERAL LIABILITY CG 20 37 12 19 THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. CG 20 37 12 19 © Insurance Services Office, Inc., 2018 Page 1 of 1 ADDITIONAL INSURED – OWNERS, LESSEES OR CONTRACTORS – COMPLETED OPERATIONS This endorsement modifies insurance provided under the following: COMMERCIAL GENERAL LIABILITY COVERAGE PART PRODUCTS/COMPLETED OPERATIONS LIABILITY COVERAGE PART SCHEDULE Name Of Additional Insured Person(s) Or Organization(s) Location And Description Of Completed Operations Information required to complete this Schedule, if not shown above, will be shown in the Declarations. A. Section II – Who Is An Insured is amended to include as an additional insured the person(s) or organization(s) shown in the Schedule, but only with respect to liability for "bodily injury" or "property damage" caused, in whole or in part, by "your work" at the location designated and described in the Schedule of this endorsement performed for that additional insured and included in the "products-completed operations hazard". However: 1.The insurance afforded to such additional insured only applies to the extent permitted by law; and 2.If coverage provided to the additional insured is required by a contract or agreement, the insurance afforded to such additional insured will not be broader than that which you are required by the contract or agreement to provide for such additional insured. B.With respect to the insurance afforded to these additional insureds, the following is added to Section III – Limits Of Insurance: If coverage provided to the additional insured is required by a contract or agreement, the most we will pay on behalf of the additional insured is the amount of insurance: 1.Required by the contract or agreement; or 2.Available under the applicable limits of insurance; whichever is less. This endorsement shall not increase the applicable limits of insurance. TB2-Z91-471905-021 Blanket as required by written contract or agreement All locations LC 20 8 11 18 © 2018 Liberty Mutual Insurance Page 1 of 4 Includes copyrighted material of Insurance Services Office, Inc., with its permission. Policy Number Issued by THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. COMMERCIAL GENERAL LIABILITY ADDITIONAL INSURED ENHANCEMENT FOR CONTRACTORS This endorsement modifies insurance provided under the following: COMMERCIAL GENERAL LIABILITY COVERAGE PART Index of modified items: Item 1. B an et Additiona Insured here Re uired B ritten Agreement Lessors of Leased Equipment Managers or Lessors of Premises Mortgagees, Assignees or Receivers Owners, Lessees or Contractors Architects, Engineers or Surveyors Any Person or Organization Item 2. B an et Additiona Insured – Grantor Of Permits Item 3. Other Insurance Amendment Item 1. B an et Additiona Insured here Re uired B ritten Agreement Paragraph 2.of Section II – ho Is An Insured is amended to add the following: Additiona Insured B ritten Agreement The following are insureds under the Policy when you have agreed in a written agreement to provide them coverage as additional insureds under your policy: 1. Lessors of Leased E ui ment The person(s) or organization(s) from whom you lease equipment, but only with respect to liability for "bodily injury", "property damage" or "personal and advertising injury" caused, in whole or in part, by your maintenance, operation or use of equipment leased to you by such person(s) or organization(s). This insurance does not apply to any "occurrence" which takes place after the equipment lease expires. 2. Managers or Lessors of Premises Any manager(s) or lessor(s) of premises leased to you in which the written lease agreement obligates you to procure additional insured coverage. The coverage afforded to the additional insured is limited to liability in connection with the ownership, maintenance or use of the premises leased to you and caused, in whole or in part, by some negligent act(s) or omission(s) of you, your "employees", your agents or your subcontractors. There is no coverage for the additional insured for liability arising out of the sole negligence of the additional insured or those acting on behalf of the additional insured, except as provided below. If the written agreement obligates you to procure additional insured coverage for the additional insured's sole negligence, then the coverage for the additional insured shall conform to the agreement, but only if the applicable law would allow you to indemnify the additional insured for liability arising out of the additional insured's sole negligence. TB2-Z91-471905-021 LC 20 8 11 18 © 2018 Liberty Mutual Insurance Page 2 of 4 Includes copyrighted material of Insurance Services Office, Inc., with its permission. This insurance does not apply to: a.Any "occurrence" which takes place after you cease to be a tenant in that premises or to lease that land; b.Structural alterations, new construction or demolition operations performed by or on behalf of that manager or lessor; or c.Any premises for which coverage is excluded by endorsement. 3. Mortgagees Assignees or Receivers Any person(s) or organization(s) with respect to their liability as mortgagee, assignee or receiver and arising out of your ownership, maintenance or use of the premises. This insurance does not apply to structural alterations, new construction and demolition operations performed by or on behalf of such person(s) or organization(s). . O ners Lessees or Contractors Any person(s) or organization(s) to whom you are obligated to procure additional insured coverage, but only with respect to liability for "bodily injury", "property damage" or "personal and advertising injury" caused, in whole or in part, by your act(s) or omission(s) or the act(s) or omission(s) of your "employees", your agents, or your subcontractors, in the performance of your ongoing operations. This insurance does not apply to "bodily injury", "property damage", or "personal and advertising injury" arising out of "your work" included in the "products-completed operations hazard" unless you are required to provide such coverage for the additional insured by the written agreement, and then only for the period of time required by the written agreement and only for liability caused, in whole or in part, by your act(s) or omission(s) or the act(s) or omission(s) of your "employees", your agents, or your subcontractors. There is no coverage for the additional insured for liability arising out of the sole negligence of the additional insured or those acting on behalf of the additional insured, except as provided below. If the written agreement obligates you to procure additional insured coverage for the additional insured's sole negligence, then the coverage for the additional insured shall conform to the agreement, but only if the applicable law would allow you to indemnify the additional insured for liability arising out the additional insured's sole negligence. This insurance does not apply to "bodily injury", "property damage" or "personal and advertising injury" arising out of the rendering of, or failure to render, any professional architectural, engineering or surveying services, including: a.The preparing, approving, or failing to prepare or approve, maps, shop drawings, opinions, reports, surveys, field orders, change orders or drawings and specifications; or b.Supervisory, inspection, architectural or engineering activities. This exclusion applies even if the claims against any insured allege negligence or other wrongdoing in the supervision, hiring, employment, training or monitoring of others by that insured, if the "occurrence" which caused the "bodily injury" or "property damage", or the offense which caused the "personal and advertising injury", involved the rendering of or failure to render any professional services. . Architects Engineers or Surve ors Any architect, engineer, or surveyor engaged by you but only with respect to liability for "bodily injury", "property damage" or "personal and advertising injury" caused, in whole or in part, by your act(s) or omission(s) or the act(s) or omission(s) of those acting on your behalf: a.In connection with your premises; or b.In the performance of your ongoing operations. This insurance does not apply to "bodily injury", "property damage" or "personal and advertising injury" arising out of the rendering of or failure to render any professional services by or for you, including: LC 20 8 11 18 © 2018 Liberty Mutual Insurance Page 3 of 4 Includes copyrighted material of Insurance Services Office, Inc., with its permission. a.The preparing, approving, or failing to prepare or approve, maps, shop drawings, opinions, reports, surveys, field orders, change orders or drawings and specifications; or b.Supervisory, inspection, architectural or engineering activities. This exclusion applies even if the claims against any insured allege negligence or other wrongdoing in the supervision, hiring, employment, training or monitoring of others by that insured, if the "occurrence" which caused the "bodily injury" or "property damage", or the offense which caused the "personal and advertising injury", involved the rendering of or failure to render any professional services by or for you. . An Person or Organi ation Other Than a oint enture Any person(s) or organization(s) (other than a joint venture of which you are a member) for whom you are obligated to procure additional insured coverage, but only with respect to liability for "bodily injury", "property damage" or "personal and advertising injury" caused, in whole or in part, by your act(s) or omission(s) or the act(s) or omission(s) of those acting on your behalf: a.In the performance of your ongoing operations; or b.In connection with premises owned by or rented to you. This insurance does not apply to: a.Any person(s) or organization(s) more specifically covered in Paragraphs 1.through .above; b.Any construction, renovation, demolition or installation operations performed by or on behalf of you, or those operating on your behalf; or c.Any person(s) or organization(s) whose profession, business or occupation is that of an architect, surveyor or engineer with respect to liability arising out of the rendering of, or failure to render, any professional architectural, engineering or surveying services, including: (1)The preparing, approving or failing to prepare or approve, maps, drawings, opinions, reports, surveys, field orders, change orders, designs and specifications; or (2)Supervisory, inspection, architectural or engineering activities. This exclusion applies even if the claims against any insured allege negligence or other wrongdoing in the supervision, hiring, employment, training or monitoring of others by that insured, if the "occurrence" which caused the "bodily injury" or "property damage", or the offense which caused the "personal and advertising injury", involved the rendering of or failure to render any professional services by or on behalf of you, or those operating on your behalf. The insurance afforded to any person(s) or organization(s) as an insured under this Item 1. 1.Applies to the extent permitted by law; 2.Applies only to the scope of coverage and the minimum limits of insurance required by the written agreement, but in no event exceeds either the scope of coverage or the limits of insurance provided by this Policy; 3.Does not apply to any person(s) or organization(s) for any "bodily injury", "property damage" or "personal and advertising injury" if any other additional insured endorsement attached to this Policy applies to such person(s) or organization(s) with regard to the "bodily injury", "property damage" or "personal and advertising injury"; .Applies only if the "bodily injury" or "property damage" occurs, or the offense giving rise to the "personal and advertising injury" is committed, subsequent to the execution of the written agreement; and .Applies only if the written agreement is in effect at the time the "bodily injury" or "property damage" occurs, or at the time the offense giving rise to the "personal and advertising injury" is committed. LC 20 8 11 18 © 2018 Liberty Mutual Insurance Page 4 of 4 Includes copyrighted material of Insurance Services Office, Inc., with its permission. Item 2. B an et Additiona Insured – Grantor Of Permits Paragraph 2.of Section II – ho Is An Insured is amended to add the following: Any state, municipality or political subdivision that has issued you a permit in connection with any operations performed by you or on your behalf, or in connection with premises you own, rent or control, and to which this insurance applies, but only to the extent that you are required to provide additional insured status to the state, municipality or political subdivision as a condition of receiving and maintaining the permit. Such state, municipality or political subdivision that has issued you a permit is an insured only with respect to their liability as grantor of such permit to you. However, with respect to the state, municipality or political subdivision: 1.Coverage will be no broader than required; and 2.Limits of insurance will not exceed the minimum limits of insurance required as a condition for receiving or maintaining the permit; but neither the scope of coverage nor the limits of insurance will exceed those provided by this Policy. This insurance does not apply to: 1."Bodily injury", "property damage" or "personal and advertising injury" arising out of operations performed for the state, municipality or political subdivision; 2.Any "bodily injury" or "property damage" included within the "products-completed operations hazard", except when required by written agreement initiated prior to loss; or 3."Bodily injury", "property damage" or "personal and advertising injury", unless negligently caused, in whole or in part, by you or those acting on your behalf. Item 3. Other Insurance Amendment If you are obligated under a written agreement to provide liability insurance on a primary, excess, contingent, or any other basis for any person(s) or organization(s) that qualifies as an additional insured on this Policy, this Policy will apply solely on the basis required by such written agreement and Paragraph . Other Insurance of Section I – Commercia Genera Liabi it Conditions will not apply. Where the applicable written agreement does not specify on what basis the liability insurance will apply, the provisions of Paragraph . Other Insurance of Section I – Commercia Genera Liabi it Conditions will apply. However, this insurance is excess over any other insurance available to the additional insured for which it is also covered as an additional insured for the same "occurrence", claim or "suit". LC 32 1 11 18 © 2018 Liberty Mutual Insurance Page 1 of 5 Includes copyrighted material of Insurance Services Office, Inc., with its permission. Policy Number Issued by THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. COMMERCIAL GENERAL LIABILITY ENHANCEMENT FOR CONTRACTORS This endorsement modifies insurance provided under the following: COMMERCIAL GENERAL LIABILITY COVERAGE PART Index of modified items: Item 1. Reasonab e Force Item 2. Non O ned atercraft E tension Item 3.Damage To Premises Rented To You – E anded Coverage Item .Bodi In ur To Co Em o ees Item . Hea th Care Professiona s As Insureds Item . no edge Of Occurrence Or Offense Item 7. Notice Of Occurrence Or Offense Item 8. Unintentiona Fai ure To Disc ose Item . Bodi In ur Redefined Item 10. Su ementar Pa ments – Increased Limits Item 11. Pro ert In Your Care Custod Or Contro Item 12. Mobi e E ui ment Redefined Item 13. Ne Formed Or Ac uired Entities Item 1 . aiver Of Right Of Recover B ritten Contract Or Agreement Item 1. Reasonab e Force Exclusion a.of Section I – Coverage A – Bodi In ur And Pro ert Damage Liabi it is replaced by the following: a. E ected Or Intended In ur "Bodily injury" or "property damage" expected or intended from the standpoint of the insured. This exclusion does not apply to "bodily injury" or "property damage" resulting from the use of reasonable force to protect persons or property. Item 2. Non O ned atercraft E tension Paragraph (2)of Exclusion g.of Section I – Coverage A – Bodi In ur And Pro ert Damage Liabi it is replaced by the following: (2)A watercraft you do not own that is: (a)Less than 55 feet long; and (b)Not being used to carry persons or property for a charge; Item 3. Damage To Premises Rented To You – E anded Coverage A.The final paragraph of 2. E c usions of Section I – Coverage A – Bodi In ur And Pro ert Damage Liabi it is replaced by the following: TB2-Z91-471905-021 LC 32 1 11 18 © 2018 Liberty Mutual Insurance Page 2 of 5 Includes copyrighted material of Insurance Services Office, Inc., with its permission. Exclusions c. through n.do not apply to damage by fire, lightning or explosion or subsequent damages resulting from such fire, lightning or explosion including water damage to premises while rented to you or temporarily occupied by you with permission of the owner. A separate limit of insurance applies to this coverage as described in Section III – Limits Of Insurance. B.Paragraph .of Section III – Limits Of Insurance is replaced by the following: .Subject to Paragraph .above, the Damage To Premises Rented To You Limit is the most we will pay under Coverage A for damages because of "property damage" to any one premises, while rented to you, or in the case of damage by fire, lightning, explosion or subsequent damages resulting from such fire, lightning or explosion including water damage to premises while rented to you or temporarily occupied by you with permission of the owner. The Damage To Premises Rented To You Limit is the greater of: a.$300,000; or b.The Damage To Premises Rented To You Limit shown on the Declarations. C.Paragraph .a.of the definition of "insured contract" in Section – Definitions is replaced by the following: a.A contract for a lease of premises. However, that portion of the contract for a lease of premises that indemnifies any person or organization for damage by fire, lightning, explosion or subsequent damages resulting from such fire, lightning or explosion including water damage to premises while rented to you or temporarily occupied by you with permission of the owner is not an "insured contract"; D.The paragraph immediately following Paragraph ()of Exclusion .of Section I – Coverage A – Bodi In ur And Pro ert Damage Liabi it is replaced by the following: Paragraphs (1),(3)and ()of this exclusion do not apply to "property damage" (other than damage by fire, lightning or explosion or subsequent damages resulting from such fire, lightning or explosion including water damage) to premises, including the contents of such premises, rented to you for a period of seven or fewer consecutive days. A separate limit of insurance applies to Damage To Premises Rented To You as described in Section III – Limits of Insurance. Item . Bodi In ur To Co Em o ees A.Paragraph 2.of Section II – ho Is An Insured is amended to include: Each of the following is also an insured: Your "employees" (other than either your "executive officers" (if you are an organization other than a partnership, joint venture or limited liability company) or your managers (if you are a limited liability company)) or "volunteer workers" are insureds while in the course of their employment or while performing duties related to the conduct of your business with respect to "bodily injury": (1)To you; (2)To your partners or members (if you are a partnership or joint venture); (3)To your members (if you are a limited liability company); or ()To a co-"employee" or "volunteer worker" while that co-"employee" or "volunteer worker" is either in the course of his or her employment by you or while performing duties related to the conduct of your business (including participation in any recreational activities sponsored by you). Paragraph 2.a.(1)(a)of Section II – ho Is An Insured does not apply to "bodily injury" for which insurance is provided by this paragraph. LC 32 1 11 18 © 2018 Liberty Mutual Insurance Page 3 of 5 Includes copyrighted material of Insurance Services Office, Inc., with its permission. B.The insurance provided by this Item .for "bodily injury" to a co-"employee" or "volunteer worker" will not apply if the injured co-"employee's" or "volunteer worker's" sole remedy for such injury is provided under a workers' compensation law or any similar law. C. Other Insurance The insurance provided by this Item .is excess over any other valid and collectible insurance available to the insured, whether primary, excess, contingent or on any other basis. Item . Hea th Care Professiona s As Insureds A.Paragraph 2.a.(1)(d)of Section II – ho Is An Insured is replaced by the following: (d)Arising out of his or her providing or failure to provide professional health care services. However, any "employee" or "volunteer worker" of the Named Insured who is acting as a Good Samaritan in response to a public or medical emergency or who is a "designated health care provider" is an insured with respect to "bodily injury" and "personal and advertising injury" that: (i)Arises out of the providing of or failure to provide professional health care services; and (ii)Occurs in the course of and within the scope of such "employee's" or "volunteer worker's" employment by the Named Insured. B.With respect to "employees" and "volunteer workers" providing professional health care services, the following exclusions are added to Paragraph 2. E c usions of Section I – Coverage A – Bodi In ur And Pro ert Damage Liabi it and Paragraph 2. E c usions of Section I – Coverage B – Persona And Advertising In ur Liabi it This insurance does not apply to: (1)Liability assumed under an "insured contract" or any other contract or agreement; (2)Liability arising out of the providing of professional health care services in violation of law; (3)Liability arising out of the providing of any professional health care services while in any degree under the influence of intoxicants or narcotics; ()Liability arising out of any dishonest, fraudulent, malicious or knowingly wrongful act or failure to act; or ()Punitive or exemplary damages, fines or penalties. C.The following definition is added to Section – Definitions: "Designated health care provider" means any "employee" or "volunteer worker" of the Named Insured whose duties include providing professional health care services, including but not limited to doctors, nurses, emergency medical technicians or designated first aid personnel. D. Other Insurance The insurance provided by this Item .is excess over any other valid and collectible insurance available to the insured, whether primary, excess, contingent or on any other basis. Item . no edge Of Occurrence Or Offense Knowledge of an "occurrence" or offense by your agent, servant or "employee" will not in itself constitute knowledge by you unless your "executive officer" or "employee" designated by you to notify us of an "occurrence" or offense has knowledge of the "occurrence" or offense. LC 32 1 11 18 © 2018 Liberty Mutual Insurance Page 4 of 5 Includes copyrighted material of Insurance Services Office, Inc., with its permission. Item 7. Notice Of Occurrence Or Offense For purposes of Paragraph 2.a.of Section I – Commercia Genera Liabi it Conditions, you refers to your "executive officer" or "employee" that you have designated to give us notice. Item 8. Unintentiona Fai ure To Disc ose Unintentional failure of the Named Insured to disclose all hazards existing at the inception of this Policy shall not be a basis for denial of any coverage afforded by this Policy. However, you must report such an error or omission to us as soon as practicable after its discovery. This provision does not affect our right to collect additional premium or exercise our right of cancellation or non- renewal. Item .Bodi In ur Redefined The definition of "bodily injury" in Section – Definitions is replaced by the following: "Bodily injury" means: a.Bodily injury, sickness or disease sustained by a person, including death resulting from any of these at any time; and b.Mental anguish, shock or humiliation arising out of injury as defined in Paragraph a.above. Mental anguish means any type of mental or emotional illness or distress. Item 10. Su ementar Pa ments – Increased Limits Paragraphs 1.b.and 1.d.of Section I – Su ementar Pa ments – Coverages A And B are replaced by the following: b.Up to $3,000 for the cost of bail bonds required because of accidents or traffic law violations arising out of the use of any vehicle to which Bodily Injury Liability Coverage applies. We do not have to furnish these bonds. d.All reasonable expenses incurred by the insured at our request to assist in the investigation or defense of the claim or "suit", including actual loss of earnings up to $500 a day because of time off from work. Item 11. Pro ert In Your Care Custod Or Contro A.Paragraphs (3)and ()of Exclusion .of Section I – Coverage A – Bodi In ur And Pro ert Damage Liabi it are deleted. B. Additiona E c usion Coverage provided by this endorsement does not apply to "property damage" to property while in transit. C. Limits of Insurance Subject to Paragraphs 2.,3., and .of Section III – Limits Of Insurance, the most we will pay for insurance provided by Paragraph A.above is: $10,000 Each Occurrence Limit $75,000 Aggregate Limit The Each Occurrence Limit for this coverage applies to all damages as a result of any one "occurrence" regardless of the number of persons or organizations who sustain damage because of that "occurrence". The Aggregate Limit is the most we will pay for the sum of all damages under this Item 11. LC 32 1 11 18 © 2018 Liberty Mutual Insurance Page 5 of 5 Includes copyrighted material of Insurance Services Office, Inc., with its permission. D. Other Insurance This insurance does not apply to any portion of a loss for which the insured has available any other valid and collectible insurance, whether primary, excess, contingent, or on any other basis, unless such other insurance was specifically purchased by the insured to apply in excess of this Policy. Item 12. Mobi e E ui ment Redefined The definition of "mobile equipment" in Section – Definitions is amended to include self-propelled vehicles with permanently attached equipment less than 1000 pounds gross vehicle weight that are primarily designed for: (1)Snow removal; (2)Road maintenance, but not construction or resurfacing; or (3)Street cleaning. However, "mobile equipment" does not include land vehicles that are subject to a compulsory or financial responsibility law or other motor vehicle insurance law where such vehicles are licensed or principally garaged. Land vehicles subject to a compulsory or financial responsibility law or other motor vehicle insurance law are considered "autos". Item 13. Ne Formed Or Ac uired Entities A.Paragraph 3.of Section II – ho Is An Insured is replaced by the following: 3.Any organization you newly acquire or form, other than a partnership or joint venture, and over which you maintain majority ownership or majority interest, will qualify as a Named Insured if there is no other similar insurance available to that organization. However: a.Coverage under this provision is afforded only until: (1)The 180th day after you acquire or form the organization; (2)Separate coverage is purchased for the organization; or (3)The end of the policy period whichever is earlier; b. Section I – Coverage A – Bodi In ur And Pro ert Damage Liabi it does not apply to "bodily injury" or "property damage" that occurred before you acquired or formed the organization; and c. Section I – Coverage B – Persona And Advertising In ur Liabi it does not apply to "personal and advertising injury" arising out of an offense committed before you acquired or formed the organization. B.The insurance afforded to any organization as a Named Insured under this Item 13. does not apply if a Broad Form Named Insured endorsement attached to this Policy applies to that organization. Item 1 . aiver Of Right Of Recover B ritten Contract Or Agreement The following is added to Paragraph 8.Transfer Of Rights Of Recovery Against Others To Us of Section I – Commercia Genera Liabi it Conditions We waive any right of recovery because of payments we make under this Policy for injury or damage arising out of your ongoing operations or "your work" included in the "products-completed operations hazard" that we may have against any person or organization with whom you have agreed in a written contract or agreement to waive your rights of recovery but only if the "bodily injury" or "property damage" occurs, or offense giving rise to "personal and advertising injury" is committed subsequent to the execution of the written contract or agreement. AC 8 07 11 17 © 2017 Liberty Mutual Insurance Page 1 of 10 Includes copyrighted material of Insurance Services Office, Inc., with its permission. Policy Number Issued by THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. AUTO ENHANCEMENT ENDORSEMENT This endorsement modifies insurance provided under the following: BUSINESS AUTO COVERAGE FORM I. Newly Acquired or Formed Organizations II. Employees as Insureds III. Lessor - Additional Insured and Loss Payee IV. Supplementary Payments - Increased Limits V. Fellow Employee Coverage VI. Personal Property of Others VII. Additional Transportation Expense and Cost to Recover Stolen Auto VIII. Airbag Coverage IX. Tapes, Records and Discs Coverage X. Physical Damage Deductible - Single Deductible XI. Physical Damage Deductible - Glass XII. Physical Damage Deductible - Vehicle Tracking System XIII. Duties in Event of Accident, Claim, Suit or Loss XIV. Unintentional Failure to Disclose Hazards XV. Worldwide Liability Coverage - Hired and Nonowned Autos XVI. Hired Auto Physical Damage XVII. Auto Medical Payments Coverage Increased Limits XVIII. Drive Other Car Coverage - Broadened Coverage for Designated Individuals XIX. Rental Reimbursement Coverage XX. Notice of Cancellation or Nonrenewal XXI. Loan/Lease Payoff Coverage XXII. Limited Mexico Coverage XXIII. Waiver of Subrogation I. NE LY AC UIRED OR FORMED ORGANI ATIONS Throughout this policy, the words "you" and "your" also refer to any organization you newly acquire or form, other than a partnership or joint venture, and over which you maintain ownership of more than 50 percent interest, provided: A.There is no similar insurance available to that organization; B.Unless you notify us to add coverage to your policy, the coverage under this provision is afforded only until: 1.The 90th day after you acquire or form the organization; or 2.The end of the policy period, whichever is earlier; and C.The coverage does not apply to an "accident" which occurred before you acquired or formed the organization. AS2-Z91-471905-031 AC 8 07 11 17 © 2017 Liberty Mutual Insurance Page 2 of 10 Includes copyrighted material of Insurance Services Office, Inc., with its permission. II. EMPLOYEES AS INSUREDS Paragraph A.1. ho Is An Insured of SECTION II CO ERED AUTOS LIABILITY CO ERAGE is amended to add the following: Your "employee" is an "insured" while using with your permission a covered "auto" you do not own, hire or borrow in your business or your personal affairs. III. LESSOR ADDITIONAL INSURED AND LOSS PAYEE A.Any "leased auto" will be considered an "auto" you own and not an "auto" you hire or borrow. The coverages provided under this section apply to any "leased auto" until the expiration date of this policy or until the lessor or his or her agent takes possession of the "leased auto" whichever occurs first. B.For any "leased auto" that is a covered "auto" under SECTION II CO ERED AUTOS LIABILITY CO ERAGE, Paragraph A.1. ho Is An Insured provision is changed to include as an "insured" the lessor of the "leased auto". However, the lessor is an "insured" only for "bodily injury" or "property damage" resulting from the acts or omissions by: 1.You. 2.Any of your "employees" or agents; or 3.Any person, except the lessor or any "employee" or agent of the lessor, operating a "leased auto" with the permission of any of the above. C. Loss Pa ee C ause 1.We will pay, as interests may appear, you and the lessor of the "leased auto" for "loss" to the covered "leased auto". 2.The insurance covers the interest of the lessor of the "leased auto" unless the "loss" results from fraudulent acts or omissions on your part. 3.If we make any payment to the lessor of a "leased auto", we will obtain his or her rights against any other party. D. Cance ation 1.If we cancel the policy, we will mail notice to the lessor in accordance with the Cancellation Common Policy Condition. 2.If you cancel the policy, we will mail notice to the lessor. 3.Cancellation ends this agreement. E.The lessor is not liable for payment of your premiums. F.For purposes of this endorsement, the following definitions apply: "Leased auto" means an "auto" which you lease for a period of six months or longer for use in your business, including any "temporary substitute" of such "leased auto". "Temporary substitute" means an "auto" that is furnished as a substitute for a covered "auto" when the covered "auto" is out of service because of its breakdown, repair, servicing, "loss" or destruction. AC 8 07 11 17 © 2017 Liberty Mutual Insurance Page 3 of 10 Includes copyrighted material of Insurance Services Office, Inc., with its permission. I . SUPPLEMENTARY PAYMENTS INCREASED LIMITS Subparagraphs A.2.a.(2)and A.2.a.( )of SECTION II CO ERED AUTOS LIABILITY CO ERAGE are deleted and replaced by the following: (2)Up to $3,000 for cost of bail bonds (including bonds for related traffic law violations) required because of an "accident" we cover. We do not have to furnish these bonds. ()All reasonable expenses incurred by the "insured" at our request, including actual loss of earnings up to $500 a day because of time off from work. . FELLO EMPLOYEE CO ERAGE A.Exclusion B. .of SECTION II CO ERED AUTOS LIABILITY CO ERAGE does not apply. B.For the purpose of Fellow Employee Coverage only, Paragraph B. .of SECTION I BUSINESS AUTO CONDITIONS is changed as follows: This Fellow Employee Coverage is excess over any other collectible insurance. I. PERSONAL PROPERTY OF OTHERS Exclusion .in SECTION II CO ERED AUTOS LIABILITY CO ERAGE for a covered "auto" is amended to add the following: This exclusion does not apply to "property damage" or "covered pollution cost or expense" involving "personal property" of your "employees" or others while such property is carried by the covered "auto". The Limit of Insurance for this coverage is $5,000 per "accident". Payment under this coverage does not increase the Limit of Insurance. For the purpose of this section of this endorsement, "personal property" is defined as any property that is not used in the individual's trade or business or held for the production or collection of income. II. ADDITIONAL TRANSPORTATION EXPENSE AND COST TO RECO ER STOLEN AUTO A.Paragraph A. .a.of SECTION III PHYSICAL DAMAGE CO ERAGE is amended as follows: The amount we will pay is increased to $50 per day and to a maximum limit of $1,000. B.Paragraph A. .a.of SECTION III PHYSICAL DAMAGE CO ERAGE is amended to add the following: If your business is shown in the Declarations as something other than an auto dealership, we will also pay up to $1,000 for reasonable and necessary costs incurred by you to return a stolen covered "auto" from the place where it is recovered to its usual garaging location. III. AIRBAG CO ERAGE Exclusion B.3.a.in SECTION III PHYSICAL DAMAGE CO ERAGE is amended to add the following: This exclusion does not apply to the accidental discharge of an airbag. IX. TAPES RECORDS AND DISCS CO ERAGE Exclusion B. .a.of SECTION III PHYSICAL DAMAGE CO ERAGE is deleted and replaced by the following: a.Tapes, records, discs or other similar audio, visual or data electronic devices designed for use with audio, visual or data electronic equipment except when the tapes, records, discs or other similar audio, visual or data electronic devices: AC 8 07 11 17 © 2017 Liberty Mutual Insurance Page 4 of 10 Includes copyrighted material of Insurance Services Office, Inc., with its permission. (1)Are your property or that of a family member; and (2)Are in a covered "auto" at the time of "loss". The most we will pay for "loss" is $200. No Physical Damage Coverage deductible applies to this coverage. X. PHYSICAL DAMAGE DEDUCTIBLE SINGLE DEDUCTIBLE Paragraph D.in SECTION III PHYSICAL DAMAGE CO ERAGE is deleted and replaced by the following: D. Deductib e For each covered "auto", our obligation to pay for, repair, return or replace damaged or stolen property will be reduced by the applicable deductible shown in the Declarations. Any Comprehensive Coverage deductible shown in the Declarations does not apply to "loss" caused by fire or lightning. When two or more covered "autos" sustain "loss" in the same collision, the total of all the "loss" for all the involved covered "autos" will be reduced by a single deductible, which will be the largest of all the deductibles applying to all such covered "autos". XI. PHYSICAL DAMAGE DEDUCTIBLE – GLASS Paragraph D.in SECTION III PHYSICAL DAMAGE CO ERAGE is amended to add the following: No deductible applies to "loss" to glass if you elect to patch or repair it rather than replace it. XII. PHYSICAL DAMAGE DEDUCTIBLE EHICLE TRAC ING SYSTEM Paragraph D.in SECTION III PHYSICAL DAMAGE CO ERAGE is amended to add: Any Comprehensive Coverage Deductible shown in the Declarations will be reduced by 50% for any "loss" caused by theft if the vehicle is equipped with a vehicle tracking device such as a radio tracking device or a global positioning device and that device was the method of recovery of the vehicle. XIII. DUTIES IN E ENT OF ACCIDENT CLAIM SUIT OR LOSS Subparagraphs A.2.a.and A.2.b.of SECTION I BUSINESS AUTO CONDITIONS are changed to: a.In the event of "accident", claim, "suit" or "loss", your insurance manager or any other person you designate must notify us as soon as reasonably possible of such "accident", claim, "suit" or "loss". Such notice must include: (1)How, when and where the "accident" or "loss" occurred; (2)The "insured's" name and address; and (3)To the extent possible, the names and addresses of any injured persons and witnesses. Knowledge of an "accident", claim, "suit" or "loss" by your agent, servant or "employee" shall not be considered knowledge by you unless you, your insurance manager or any other person you designate has received notice of the "accident", claim, "suit" or "loss" from your agent, servant or "employee". b.Additionally, you and any other involved "insured" must: (1)Assume no obligation, make no payment or incur no expense without our consent, except at the "insured's" own cost. AC 8 07 11 17 © 2017 Liberty Mutual Insurance Page 5 of 10 Includes copyrighted material of Insurance Services Office, Inc., with its permission. (2)Immediately send us copies of any request, demand, order, notice, summons or legal paper received concerning the claim or "suit". (3)Cooperate with us in the investigation or settlement of the claim or defense against the "suit". ()Authorize us to obtain medical records or other pertinent information. ()Submit to examination, at our expense, by physicians of our choice, as often as we reasonably require. XI . UNINTENTIONAL FAILURE TO DISCLOSE HA ARDS Paragraph B.2.in SECTION I BUSINESS AUTO CONDITIONS is amended to add the following: Any unintentional failure to disclose all exposures or hazards existing as of the effective date of the Business Auto Coverage Form or at any time during the policy period will not invalidate or adversely affect the coverage for such exposure or hazard. However, you must report the undisclosed exposure or hazard to us as soon as reasonably possible after its discovery. X . ORLD IDE LIABILITY CO ERAGE HIRED AND NONO NED AUTOS Condition B.7.in SECTION I BUSINESS AUTO CONDITIONS is amended to add the following: For "accidents" resulting from the use or operation of covered "autos" you do not own, the coverage territory means all parts of the world subject to the following provisions: a.If claim is made or "suit" is brought against an "insured" outside of the United States of America, its territories and possessions, Puerto Rico and Canada, we shall have the right, but not the duty to investigate, negotiate, and settle or defend such claim or "suit". If we do not exercise that right, the "insured" shall have the duty to investigate, negotiate, and settle or defend the claim or "suit" and we will reimburse the "insured" for the expenses reasonably incurred in connection with the investigation, settlement or defense. Reimbursement will be paid in the currency of the United States of America at the rate of exchange prevailing on the date of reimbursement. The "insured" shall provide us with such information we shall reasonably request regarding such claim or "suit" and its investigation, negotiation, and settlement or defense. The "insured" shall not agree to any settlement of the claim or "suit" without our consent. We shall not unreasonably withhold consent. b.We are not licensed to write insurance outside of the United States of America, its territories or possessions, Puerto Rico and Canada. We will not furnish certificates of insurance or other evidence of insurance you may need for the purpose of complying with the laws of other countries relating to auto insurance. Failure to comply with the auto insurance laws of other countries may result in fines or penalties. This insurance does not apply to such fines or penalties. X I. HIRED AUTO PHYSICAL DAMAGE If no deductibles are shown in the Declarations for Physical Damage Coverage for Hired or Borrowed Autos, the following will apply: A.We will pay for "loss" under Comprehensive and Collision coverages to a covered "auto" of the private passenger type hired without an operator for use in your business: AC 8 07 11 17 © 2017 Liberty Mutual Insurance Page 6 of 10 Includes copyrighted material of Insurance Services Office, Inc., with its permission. 1.The most we will pay for coverage afforded by this endorsement is the lesser of: a.The actual cost to repair or replace such covered "auto" with other property of like kind and quality; or b.The actual cash value of such covered "auto" at the time of the "loss". 2.An adjustment for depreciation and physical condition will be made in determining actual cash value in the event of a total "loss". 3.If a repair or replacement results in better than like kind or quality, we will not pay for the amount of the betterment. B.For each covered "auto", our obligation to pay for, repair, return or replace the covered "auto" will be reduced by any deductible shown in the Declarations that applies to private passenger "autos" that you own. If no applicable deductible is shown in the Declarations, the deductible will be $250. If the Declarations show other deductibles for Physical Damage Coverages for Hired or Borrowed Autos, this Section XVI of this endorsement does not apply. C.Paragraph A. .b.of SECTION III PHYSICAL DAMAGE CO ERAGE is replaced by the following: b. Loss of Use E enses For Hired Auto Physical Damage provided by this endorsement, we will pay expenses for which an "insured" becomes legally responsible to pay for loss of use of a private passenger vehicle rented or hired without a driver, under a written rental contract or agreement. We will pay for loss of use expenses caused by: (1)Other than collision only if the Declarations indicate that Comprehensive Coverage is provided for any covered "auto"; (2)Specified Causes of Loss only if the Declarations indicate that Specified Causes of Loss Coverage is provided for any covered "auto"; or (3)Collision only if the Declarations indicate that Collision Coverage is provided for any covered "auto". However, the most we will pay under this coverage is $30 per day, subject to a maximum of $900. X II. AUTO MEDICAL PAYMENTS CO ERAGE INCREASED LIMITS For any covered "loss", the Limit of Insurance for Auto Medical Payments will be double the limit shown in the Declarations if the "insured" was wearing a seat belt at the time of the "accident". This is the maximum amount we will pay for all covered medical expenses, regardless of the number of covered "autos", "insureds", premiums paid, claims made, or vehicles involved in the "accident". If no limit of insurance for Auto Medical Payments is shown on the Declarations, this paragraph Section XVII of this endorsement does not apply. X III. DRI E OTHER CAR CO ERAGE BROADENED CO ERAGE FOR DESIGNATED INDI IDUALS A.This endorsement amends only those coverages indicated with an "X" in the Drive Other Car section of the Schedule to this endorsement. B. SECTION II CO ERED AUTOS LIABILITY CO ERAGE is amended as follows: 1.Any "auto" you don't own, hire or borrow is a covered "auto" for Liability Coverage while being used by any individual named in the Drive Other Car section of the Schedule to this endorsement or by his or her spouse while a resident of the same household except: AC 8 07 11 17 © 2017 Liberty Mutual Insurance Page 7 of 10 Includes copyrighted material of Insurance Services Office, Inc., with its permission. a.Any "auto" owned by that individual or by any member of his or her household; or b.Any "auto" used by that individual or his or her spouse while working in a business of selling, servicing, repairing or parking "autos". 2.The following is added to ho Is An Insured: Any individual named in the Drive Other Car section of the Schedule to this endorsement and his or her spouse, while a resident of the same household, are "insureds" while using any covered "auto" described in Paragraph B.1.of this endorsement. C.Auto Medical Payments, Uninsured Motorist, and Underinsured Motorist Coverages are amended as follows: The following is added to ho Is An Insured: Any individual named in the Drive Other Car section of the Schedule to this endorsement and his or her "family members" are "insured" while "occupying" or while a pedestrian when struck by any "auto" you don't own except: Any "auto" owned by that individual or by any "family member". D. SECTION III PHYSICAL DAMAGE CO ERAGE is changed as follows: Any private passenger type "auto" you don't own, hire or borrow is a covered "auto" while in the care, custody or control of any individual named in the Drive Other Car section of the Schedule to this endorsement or his or her spouse while a resident of the same household except: 1.Any "auto" owned by that individual or by any member of his or her household; or 2.Any "auto" used by that individual or his or her spouse while working in a business of selling, servicing, repairing or parking "autos". E.For purposes of this endorsement, SECTION DEFINITIONS is amended to add the following: "Family member" means a person related to the individual named in the Drive Other Car section of the Schedule to this endorsement by blood, marriage or adoption who is a resident of the individual's household, including a ward or foster child. XIX. RENTAL REIMBURSEMENT CO ERAGE A.For any owned covered "auto" for which Collision and Comprehensive Coverages are provided, we will pay for rental reimbursement expenses incurred by you for the rental of an "auto" because of a covered physical damage "loss" to an owned covered "auto". Such payment applies in addition to the otherwise applicable amount of physical damage coverage you have on a covered "auto". No deductibles apply to this coverage. B.We will pay only for those expenses incurred during the policy period beginning 24 hours after the "loss" and ending with the earlier of the return or repair of the covered "auto", or the exhaustion of the coverage limit. C.Our payment is limited to the lesser of the following amounts: 1.Necessary and actual expenses incurred; or 2.$30 per day with a maximum of $900 in any one period. AC 8 07 11 17 © 2017 Liberty Mutual Insurance Page 8 of 10 Includes copyrighted material of Insurance Services Office, Inc., with its permission. D.This coverage does not apply: 1.While there are spare or reserve "autos" available to you for your operations; or 2.If coverage is provided by another endorsement attached to this policy. E.If a covered "loss" results from the total theft of a covered "auto" of the private passenger type, we will pay under this coverage only that amount of your rental reimbursement expenses which is not already provided for under Paragraph A. .Coverage Extensions of SECTION III – PHYSICAL DAMAGE CO ERAGE of the Business Auto Coverage Form or Section VII of this endorsement. XX. NOTICE OF CANCELLATION OR NONRENE AL A.Paragraph A.2.of the COMMON POLICY CONDITIONS is changed to: 2.We may cancel or non-renew this policy by mailing written notice of cancellation or non-renewal to the Named Insured, and to any name(s) and address(es) shown in the Cancellation and Non-renewal Schedule: a.For reasons of non-payment, the greater of: (1)10 days; or (2)The number of days specified in any other Cancellation Condition attached to this policy; or b.For reasons other than non-payment, the greater of: (1)60 days; (2)The number of days shown in the Cancellation and Non-renewal Schedule; or (3)The number of days specified in any other Cancellation Condition attached to this policy, prior to the effective date of the cancellation or non-renewal. B.All other terms of Paragraph A. of the COMMON POLICY CONDITIONS, and any amendments thereto, remain in full force and effect. XXI. LOAN LEASE PAYOFF CO ERAGE The following is added to Paragraph C. Limits Of Insurance of SECTION III PHYSICAL DAMAGE CO ERAGE: In the event of a total "loss" to a covered "auto" of the private passenger type shown in the schedule or declarations for which Collision and Comprehensive Coverage apply, we will pay any unpaid amount due on the lease or loan for that covered "auto", less: 1.The amount paid under the PHYSICAL DAMAGE CO ERAGE SECTION of the policy; and 2.Any: a.Overdue lease/loan payments at the time of the "loss"; b.Financial penalties imposed under a lease for excessive use, abnormal wear and tear or high mileage; c.Security deposits not returned by the lessor; d.Costs for extended warranties, Credit Life Insurance, Health, Accident or Disability Insurance purchased with the loan or lease; and AC 8 07 11 17 © 2017 Liberty Mutual Insurance Page 9 of 10 Includes copyrighted material of Insurance Services Office, Inc., with its permission. e.Carry-over balances from previous loans or leases. This coverage is limited to a maximum of $1,500 for each covered "auto". XXII.LIMITED MEXICO CO ERAGE ARNING AUTO ACCIDENTS IN MEXICO ARE SUBJECT TO THE LAWS OF MEXICO ONLY - NOT THE LAWS OF THE UNITED STATES OF AMERICA. THE REPUBLIC OF MEXICO CONSIDERS ANY AUTO ACCIDENT A CRIMINAL OFFENSE AS WELL AS A CIVIL MATTER. IN SOME CASES THE COVERAGE PROVIDED UNDER THIS ENDORSEMENT MAY NOT BE RECOGNI ED BY THE MEXICAN AUTHORITIES AND WE MAY NOT BE ALLOWED TO IMPLEMENT THIS COVERAGE AT ALL IN MEXICO. YOU SHOULD CONSIDER PURCHASING AUTO COVERAGE FROM A LICENSED MEXICAN INSURANCE COMPANY BEFORE DRIVING INTO MEXICO. THIS ENDORSEMENT DOES NOT APPLY TO ACCIDENTS OR LOSSES WHICH OCCUR BEYOND 25 MILES FROM THE BOUNDARY OF THE UNITED STATES OF AMERICA. A. Coverage 1.Paragraph B.7.of SECTION I BUSINESS AUTO CONDITIONS is amended by the addition of the following: The coverage territory is extended to include Mexico but only if all of the following criteria are met: a.The "accidents" or "loss" occurs within 25 miles of the United States border; and b.While on a trip into Mexico for 10 days or less. 2.For coverage provided by this section of the endorsement, Paragraph B..Other Insurance in SECTION I BUSINESS AUTO CONDITIONS is replaced by the following: The insurance provided by this endorsement will be excess over any other collectible insurance. B. Ph sica Damage Coverage is amended by the addition of the following: If a "loss" to a covered "auto" occurs in Mexico, we will pay for such "loss" in the United States. If the covered "auto" must be repaired in Mexico in order to be driven, we will not pay more than the actual cash value of such "loss" at the nearest United States point where the repairs can be made. C. Additiona E c usions The following additional exclusions are added: This insurance does not apply: 1.If the covered "auto" is not principally garaged and principally used in the United States. 2.To any "insured" who is not a resident of the United States. XXIII. AI ER OF SUBROGATION Paragraph A. .in SECTION I BUSINESS AUTO CONDITIONS does not apply to any person or organization where the Named Insured has agreed, by written contract executed prior to the date of "accident", to waive rights of recovery against such person or organization. AC 8 07 11 17 © 2017 Liberty Mutual Insurance Page 10 of 10 Includes copyrighted material of Insurance Services Office, Inc., with its permission. Schedu e Premium Liability Physical Damage Total Premium X III. Drive Other Car Name of Individua LIAB MP UM UIM COMP COLL XX. Notice of Cance ation or Nonrene a Name and Address Number of Da s AC 84 23 08 11 © 2010, Liberty Mutual Group of Companies. All rights reserved. Includes copyrighted material of Insurance Services Office, Inc. with its permission. Page 1 of 1 Policy Number: Issued by: THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. DESIGNATED INSURED - NONCONTRIBUTING This endorsement modifies insurance provided under the following: BUSINESS AUTO COVERAGE FORM GARAGE COVERAGE FORM MOTOR CARRIERS COVERGE FORM TRUCKERS COVERAGE FORM With respect to coverage provided by this endorsement, the provisions of the Coverage Form apply unless modified by this endorsement. This endorsement identifies person(s) or organization(s) who are "insureds" under the Who Is An Insured Provision of the Coverage Form. This endorsement does not alter coverage provided in the Coverage form. Schedule Name of Person(s) or Organizations(s): Regarding Designated Contract or Project: Each person or organization shown in the Schedule of this endorsement is an "insured" for Liability Coverage, but only to the extent that person or organization qualifies as an "insured" under the Who Is An Insured Provision contained in Section II of the Coverage Form. The following is added to the Other Insurance Condition: If you have agreed in a written agreement that this policy will be primary and without right of contribution from any insurance in force for an Additional Insured for liability arising out of your operations, and the agreement was executed prior to the "bodily injury" or "property damage", then this insurance will be primary and we will not seek contribution from such insurance. AS2-Z91-471905-031 LIM 99 01 05 11 © 2011 Liberty Mutual Group of Companies. All rights reserved. Includes copyrighted material of Insurance Services Office, Inc., with its permission. Page 1 of 1 Policy Number Issued by THIS ENDORSEMENT CHANGES THE POLICY. PLEASE READ IT CAREFULLY. NOTICE OF CANCELLATION TO THIRD PARTIES This endorsement modifies insurance provided under the following: BUSINESS AUTO COVERAGE PART MOTOR CARRIER COVERAGE PART GARAGE COVERAGE PART TRUCKERS COVERAGE PART EXCESS AUTOMOBILE LIABILITY INDEMNITY COVERAGE PART SELF-INSURED TRUCKER EXCESS LIABILITY COVERAGE PART COMMERCIAL GENERAL LIABILITY COVERAGE PART EXCESS COMMERCIAL GENERAL LIABILITY COVERAGE PART PRODUCTS/COMPLETED OPERATIONS LIABILITY COVERAGE PART LIQUOR LIABILITY COVERAGE PART Schedule Name of Other Person(s) / Organization(s): Email Address or mailing address:Number Days Notice: A. If we cancel this policy for any reason other than nonpayment of premium, we will notify the persons or organizations shown in the Schedule above. We will send notice to the email or mailing address listed above at least 10 days, or the number of days listed above, if any, before the cancellation becomes effective. In no event does the notice to the third party exceed the notice to the first named insured. B. This advance notification of a pending cancellation of coverage is intended as a courtesy only. Our failure to provide such advance notification will not extend the policy cancellation date nor negate cancellation of the policy. All other terms and conditions of this policy remain unchanged. AS2-Z91-471905-031 OR ERS COMPENSATION AND EMPLOYERS LIABILITY POLICY C 2 03 0 B Insured copy This endorsement changes the policy to which it is attached effective on the inception date of the policy unless a different date is indicated below. (The following "attaching clause" need be completed only when this endorsement is issued subsequent to preparation of the policy.) This endorsement, effective on 6/15/21 at 12 01 a.m. standard time, forms a part of: Policy no. 0002063431 of Texas Mutual Insurance Company effective on 6/15/21 Issued to: BEAN ELECTRICAL INC This is not a bill NCCI Carrier Code: 29939 Authori ed re resentative 6/9/21 1 of 1 PO Box 12058, Austin, TX 78711-2058 texasmutual.com | (800) 859-5995 | Fax (800) 359-0650 WC 42 03 04 B TEXAS AI ER OF OUR RIGHT TO RECO ER FROM OTHERS ENDORSEMENT This endorsement applies only to the insurance provided by the policy because Texas is shown in item 3.A. of the Information Page. We have the right to recover our payments from anyone liable for an injury covered by this policy. We will not enforce our right against the person or organization named in the Schedule, but this waiver applies only with respect to bodily injury arising out of the operations described in the schedule where you are required by a written contract to obtain this waiver from us. This endorsement shall not operate directly or indirectly to benefit anyone not named in the Schedule. The premium for this endorsement is shown in the Schedule. Schedu e 1. ( ) Specific Waiver Name of person or organization (X)Blanket Waiver Any person or organization for whom the Named Insured has agreed by written contract to furnish this waiver. 2. Operations: All Texas operations 3. Premium: The premium charge for this endorsement shall be 2.00 percent of the premium developed on payroll in connection with work performed for the above person(s) or organization(s) arising out of the operations described. 4. Advance Premium: Included, see Information Page SureTec Insurance Company THIS BOND RIDER CONTAINS IMPORTANT COVERAGE INFORMATION FORCE MAJEURE RIDER The obligations of the Surety and Principal under the Bond or Bonds to which this Rider is annexed are subject to the following limitations and conditions, to wit: that, it is a condition precedent to their liability hereunder that the contractual obligation (the contract or subcontract, as the case may be, being referred to in this Rider as the "Contract") between the Principal and the Obligee underlying this Bond includes (or shall be considered amended to include) a Force Majeure exclusion holding that the Principal and its Sureties shall not be held liable under this Bond or under the Contract for any impacts, delays, defaults, or damages related to Principal's work arising from, or related to epidemics, pandemics, medical emergencies, supply line interruptions, or natural disasters impacting the work required by the Contract, regardless of where such events occur, acts of God, terrorism, war, acts of government or administrative suspension, limitation, or shut-down, or the direct or indirect consequences or aftermath of any of the foregoing, and the Contract further provides that the Principal shall be entitled to an extension of the Contract Time and an equitable adjustment of the Contract Price, as a result of any of the exclusions heretofore cited. In the event the provisions for force majeure, time extensions, or equitable adjustment for time and money are more favorable to Principal in the Contract, than in this Rider, the more favorable shall apply. Revised 3-2009 SureTec Insurance Company IMPORTANT NOTICE Statutory Complaint Notice/Filing of Claims To obtain information or make a complaint: You may call the Surety's toll free telephone number for information or to make a complaint or file a claim at: 1-866-732-0099. You may also write to the Surety at: SureTec Insurance Company 9737 Great Hills Trail, Suite 320 Austin, TX 78759 You may contact the Texas Department of Insurance to obtain information on companies, coverage, rights or complaints at 1-800-252- 3439. You may write the Texas Department of Insurance at: PO Box 149104 Austin, TX 78714-9104 Fax#: 512-490-1007 Web: http://www.tdi.texas.qov Email: ConsumerProtection@tdi.texas.gov PREMIUM OR CLAIMS DISPUTES: Should you have a dispute concerning your premium or about a claim, you should contact the Surety first. If the dispute is not resolved, you may contact the Texas Department of Insurance. Texas Rider 8/2019 26th April 006219-2 MAINTENANCE BOND Page 2 of 3 WHEREAS, Principal binds itself to repair or reconstruct the Work in whole or in part upon receiving notice from the Developer and/or City of the need thereof at any time within the Maintenance Period. NOW THEREFORE, the condition of this obligation is such that if Principal shall remedy any defective Work, for which timely notice was provided by Developer or City, to a completion satisfactory to the City, then this obligation shall become null and void; otherwise to remain in full force and effect. PROVIDED, HOWEVER, if Principal shall fail so to repair or reconstruct any timely noticed defective Work, it is agreed that the Developer or City may cause any and all such defective Work to be repaired and/or reconstructed with all associated costs thereof being borne by the Principal and the Surety under this Maintenance Bond; and PROVIDED FURTHER, that if any legal action be filed on this Bond, venue shall lie in Tarrant County, Texas or the United States District Court for the Northern District of Texas, Fort Worth Division; and PROVIDED FURTHER, that this obligation shall be continuous in nature and successive recoveries may be had hereon for successive breaches. CITY OF FORT WORTH Texas Industries Addition No 3, Lot 2 Block 2 STANDARD CITY CONDITIONS — DEVELOPER AWARD�D PROJECTS City Project # 103784 Revised Ianuary 31, 2012 26th April 26th April 2022 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 STANDARD CITY CONDITIONS OF THE CONSTRUCTION CONTRACT FOR DEVELOPER AWARDED PROJECTS CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 STANDARD CITY CONDITIONS OF THE CONSTRUCTION CONTRACT FOR DEVELOPER AWARDED PROJECTS TABLE OF CONTENTS Page Article 1 – Definitions and Terminology .......................................................................................................... 1 1.01 Defined Terms ............................................................................................................................... 1 1.02 Terminology .................................................................................................................................. 5 Article 2 – Preliminary Matters ......................................................................................................................... 6 2.01 Before Starting Construction ........................................................................................................ 6 2.02 Preconstruction Conference .......................................................................................................... 6 2.03 Public Meeting .............................................................................................................................. 6 Article 3 – Contract Documents and Amending ............................................................................................... 6 3.01 Reference Standards ..................................................................................................................... 6 3.02 Amending and Supplementing Contract Documents .................................................................. 6 Article 4 – Bonds and Insurance ....................................................................................................................... 7 4.01 Licensed Sureties and Insurers ..................................................................................................... 7 4.02 Performance, Payment, and Maintenance Bonds ........................................................................ 7 4.03 Certificates of Insurance ............................................................................................................... 7 4.04 Contractor’s Insurance .................................................................................................................. 9 4.05 Acceptance of Bonds and Insurance; Option to Replace ........................................................... 12 Article 5 – Contractor’s Responsibilities ........................................................................................................ 12 5.01 Supervision and Superintendent ................................................................................................. 12 5.02 Labor; Working Hours ................................................................................................................ 13 5.03 Services, Materials, and Equipment ........................................................................................... 13 5.04 Project Schedule .......................................................................................................................... 14 5.05 Substitutes and “Or-Equals” ....................................................................................................... 14 5.06 Pre-Qualification of Bidders (Prime Contractors and Subcontractors) ..................................... 16 5.07 Concerning Subcontractors, Suppliers, and Others ................................................................... 16 5.08 Wage Rates.................................................................................................................................. 18 5.09 Patent Fees and Royalties ........................................................................................................... 19 5.10 Laws and Regulations ................................................................................................................. 19 5.11 Use of Site and Other Areas ....................................................................................................... 19 5.12 Record Documents ...................................................................................................................... 20 5.13 Safety and Protection .................................................................................................................. 21 5.14 Safety Representative ................................................................................................................. 21 5.15 Hazard Communication Programs ............................................................................................. 22 5.16 Submittals .................................................................................................................................... 22 5.17 Contractor’s General Warranty and Guarantee .......................................................................... 23 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 5.18 Indemnification ........................................................................................................................... 24 5.19 Delegation of Professional Design Services .............................................................................. 24 5.20 Right to Audit: ............................................................................................................................ 25 5.21 Nondiscrimination....................................................................................................................... 25 Article 6 – Other Work at the Site ................................................................................................................... 26 6.01 Related Work at Site ................................................................................................................... 26 Article 7 – City’s Responsibilities................................................................................................................... 26 7.01 Inspections, Tests, and Approvals .............................................................................................. 26 7.02 Limitations on City’s Responsibilities ....................................................................................... 26 7.03 Compliance with Safety Program ............................................................................................... 27 Article 8 – City’s Observation Status During Construction ........................................................................... 27 8.01 City’s Project Representative ..................................................................................................... 27 8.02 Authorized Variations in Work .................................................................................................. 27 8.03 Rejecting Defective Work .......................................................................................................... 27 8.04 Determinations for Work Performed .......................................................................................... 28 Article 9 – Changes in the Work ..................................................................................................................... 28 9.01 Authorized Changes in the Work ............................................................................................... 28 9.02 Notification to Surety .................................................................................................................. 28 Article 10 – Change of Contract Price; Change of Contract Time ................................................................ 28 10.01 Change of Contract Price ............................................................................................................ 28 10.02 Change of Contract Time............................................................................................................ 28 10.03 Delays .......................................................................................................................................... 28 Article 11 – Tests and Inspections; Correction, Removal or Acceptance of Defective Work ...................... 29 11.01 Notice of Defects ........................................................................................................................ 29 11.02 Access to Work ........................................................................................................................... 29 11.03 Tests and Inspections .................................................................................................................. 29 11.04 Uncovering Work ....................................................................................................................... 30 11.05 City May Stop the Work ............................................................................................................. 30 11.06 Correction or Removal of Defective Work ................................................................................ 30 11.07 Correction Period ........................................................................................................................ 30 11.08 City May Correct Defective Work ............................................................................................. 31 Article 12 – Completion.................................................................................................................................. 32 12.01 Contractor’s Warranty of Title ................................................................................................... 32 12.02 Partial Utilization ........................................................................................................................ 32 12.03 Final Inspection ........................................................................................................................... 32 12.04 Final Acceptance ......................................................................................................................... 33 Article 13 – Suspension of Work .................................................................................................................... 33 13.01 City May Suspend Work ............................................................................................................ 33 Article 14 – Miscellaneous .............................................................................................................................. 34 14.01 Giving Notice .............................................................................................................................. 34 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 14.02 Computation of Times ................................................................................................................ 34 14.03 Cumulative Remedies ................................................................................................................. 34 14.04 Survival of Obligations ............................................................................................................... 35 14.05 Headings ...................................................................................................................................... 35 00 73 10- 1 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 1 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 ARTICLE 1 – DEFINITIONS AND TERMINOLOGY 1.01 Defined Terms A. Wherever used in these General Conditions or in other Contract Documents, the terms listed below have the meanings indicated which are applicable to both the singular and plural thereof, and words denoting gender shall include the masculine, feminine and neuter. Said terms are generally capitalized or written in italics, but not always. When used in a context consistent with the definition of a listed-defined term, the term shall have a meaning as defined below whether capitalized or italicized or otherwise. In addition to terms specifically defined, terms with initial capital letters in the Contract Documents include references to identified articles and paragraphs, and the titles of other documents or forms. 1.Agreement - The written instrument which is evidence of the agreement between Developer and Contractor covering the Work 2.Asbestos—Any material that contains more than one percent asbestos and is friable or is releasing asbestos fibers into the air above current action levels established by the United States Occupational Safety and Health Administration. 3.Business Day – A business day is defined as a day that the City conducts normal business, generally Monday through Friday, except for federal or state holidays observed by the City. 4.Buzzsaw – City’s on-line, electronic document management and collaboration system. 5.Calendar Day – A day consisting of 24 hours measured from midnight to the next midnight. 6.City— The City of Fort Worth, Texas, a Texas home-rule municipal corporation, acting by, its governing body through its City Manager, his designee, or agents authorized pursuant to its duly authorized charter on his behalf. 7.Community Facilities Agreement (CFA) -–A Contract between the Developer and the City for the Construction of one or more following public facilities within the City public right-of- way or easement: Water, Sanitary Sewer, Street, Storm Drain, Street Light, and Street Signs. A CFA may include private facilities within the right-of-way dedicated as private right-of- way or easement on a recorded plat. 8.Contract—The entire and integrated written document incorporating the Contract Documents between the Developer, Contractor, and/or City concerning the Work. The Contract supersedes prior negotiations, representations, or agreements, whether written or oral. 9.Contract Documents—Those items that make up the contract and which must include the Agreement, and it’s attachments such as standard construction specifications, standard City Conditions, other general conditions of the Developer, including: a. An Agreement 00 73 10- 2 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 2 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 b. Attachments to the Agreement i. Bid Form ii. Vendor Compliance with State Law Non-Resident Bidder iii. Prequalification Statement c. Current Prevailing Wage Rates Table (if required by City) d. Insurance Accord Form e. Payment Bond f. Performance Bond g. Maintenance Bond h. Power of Attorney for Bonds i. Workers Compensation Affidavit j. MWBE Commitment Form( If required by City) k. General Conditions l. Supplementary Conditions m. The Standard City Conditions n. Specifications specifically made part of the Contract Documents by attachment, if not attached, as incorporated by reference and described in the Table of Contents of the Project’s Contract Documents o. Drawings p. Documentation submitted by contractor prior to Notice of Award. q. The following which may be delivered or issued after the effective date if the Agreement and, if issued become an incorporated part of the Contract Documents i. Notice to Proceed ii. Field Orders iii. Change Orders iv. Letters of Final Acceptance r. Approved Submittals, other Contractor submittals, and the reports and drawings of subsurface and physical conditions are not Contract Documents. 10.Contractor—The individual or entity with whom Developer has entered into the Agreement. 11.Day or day – A day, unless otherwise defined, shall mean a Calendar Day. 12.Developer – An individual or entity that desires to make certain improvements within the City of Fort Worth 13.Drawings—That part of the Contract Documents prepared or approved by Engineer which graphically shows the scope, extent, and character of the Work to be performed by Contractor. Submittals are not Drawings as so defined. 14.Engineer—The licensed professional engineer or engineering firm registered in the State of Texas performing professional services for the Developer. 15.Final Acceptance – The written notice given by the City to the Developer and/or Contractor that the Work specified in the Contract Documents has been completed to the satisfaction of the City. 00 73 10- 3 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 3 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 16.Final Inspection – Inspection carried out by the City to verify that the Contractor has completed the Work, and each and every part or appurtenance thereof, fully, entirely, and in conformance with the Contract Documents. 17.General Requirements—A part of the Contract Documents between the Developer and a Contractor. 18.Laws and Regulations—Any and all applicable laws, rules, regulations, ordinances, codes, and orders of any and all governmental bodies, agencies, authorities, and courts having jurisdiction. 19.Liens—Charges, security interests, or encumbrances upon Project funds, real property, or personal property. 20.Milestone—A principal event specified in the Contract Documents relating to an intermediate Contract Time prior to Final Acceptance of the Work. 21.Non-Participating Change Order—A document, which is prepared for and reviewed by the City, which is signed by Contractor, and Developer, and authorizes an addition, deletion, or revision in the Work or an adjustment in the Contract Price or the Contract Time, issued on or after the Effective Date of the Agreement. 22.Participating Change Order—A document, which is prepared for and approved by the City, which is signed by Contractor, Developer, and City and authorizes an addition, deletion, or revision in the Work or an adjustment in the Contract Price or the Contract Time, issued on or after the Effective Date of the Agreement. 23.Plans – See definition of Drawings. 24.Project Schedule—A schedule, prepared and maintained by Contractor, in accordance with the General Requirements, describing the sequence and duration of the activities comprising the Contractor’s plan to accomplish the Work within the Contract Time. 25.Project—The Work to be performed under the Contract Documents. 26.Project Representative—The authorized representative of the City who will be assigned to the Site. 27.Public Meeting – An announced meeting conducted by the Developer to facilitate public participation and to assist the public in gaining an informed view of the Project. 28.Regular Working Hours – Hours beginning at 7:00 a.m. and ending at 6:00 p.m., Monday thru Friday (excluding legal holidays). 29.Samples—Physical examples of materials, equipment, or workmanship that are representative of some portion of the Work and which establish the standards by which such portion of the Work will be judged. 00 73 10- 4 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 4 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 30.Schedule of Submittals—A schedule, prepared and maintained by Contractor, of required submittals and the time requirements to support scheduled performance of related construction activities. 31.Site—Lands or areas indicated in the Contract Documents as being furnished by City or Developer upon which the Work is to be performed, including rights-of-way, permits, and easements for access thereto, and such other lands furnished by City or Developer which are designated for the use of Contractor. 32.Specifications—That part of the Contract Documents consisting of written requirements for materials, equipment, systems, standards and workmanship as applied to the Work, and certain administrative requirements and procedural matters applicable thereto. Specifications may be specifically made a part of the Contract Documents by attachment or, if not attached, may be incorporated by reference as indicated in the Table of Contents (Division 00 00 00) of each Project. 33.Standard City Conditions – That part of the Contract Documents setting forth requirements of the City. 34.Subcontractor—An individual or entity having a direct contract with Contractor or with any other Subcontractor for the performance of a part of the Work at the Site. 35.Submittals—All drawings, diagrams, illustrations, schedules, and other data or information which are specifically prepared or assembled by or for Contractor and submitted by Contractor to illustrate some portion of the Work. 36.Superintendent – The representative of the Contractor who is available at all times and able to receive instructions from the City and/or Developer and to act for the Contractor. 37.Supplementary Conditions—That part of the Contract Documents which amends or supplements the General Conditions. 38.Supplier—A manufacturer, fabricator, supplier, distributor, materialman, or vendor having a direct contract with Contractor or with any Subcontractor to furnish materials or equipment to be incorporated in the Work by Contractor or Subcontractor. 39.Underground Facilities—All underground pipelines, conduits, ducts, cables, wires, manholes, vaults, tanks, tunnels, or other such facilities or attachments, and any encasements containing such facilities, including but not limited to, those that convey electricity, gases, steam, liquid petroleum products, telephone or other communications, cable television, water, wastewater, storm water, other liquids or chemicals, or traffic or other control systems. 40.Weekend Working Hours – Hours beginning at 9:00 a.m. and ending at 5:00 p.m., Saturday, Sunday or legal holiday, as approved in advance by the City. 00 73 10- 5 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 5 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 41.Work—The entire construction or the various separately identifiable parts thereof required to be provided under the Contract Documents. Work includes and is the result of performing or providing all labor, services, and documentation necessary to produce such construction including any Participating Change Order, Non-Participating Change Order, or Field Order, and furnishing, installing, and incorporating all materials and equipment into such construction, all as required by the Contract Documents. 42.Working Day – A working day is defined as a day, not including Saturdays, Sundays, or legal holidays authorized by the City for contract purposes, in which weather or other conditions not under the control of the Contractor will permit the performance of the principal unit of work underway for a continuous period of not less than 7 hours between 7 a.m. and 6 p.m. 1.02 Terminology A. The words and terms discussed in Paragraph 1.02.B through D are not defined but, when used in the Bidding Requirements or Contract Documents, have the indicated meaning. B.Defective: 1. The word “defective,” when modifying the word “Work,” refers to Work that is unsatisfactory, faulty, or deficient in that it: a. does not conform to the Contract Documents; or b. does not meet the requirements of any applicable inspection, reference standard, test, or approval referred to in the Contract Documents; or c. has been damaged prior to City’s written acceptance. C.Furnish, Install, Perform, Provide: 1. The word “Furnish” or the word “Install” or the word “Perform” or the word “Provide” or the word “Supply,” or any combination or similar directive or usage thereof, shall mean furnishing and incorporating in the Work including all necessary labor, materials, equipment, and everything necessary to perform the Work indicated, unless specifically limited in the context used. D. Unless stated otherwise in the Contract Documents, words or phrases that have a well-known technical or construction industry or trade meaning are used in the Contract Documents in accordance with such recognized meaning. 00 73 10- 6 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 6 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 ARTICLE 2 – PRELIMINARY MATTERS 2.01 Before Starting Construction Baseline Schedules: Submit to City in accordance with the Contract Documents, and prior to starting the Work. New schedules will be submitted to City when Participating Change Orders or Non- Participating Change Orders occur. 2.02 Preconstruction Conference Before any Work at the Site is started, the Contractor shall attend a Preconstruction Conference as specified in the Contract Documents. 2.03 Public Meeting Contractor may not mobilize any equipment, materials or resources to the Site prior to Contractor attending the Public Meeting as scheduled by the City. ARTICLE 3 – CONTRACT DOCUMENTS AND AMENDING 3.01 Reference Standards A. Standards, Specifications, Codes, Laws, and Regulations 1. Reference to standards, specifications, manuals, or codes of any technical society, organization, or association, or to Laws or Regulations, whether such reference be specific or by implication, shall mean the standard, specification, manual, code, or Laws or Regulations in effect at the time of opening of Bids (or on the Effective Date of the Agreement if there were no Bids), except as may be otherwise specifically stated in the Contract Documents. 2. No provision or instruction shall be effective to assign to City, or any of its officers, directors, members, partners, employees, agents, consultants, or subcontractors, any duty or authority to supervise or direct the performance of the Work or any duty or authority to undertake responsibility inconsistent with the provisions of the Contract Documents. 3.02 Amending and Supplementing Contract Documents A. The Contract Documents may be amended to provide for additions, deletions, and revisions in the Work or to modify the terms and conditions thereof by a Participating Change Order or a Non-Participating Change Order. B. The requirements of the Contract Documents may be supplemented, and minor variations and deviations in the Work not involving a change in Contract Price or Contract Time, may be authorized, by one or more of the following ways: 1. A Field Order; 00 73 10- 7 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 7 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 1. City’s or Engineer’s review of a Submittal (subject to the provisions of Paragraph 5.16.C); or 2. City’s written interpretation or clarification. ARTICLE 4 – BONDS AND INSURANCE 4.01 Licensed Sureties and Insurers All bonds and insurance required by the Contract Documents to be purchased and maintained by Contractor shall be obtained from surety or insurance companies that are duly licensed or authorized in the State of Texas to issue bonds or insurance policies for the limits and coverage so required. Such surety and insurance companies shall also meet such additional requirements and qualifications as may be provided Section 4.04. 4.02 Performance, Payment, and Maintenance Bonds A. Contractor shall furnish performance and payment bonds in the name of Developer and City, in accordance with Texas Government Code Chapter 2253 or successor statute, each in an amount equal to the Contract Price as security for the faithful performance and payment of all of Contractor’s obligations under the Contract Documents. B. Contractor shall furnish maintenance bonds in the name of Developer and City in an amount equal to the Contract Price as security to protect the City against any defects in any portion of the Work described in the Contract Documents. Maintenance bonds shall remain in effect for two (2) years after the date of Final Acceptance by the City. C. All bonds shall be in the form prescribed by the Contract Documents except as provided otherwise by Laws or Regulations, and shall be executed by such sureties as are named in the list of “Companies Holding Certificates of Authority as Acceptable Sureties on Federal Bonds and as Acceptable Reinsuring Companies” as published in Circular 570 (amended) by the Financial Management Service, Surety Bond Branch, U.S. Department of the Treasury. All bonds signed by an agent or attorney-in-fact must be accompanied by a sealed and dated power of attorney which shall show that it is effective on the date the agent or attorney-in-fact signed each bond. D. If the surety on any bond furnished by Contractor is declared bankrupt or becomes insolvent or its right to do business is terminated in the State of Texas or it ceases to meet the requirements of Paragraph 4.02.C, Contractor shall promptly notify City and shall, within 30 days after the event giving rise to such notification, provide another bond and surety, both of which shall comply with the requirements of Paragraphs 4.01 and 4.02.C. 4.03 Certificates of Insurance Contractor shall deliver to Developer and City, with copies to each additional insured and loss payee identified in these Standard City Conditions certificates of insurance (and other evidence of insurance requested by City or any other additional insured) which Contractor is required to purchase and maintain. 00 73 10- 8 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 8 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 1. The certificate of insurance shall document the City, an as “Additional Insured” on all liability policies. 2. The Contractor’s general liability insurance shall include a, “per project” or “per location”, endorsement, which shall be identified in the certificate of insurance provided to the City. 3. The certificate shall be signed by an agent authorized to bind coverage on behalf of the insured, be complete in its entirety, and show complete insurance carrier names as listed in the current A.M. Best Property & Casualty Guide 4. The insurers for all policies must be licensed and/or approved to do business in the State of Texas. Except for workers’ compensation, all insurers must have a minimum rating of A-: VII in the current A. M. Best Key Rating Guide or have reasonably equivalent financial strength and solvency to the satisfaction of Risk Management. If the rating is below that required, written approval of City is required. 5. All applicable policies shall include a Waiver of Subrogation (Rights of Recovery) in favor of the City. In addition, the Contractor agrees to waive all rights of subrogation against the Engineer (if applicable), and each additional insured identified in these Standard City Conditions. Failure of the City to demand such certificates or other evidence of full compliance with the insurance requirements or failure of the City to identify a deficiency from evidence that is provided shall not be construed as a waiver of Contractor’s obligation to maintain such lines of insurance coverage. 6. If insurance policies are not written for specified coverage limits, an Umbrella or Excess Liability insurance for any differences is required. Excess Liability shall follow form of the primary coverage. 7. Unless otherwise stated, all required insurance shall be written on the “occurrence basis”. If coverage is underwritten on a claims-made basis, the retroactive date shall be coincident with or prior to the date of the effective date of the agreement and the certificate of insurance shall state that the coverage is claims-made and the retroactive date. The insurance coverage shall be maintained for the duration of the Contract and for three (3) years following Final Acceptance provided under the Contract Documents or for the warranty period, whichever is longer. An annual certificate of insurance submitted to the City shall evidence such insurance coverage. 8. Policies shall have no exclusions by endorsements, which, neither nullify or amend, the required lines of coverage, nor decrease the limits of said coverage unless such endorsements are approved in writing by the City. In the event a Contract has been bid or executed and the exclusions are determined to be unacceptable or the City desires additional insurance coverage, and the City desires the contractor/engineer to obtain such coverage, the contract price shall be adjusted by the cost of the premium for such additional coverage plus 10%. 9. Any self-insured retention (SIR), in excess of $25,000.00, affecting required insurance coverage shall be approved by the City in regards to asset value and stockholders' equity. In 00 73 10- 9 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 9 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 lieu of traditional insurance, alternative coverage maintained through insurance pools or risk retention groups, must also be approved by City. 10. Any deductible in excess of $5,000.00, for any policy that does not provide coverage on a first-dollar basis, must be acceptable to and approved by the City. 11. City, at its sole discretion, reserves the right to review the insurance requirements and to make reasonable adjustments to insurance coverage’s and their limits when deemed necessary and prudent by the City based upon changes in statutory law, court decision or the claims history of the industry as well as of the contracting party to the City. The City shall be required to provide prior notice of 90 days, and the insurance adjustments shall be incorporated into the Work by Change Order. 12. City shall be entitled, upon written request and without expense, to receive copies of policies and endorsements thereto and may make any reasonable requests for deletion or revision or modifications of particular policy terms, conditions, limitations, or exclusions necessary to conform the policy and endorsements to the requirements of the Contract. Deletions, revisions, or modifications shall not be required where policy provisions are established by law or regulations binding upon either party or the underwriter on any such policies. 13. City shall not be responsible for the direct payment of insurance premium costs for Contractor’s insurance. 4.04 Contractor’s Insurance A.Workers Compensation and Employers’ Liability. Contractor shall purchase and maintain such insurance coverage with limits consistent with statutory benefits outlined in the Texas Workers’ Compensation Act (Texas Labor Code, Ch. 406, as amended), and minimum limits for Employers’ Liability as is appropriate for the Work being performed and as will provide protection from claims set forth below which may arise out of or result from Contractor’s performance of the Work and Contractor’s other obligations under the Contract Documents, whether it is to be performed by Contractor, any Subcontractor or Supplier, or by anyone directly or indirectly employed by any of them to perform any of the Work, or by anyone for whose acts any of them may be liable: 1. claims under workers’ compensation, disability benefits, and other similar employee benefit acts; 2. claims for damages because of bodily injury, occupational sickness or disease, or death of Contractor’s employees. 3. The limits of liability for the insurance shall provide the following coverages for not less than the following amounts or greater where required by Laws and Regulations a. Statutory limits b. Employer's liability 00 73 10- 10 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 10 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 1) $100,000 each accident/occurrence 2) $100,000 Disease - each employee 3) $500,000 Disease - policy limit B. Commercial General Liability. Coverage shall include but not be limited to covering liability (bodily injury or property damage) arising from: premises/operations, independent contractors, products/completed operations, personal injury, and liability under an insured contract. Insurance shall be provided on an occurrence basis, and as comprehensive as the current Insurance Services Office (ISO) policy. This insurance shall apply as primary insurance with respect to any other insurance or self-insurance programs afforded to the City. The Commercial General Liability policy, shall have no exclusions by endorsements that would alter of nullify premises/operations, products/completed operations, contractual, personal injury, or advertising injury, which are normally contained with the policy, unless the City approves such exclusions in writing. 1. For construction projects that present a substantial completed operation exposure, the City may require the contractor to maintain completed operations coverage for a minimum of no less than three (3) years following the completion of the project 2. Contractor's Liability Insurance under this Section which shall be on a per project basis covering the Contractor with minimum limits of: a. $1,000,000 each occurrence b. $2,000,000 aggregate limit 3. The policy must have an endorsement (Amendment – Aggregate Limits of Insurance) making the General Aggregate Limits apply separately to each job site. 4. The Commercial General Liability Insurance policies shall provide “X”, “C”, and “U” coverage’s. Verification of such coverage must be shown in the Remarks Article of the Certificate of Insurance. C.Automobile Liability. A commercial business auto policy shall provide coverage on “any auto”, defined as autos owned, hired and non-owned and provide indemnity for claims for damages because bodily injury or death of any person and or property damage arising out of the work, maintenance or use of any motor vehicle by the Contractor, any Subcontractor or Supplier, or by anyone directly or indirectly employed by any of them to perform any of the Work, or by anyone for whose acts any of them may be liable. 1. Automobile Liability, Contractor’s Liability Insurance under this Section, which shall be in an amount not less than the following amounts: a.Automobile Liability - a commercial business policy shall provide coverage on "Any Auto", defined as autos owned, hired and non-owned. 00 73 10- 11 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 11 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 1) $1,000,000 each accident on a combined single limit basis. Split limits are acceptable if limits are at least: 2)$250,000 Bodily Injury per person 3)$500,000 Bodily Injury per accident / 4)$100,000 Property Damage D.Railroad Protective Liability. If any of the work or any warranty work is within the limits of railroad right-of-way, the Contractor shall comply with the following requirements: 1. The Contractor’s construction activities will require its employees, agents, subcontractors, equipment, and material deliveries to cross railroad properties and tracks owned and operated by: ____________________________________________________________ Write the name of the railroad company. (If none, then write none) 2. The Contractor shall conduct its operations on railroad properties in such a manner as not to interfere with, hinder, or obstruct the railroad company in any manner whatsoever in the use or operation of its/their trains or other property. Such operations on railroad properties may require that Contractor to execute a “Right of Entry Agreement” with the particular railroad company or companies involved, and to this end the Contractor should satisfy itself as to the requirements of each railroad company and be prepared to execute the right-of-entry (if any) required by a railroad company. The requirements specified herein likewise relate to the Contractor’s use of private and/or construction access roads crossing said railroad company’s properties. 3. The Contractual Liability coverage required by Paragraph 5.04D of the General Conditions shall provide coverage for not less than the following amounts, issued by companies satisfactory to the City and to the Railroad Company for a term that continues for so long as the Contractor’s operations and work cross, occupy, or touch railroad property: a. General Aggregate: _____________________________________ Enter limits provided by Railroad Company (If none, write none) b. Each Occurrence: : _____________________________________ Enter limits provided by Railroad Company (If none, write none) 4. With respect to the above outlined insurance requirements, the following shall govern: a. Where a single railroad company is involved, the Contractor shall provide one insurance policy in the name of the railroad company. However, if more than one grade separation or at-grade crossing is affected by the Project at entirely separate locations on the line or lines of the same railroad company, separate coverage may be required, each in the amount stated above. b. Where more than one railroad company is operating on the same right-of-way or where several railroad companies are involved and operated on their own separate rights-of- None None None 00 73 10- 12 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 12 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 way, the Contractor may be required to provide separate insurance policies in the name of each railroad company. c. If, in addition to a grade separation or an at-grade crossing, other work or activity is proposed on a railroad company’s right-of-way at a location entirely separate from the grade separation or at-grade crossing, insurance coverage for this work must be included in the policy covering the grade separation. d. If no grade separation is involved but other work is proposed on a railroad company’s right-of-way, all such other work may be covered in a single policy for that railroad, even though the work may be at two or more separate locations. 5. No work or activities on a railroad company’s property to be performed by the Contractor shall be commenced until the Contractor has furnished the City with an original policy or policies of the insurance for each railroad company named, as required above. All such insurance must be approved by the City and each affected Railroad Company prior to the Contractor’s beginning work. 6. The insurance specified above must be carried until all Work to be performed on the railroad right-of-way has been completed and the grade crossing, if any, is no longer used by the Contractor. In addition, insurance must be carried during all maintenance and/or repair work performed in the railroad right-of-way. Such insurance must name the railroad company as the insured, together with any tenant or lessee of the railroad company operating over tracks involved in the Project. E.Notification of Policy Cancellation: Contractor shall immediately notify City upon cancellation or other loss of insurance coverage. Contractor shall stop work until replacement insurance has been procured. There shall be no time credit for days not worked pursuant to this section. 4.05 Acceptance of Bonds and Insurance; Option to Replace If City has any objection to the coverage afforded by or other provisions of the bonds or insurance required to be purchased and maintained by the Contractor in accordance with Article 5 on the basis of non-conformance with the Contract Documents, the Developer and City shall so notify the Contractor in writing within 10 Business Days after receipt of the certificates (or other evidence requested). Contractor shall provide to the City such additional information in respect of insurance provided as the Developer or City may reasonably request. If Contractor does not purchase or maintain all of the bonds and insurance required by the Contract Documents, the Developer or City shall notify the Contractor in writing of such failure prior to the start of the Work, or of such failure to maintain prior to any change in the required coverage. ARTICLE 5 – CONTRACTOR’S RESPONSIBILITIES 5.01 Supervision and Superintendent A. Contractor shall supervise, inspect, and direct the Work competently and efficiently, devoting such attention thereto and applying such skills and expertise as may be necessary to perform the 00 73 10- 13 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 13 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 Work in accordance with the Contract Documents. Contractor shall be solely responsible for the means, methods, techniques, sequences, and procedures of construction. B. At all times during the progress of the Work, Contractor shall assign a competent, English- speaking, Superintendent who shall not be replaced without written notice to City. The Superintendent will be Contractor’s representative at the Site and shall have authority to act on behalf of Contractor. All communication given to or received from the Superintendent shall be binding on Contractor. C. Contractor shall notify the City 24 hours prior to moving areas during the sequence of construction. 5.02 Labor; Working Hours A. Contractor shall provide competent, suitably qualified personnel to perform construction as required by the Contract Documents. Contractor shall at all times maintain good discipline and order at the Site. B. Except as otherwise required for the safety or protection of persons or the Work or property at the Site or adjacent thereto, and except as otherwise stated in the Contract Documents, all Work at the Site shall be performed during Regular Working Hours. Contractor will not permit the performance of Work beyond Regular Working Hours or for Weekend Working Hours without City’s written consent (which will not be unreasonably withheld). Written request (by letter or electronic communication) to perform Work: 1. for beyond Regular Working Hours request must be made by noon at least two (2) Business Days prior 2. for Weekend Working Hours request must be made by noon of the preceding Thursday 3. for legal holidays request must be made by noon two Business Days prior to the legal holiday. 5.03 Services, Materials, and Equipment A. Unless otherwise specified in the Contract Documents, Contractor shall provide and assume full responsibility for all services, materials, equipment, labor, transportation, construction equipment and machinery, tools, appliances, fuel, power, light, heat, telephone, water, sanitary facilities, temporary facilities, and all other facilities and incidentals necessary for the performance, Contractor required testing, start-up, and completion of the Work. B. All materials and equipment incorporated into the Work shall be as specified or, if not specified, shall be of good quality and new, except as otherwise provided in the Contract Documents. All special warranties and guarantees required by the Specifications shall expressly run to the benefit of City. If required by City, Contractor shall furnish satisfactory evidence (including reports of required tests) as to the source, kind, and quality of materials and equipment. 00 73 10- 14 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 14 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 C. All materials and equipment to be incorporated into the Work shall be stored, applied, installed, connected, erected, protected, used, cleaned, and conditioned in accordance with instructions of the applicable Supplier, except as otherwise may be provided in the Contract Documents. 5.04 Project Schedule A. Contractor shall adhere to the Project Schedule established in accordance with Paragraph 2.01 and the General Requirements as it may be adjusted from time to time as provided below. 1. Contractor shall submit to City for acceptance (to the extent indicated in Paragraph 2.01 and the General Requirements) proposed adjustments in the Project Schedule. 2. Proposed adjustments in the Project Schedule that will change the Contract Time shall be submitted in accordance with the requirements of Article 9. Adjustments in Contract Time for projects with City participation shall be made by participating change orders. 5.05 Substitutes and “Or-Equals” A. Whenever an item of material or equipment is specified or described in the Contract Documents by using the name of a proprietary item or the name of a particular Supplier, the specification or description is intended to establish the type, function, appearance, and quality required. Unless the specification or description contains or is followed by words reading that no like, equivalent, or “or-equal” item or no substitution is permitted, other items of material or equipment of other Suppliers may be submitted to City for review under the circumstances described below. 1.“Or-Equal” Items: If in City’s sole discretion an item of material or equipment proposed by Contractor is functionally equal to that named and sufficiently similar so that no change in related Work will be required, it may be considered by City as an “or-equal” item, in which case review and approval of the proposed item may, in City’s sole discretion, be accomplished without compliance with some or all of the requirements for approval of proposed substitute items. For the purposes of this Paragraph 5.05.A.1, a proposed item of material or equipment will be considered functionally equal to an item so named if: a. City determines that: 1) it is at least equal in materials of construction, quality, durability, appearance, strength, and design characteristics; 2) it will reliably perform at least equally well the function and achieve the results imposed by the design concept of the completed Project as a functioning whole; and 3) it has a proven record of performance and availability of responsive service; and b. Contractor certifies that, if approved and incorporated into the Work: 1) there will be no increase in cost to the City or increase in Contract Time; and 00 73 10- 15 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 15 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 2) it will conform substantially to the detailed requirements of the item named in the Contract Documents. 2.Substitute Items: a. If in City’s sole discretion an item of material or equipment proposed by Contractor does not qualify as an “or-equal” item under Paragraph 5.05.A.1, it may be submitted as a proposed substitute item. b. Contractor shall submit sufficient information as provided below to allow City to determine if the item of material or equipment proposed is essentially equivalent to that named and an acceptable substitute therefor. Requests for review of proposed substitute items of material or equipment will not be accepted by City from anyone other than Contractor. c. Contractor shall make written application to City for review of a proposed substitute item of material or equipment that Contractor seeks to furnish or use. The application shall comply with Section 01 25 00 and: 1) shall certify that the proposed substitute item will: i. perform adequately the functions and achieve the results called for by the general design; ii. be similar in substance to that specified; iii. be suited to the same use as that specified; and 2) will state: i. the extent, if any, to which the use of the proposed substitute item will prejudice Contractor’s achievement of final completion on time; ii. whether use of the proposed substitute item in the Work will require a change in any of the Contract Documents (or in the provisions of any other direct contract with City for other work on the Project) to adapt the design to the proposed substitute item; iii. whether incorporation or use of the proposed substitute item in connection with the Work is subject to payment of any license fee or royalty; and 3) will identify: i. all variations of the proposed substitute item from that specified; ii. available engineering, sales, maintenance, repair, and replacement services; and 00 73 10- 16 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 16 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 4) shall contain an itemized estimate of all costs or credits that will result directly or indirectly from use of such substitute item, including costs of redesign and Damage Claims of other contractors affected by any resulting change. B.Substitute Construction Methods or Procedures: If a specific means, method, technique, sequence, or procedure of construction is expressly required by the Contract Documents, Contractor may furnish or utilize a substitute means, method, technique, sequence, or procedure of construction approved by City. Contractor shall submit sufficient information to allow City, in City’s sole discretion, to determine that the substitute proposed is equivalent to that expressly called for by the Contract Documents. Contractor shall make written application to City for review in the same manner as those provided in Paragraph 5.05.A.2. C.City’s Evaluation: City will be allowed a reasonable time within which to evaluate each proposal or submittal made pursuant to Paragraphs 5.05.A and 5.05.B. City may require Contractor to furnish additional data about the proposed substitute. City will be the sole judge of acceptability. No “or-equal” or substitute will be ordered, installed or utilized until City’s review is complete, which will be evidenced by a Change Order in the case of a substitute and an accepted Submittal for an “or-equal.” City will advise Contractor in writing of its determination. D.Special Guarantee: City may require Contractor to furnish at Contractor’s expense a special performance guarantee, warranty, or other surety with respect to any substitute. Contractor shall indemnify and hold harmless City and anyone directly or indirectly employed by them from and against any and all claims, damages, losses and expenses (including attorneys fees) arising out of the use of substituted materials or equipment. E.City’s Cost Reimbursement: City will record City’s costs in evaluating a substitute proposed or submitted by Contractor pursuant to Paragraphs 5.05.A.2 and 5.05.B. Whether or not City approves a substitute so proposed or submitted by Contractor, Contractor may be required to reimburse City for evaluating each such proposed substitute. Contractor may also be required to reimburse City for the charges for making changes in the Contract Documents. F.Contractor’s Expense: Contractor shall provide all data in support of any proposed substitute or “or-equal” at Contractor’s expense. G.Substitute Reimbursement: Costs (savings or charges) attributable to acceptance of a substitute shall be incorporated to the Contract by Participating Change Order. 5.06 Pre-Qualification of Bidders (Prime Contractors and Subcontractors) A. The Contractor and any subcontractors are required to be prequalified for the work types requiring pre-qualification 5.07 Concerning Subcontractors, Suppliers, and Others A.Minority and Women Owned Business Enterprise Compliance: 00 73 10- 17 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 17 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 Required for this Contract. (Check this box if there is any City Participation) Not Required for this Contract. It is City policy to ensure the full and equitable participation by Minority and Women Business Enterprises (MWBE) in the procurement of goods and services on a contractual basis. If the Contract Documents provide for a MWBE goal, Contractor is required to comply with the intent of the City’s MWBE Ordinance (as amended) by the following: 1. Contractor shall, upon request by City, provide complete and accurate information regarding actual work performed by a MWBE on the Contract and payment therefor. 2. Contractor will not make additions, deletions, or substitutions of accepted MWBE without written consent of the City. Any unjustified change or deletion shall be a material breach of Contract and may result in debarment in accordance with the procedures outlined in the Ordinance. 3. Contractor shall, upon request by City, allow an audit and/or examination of any books, records, or files in the possession of the Contractor that will substantiate the actual work performed by an MWBE. Material misrepresentation of any nature will be grounds for termination of the Contract. Any such misrepresentation may be grounds for disqualification of Contractor to bid on future contracts with the City for a period of not less than three years. B. Contractor shall be fully responsible to City for all acts and omissions of the Subcontractors, Suppliers, and other individuals or entities performing or furnishing any of the Work just as Contractor is responsible for Contractor’s own acts and omissions. Nothing in the Contract Documents: 1. shall create for the benefit of any such Subcontractor, Supplier, or other individual or entity any contractual relationship between City and any such Subcontractor, Supplier or other individual or entity; nor 2. shall create any obligation on the part of City to pay or to see to the payment of any moneys due any such Subcontractor, Supplier, or other individual or entity except as may otherwise be required by Laws and Regulations. C. Contractor shall be solely responsible for scheduling and coordinating the Work of Subcontractors, Suppliers, and other individuals or entities performing or furnishing any of the Work under a direct or indirect contract with Contractor. D. All Subcontractors, Suppliers, and such other individuals or entities performing or furnishing any of the Work shall communicate with City through Contractor. E. All Work performed for Contractor by a Subcontractor or Supplier will be pursuant to an appropriate agreement between Contractor and the Subcontractor or Supplier which specifically binds the Subcontractor or Supplier to the applicable terms and conditions of these Contract x 00 73 10- 18 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 18 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 Documents, Contractor shall provide City contract numbers and reference numbers to the Subcontractors and/or Suppliers. 5.08 Wage Rates Required for this Contract. Not Required for this Contract. A.Duty to pay Prevailing Wage Rates. The Contractor shall comply with all requirements of Chapter 2258, Texas Government Code (as amended), including the payment of not less than the rates determined by the City Council of the City of Fort Worth to be the prevailing wage rates in accordance with Chapter 2258. Such prevailing wage rates are included in these Contract Documents. B.Penalty for Violation. A Contractor or any Subcontractor who does not pay the prevailing wage shall, upon demand made by the City, pay to the City $60 for each worker employed for each calendar day or part of the day that the worker is paid less than the prevailing wage rates stipulated in these contract documents. This penalty shall be retained by the City to offset its administrative costs, pursuant to Texas Government Code 2258.023. C.Complaints of Violations and City Determination of Good Cause. On receipt of information, including a complaint by a worker, concerning an alleged violation of 2258.023, Texas Government Code, by a Contractor or Subcontractor, the City shall make an initial determination, before the 31st day after the date the City receives the information, as to whether good cause exists to believe that the violation occurred. The City shall notify in writing the Contractor or Subcontractor and any affected worker of its initial determination. Upon the City’s determination that there is good cause to believe the Contractor or Subcontractor has violated Chapter 2258, the City shall retain the full amounts claimed by the claimant or claimants as the difference between wages paid and wages due under the prevailing wage rates, such amounts being subtracted from successive progress payments pending a final determination of the violation. D.Arbitration Required if Violation Not Resolved. An issue relating to an alleged violation of Section 2258.023, Texas Government Code, including a penalty owed to the City or an affected worker, shall be submitted to binding arbitration in accordance with the Texas General Arbitration Act (Article 224 et seq., Revised Statutes) if the Contractor or Subcontractor and any affected worker does not resolve the issue by agreement before the 15th day after the date the City makes its initial determination pursuant to Paragraph C above. If the persons required to arbitrate under this section do not agree on an arbitrator before the 11th day after the date that arbitration is required, a district court shall appoint an arbitrator on the petition of any of the persons. The City is not a party in the arbitration. The decision and award of the arbitrator is final and binding on all parties and may be enforced in any court of competent jurisdiction. E.Records to be Maintained. The Contractor and each Subcontractor shall, for a period of three (3) years following the date of acceptance of the work, maintain records that show (i) the name and x 00 73 10- 19 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 19 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 occupation of each worker employed by the Contractor in the construction of the Work provided for in this Contract; and (ii) the actual per diem wages paid to each worker. The records shall be open at all reasonable hours for inspection by the City. The provisions of Paragraph 6.23, Right to Audit, shall pertain to this inspection. F.Progress Payments. With each progress payment or payroll period, whichever is less, the Contractor shall submit an affidavit stating that the Contractor has complied with the requirements of Chapter 2258, Texas Government Code. G.Posting of Wage Rates. The Contractor shall post prevailing wage rates in a conspicuous place at all times. H.Subcontractor Compliance. The Contractor shall include in its subcontracts and/or shall otherwise require all of its Subcontractors to comply with Paragraphs A through G above. 5.09 Patent Fees and Royalties A.To the fullest extent permitted by Laws and Regulations, Contractor shall indemnify and hold harmless City, from and against all claims, costs, losses, and damages (including but not limited to all fees and charges of engineers, architects, attorneys, and other professionals and all court or arbitration or other dispute resolution costs) arising out of or relating to any infringement of patent rights or copyrights incident to the use in the performance of the Work or resulting from the incorporation in the Work of any invention, design, process, product, or device not specified in the Contract Documents. 5.10 Laws and Regulations A. Contractor shall give all notices required by and shall comply with all Laws and Regulations applicable to the performance of the Work. Except where otherwise expressly required by applicable Laws and Regulations, the City shall not be responsible for monitoring Contractor’s compliance with any Laws or Regulations. B. If Contractor performs any Work knowing or having reason to know that it is contrary to Laws or Regulations, Contractor shall bear all claims, costs, losses, and damages (including but not limited to all fees and charges of engineers, architects, attorneys, and other professionals and all court or arbitration or other dispute resolution costs) arising out of or relating to such Work. However, it shall not be Contractor’s responsibility to make certain that the Specifications and Drawings are in accordance with Laws and Regulations, but this shall not relieve Contractor of Contractor’s obligations under Paragraph 3.01. 5.11 Use of Site and Other Areas A.Limitation on Use of Site and Other Areas: 1. Contractor shall confine construction equipment, the storage of materials and equipment, and the operations of workers to the Site and other areas permitted by Laws and Regulations, and shall not unreasonably encumber the Site and other areas with construction equipment or 00 73 10- 20 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 20 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 other materials or equipment. Contractor shall assume full responsibility for any damage to any such land or area, or to the owner or occupant thereof, or of any adjacent land or areas resulting from the performance of the Work. 2. At any time when, in the judgment of the City, the Contractor has obstructed or closed or is carrying on operations in a portion of a street, right-of-way, or easement greater than is necessary for proper execution of the Work, the City may require the Contractor to finish the section on which operations are in progress before work is commenced on any additional area of the Site. 3. Should any Damage Claim be made by any such owner or occupant because of the performance of the Work, Contractor shall promptly attempt to resolve the Damage Claim. 4.Pursuant to Paragraph 5.18, Contractor shall indemnify and hold harmless City, from and against all claims, costs, losses, and damages arising out of or relating to any claim or action, legal or equitable, brought by any such owner or occupant against City. B.Removal of Debris During Performance of the Work: During the progress of the Work Contractor shall keep the Site and other areas free from accumulations of waste materials, rubbish, and other debris. Removal and disposal of such waste materials, rubbish, and other debris shall conform to applicable Laws and Regulations. C.Site Maintenance Cleaning: 24 hours after written notice is given to the Contractor that the clean-up on the job site is proceeding in a manner unsatisfactory to the City or Developer, if the Contractor fails to correct the unsatisfactory procedure, the City may take such direct action as the City deems appropriate to correct the clean-up deficiencies cited to the Contractor in the written notice (by letter or electronic communication), and shall be entitled to recover its cost in doing so. The City may withhold Final Acceptance until clean-up is complete and cost are recovered. D.Final Site Cleaning: Prior to Final Acceptance of the Work Contractor shall clean the Site and the Work and make it ready for utilization by City or adjacent property owner. At the completion of the Work Contractor shall remove from the Site all tools, appliances, construction equipment and machinery, and surplus materials and shall restore to original condition or better all property disturbed by the Work. E.Loading Structures: Contractor shall not load nor permit any part of any structure to be loaded in any manner that will endanger the structure, nor shall Contractor subject any part of the Work or adjacent property to stresses or pressures that will endanger it. 5.12 Record Documents A. Contractor shall maintain in a safe place at the Site or in a place designated by the Contractor and approved by the City, one (1) record copy of all Drawings, Specifications, Addenda, Change Orders, Field Orders, and written interpretations and clarifications in good order and annotated to show changes made during construction. These record documents together with all approved 00 73 10- 21 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 21 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 Samples and a counterpart of all accepted Submittals will be available to City for reference. Upon completion of the Work, these record documents, any operation and maintenance manuals, and Submittals will be delivered to City prior to Final Inspection. Contractor shall include accurate locations for buried and imbedded items. 5.13 Safety and Protection A. Contractor shall be solely responsible for initiating, maintaining and supervising all safety precautions and programs in connection with the Work. Such responsibility does not relieve Subcontractors of their responsibility for the safety of persons or property in the performance of their work, nor for compliance with applicable safety Laws and Regulations. Contractor shall take all necessary precautions for the safety of, and shall provide the necessary protection to prevent damage, injury or loss to: 1. all persons on the Site or who may be affected by the Work; 2. all the Work and materials and equipment to be incorporated therein, whether in storage on or off the Site; and 3. other property at the Site or adjacent thereto, including trees, shrubs, lawns, walks, pavements, roadways, structures, utilities, and Underground Facilities not designated for removal, relocation, or replacement in the course of construction. B. Contractor shall comply with all applicable Laws and Regulations relating to the safety of persons or property, or to the protection of persons or property from damage, injury, or loss; and shall erect and maintain all necessary safeguards for such safety and protection. Contractor shall notify owners of adjacent property and of Underground Facilities and other utility owners when prosecution of the Work may affect them, and shall cooperate with them in the protection, removal, relocation, and replacement of their property. C. Contractor shall comply with the applicable requirements of City’s safety programs, if any. D. Contractor shall inform City of the specific requirements of Contractor’s safety program, if any, with which City’s employees and representatives must comply while at the Site. E. All damage, injury, or loss to any property referred to in Paragraph 5.13.A.2 or 5.13.A.3 caused, directly or indirectly, in whole or in part, by Contractor, any Subcontractor, Supplier, or any other individual or entity directly or indirectly employed by any of them to perform any of the Work, or anyone for whose acts any of them may be liable, shall be remedied by Contractor. F. Contractor’s duties and responsibilities for safety and for protection of the Work shall continue until such time as all the Work is completed and City has accepted the Work. 5.14 Safety Representative Contractor shall inform City in writing of Contractor’s designated safety representative at the Site. 00 73 10- 22 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 22 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 5.15 Hazard Communication Programs Contractor shall be responsible for coordinating any exchange of material safety data sheets or other hazard communication information required to be made available to or exchanged between or among employers in accordance with Laws or Regulations. 5.16 Submittals A. Contractor shall submit required Submittals to City for review and acceptance. Each submittal will be identified as required by City. 1. Submit number of copies specified in the General Requirements. 2. Data shown on the Submittals will be complete with respect to quantities, dimensions, specified performance and design criteria, materials, and similar data to show City the services, materials, and equipment Contractor proposes to provide and to enable City to review the information for the limited purposes required by Paragraph 5.16.C. 3. Submittals submitted as herein provided by Contractor and reviewed by City for conformance with the design concept shall be executed in conformity with the Contract Documents unless otherwise required by City. 4. When Submittals are submitted for the purpose of showing the installation in greater detail, their review shall not excuse Contractor from requirements shown on the Drawings and Specifications. 5. For-Information-Only submittals upon which the City is not expected to conduct review or take responsive action may be so identified in the Contract Documents. 6. Submit required number of Samples specified in the Specifications. 7. Clearly identify each Sample as to material, Supplier, pertinent data such as catalog numbers, the use for which intended and other data as City may require to enable City to review the submittal for the limited purposes required by Paragraph 5.16.C. B. Where a Submittal is required by the Contract Documents or the Schedule of Submittals, any related Work performed prior to City’s review and acceptance of the pertinent submittal will be at the sole expense and responsibility of Contractor. C.City’s Review: 1. City will provide timely review of required Submittals in accordance with the Schedule of Submittals acceptable to City. City’s review and acceptance will be only to determine if the items covered by the submittals will, after installation or incorporation in the Work, conform to the information given in the Contract Documents and be compatible with the design concept of the completed Project as a functioning whole as indicated by the Contract Documents. 00 73 10- 23 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 23 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 2. City’s review and acceptance will not extend to means, methods, techniques, sequences, or procedures of construction (except where a particular means, method, technique, sequence, or procedure of construction is specifically and expressly called for by the Contract Documents) or to safety precautions or programs incident thereto. The review and acceptance of a separate item as such will not indicate approval of the assembly in which the item functions. 3. City’s review and acceptance shall not relieve Contractor from responsibility for any variation from the requirements of the Contract Documents unless Contractor has complied with the requirements of Section 01 33 00 and City has given written acceptance of each such variation by specific written notation thereof incorporated in or accompanying the Submittal. City’s review and acceptance shall not relieve Contractor from responsibility for complying with the requirements of the Contract Documents. 5.17 Contractor’s General Warranty and Guarantee A. Contractor warrants and guarantees to City that all Work will be in accordance with the Contract Documents and will not be defective. City and its officers, directors, members, partners, employees, agents, consultants, and subcontractors shall be entitled to rely on representation of Contractor’s warranty and guarantee. B. Contractor’s warranty and guarantee hereunder excludes defects or damage caused by: 1. abuse, modification, or improper maintenance or operation by persons other than Contractor, Subcontractors, Suppliers, or any other individual or entity for whom Contractor is responsible; or 2. normal wear and tear under normal usage. C. Contractor’s obligation to perform and complete the Work in accordance with the Contract Documents shall be absolute. None of the following will constitute an acceptance of Work that is not in accordance with the Contract Documents or a release of Contractor’s obligation to perform the Work in accordance with the Contract Documents: 1. observations by City; 2. recommendation or payment by City or Developer of any progress or final payment; 3. the issuance of a certificate of Final Acceptance by City or any payment related thereto by City; 4. use or occupancy of the Work or any part thereof by City; 5. any review and acceptance of a Submittal by City; 6. any inspection, test, or approval by others; or 00 73 10- 24 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 24 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 7. any correction of defective Work by City. D. The Contractor shall remedy any defects or damages in the Work and pay for any damage to other work or property resulting therefrom which shall appear within a period of two (2) years from the date of Final Acceptance of the Work unless a longer period is specified and shall furnish a good and sufficient maintenance bond, complying with the requirements of Article 4.02.B. The City will give notice of observed defects with reasonable promptness. 5.18 Indemnification A. Contractor covenants and agrees to indemnify, hold harmless and defend, at its own expense, the City, its officers, servants and employees, from and against any and all claims arising out of, or alleged to arise out of, the work and services to be performed by the Contractor, its officers, agents, employees, subcontractors, licenses or invitees under this Contract. THIS INDEMNIFICATION PROVISION IS SPECIFICALLY INTENDED TO OPERATE AND BE EFFECTIVE EVEN IF IT IS ALLEGED OR PROVEN THAT ALL OR SOME OF THE DAMAGES BEING SOUGHT WERE CAUSED, IN WHOLE OR IN PART, BY ANY ACT, OMISSION OR NEGLIGENCE OF THE CITY. This indemnity provision is intended to include, without limitation, indemnity for costs, expenses and legal fees incurred by the City in defending against such claims and causes of actions. B. Contractor covenants and agrees to indemnify and hold harmless, at its own expense, the City, its officers, servants and employees, from and against any and all loss, damage or destruction of property of the City, arising out of, or alleged to arise out of, the work and services to be performed by the Contractor, its officers, agents, employees, subcontractors, licensees or invitees under this Contract. THIS INDEMNIFICATION PROVISION IS SPECIFICALLY INTENDED TO OPERATE AND BE EFFECTIVE EVEN IF IT IS ALLEGED OR PROVEN THAT ALL OR SOME OF THE DAMAGES BEING SOUGHT WERE CAUSED, IN WHOLE OR IN PART, BY ANY ACT, OMISSION OR NEGLIGENCE OF THE CITY. 5.19 Delegation of Professional Design Services A. Contractor will not be required to provide professional design services unless such services are specifically required by the Contract Documents for a portion of the Work or unless such services are required to carry out Contractor’s responsibilities for construction means, methods, techniques, sequences and procedures. B. If professional design services or certifications by a design professional related to systems, materials or equipment are specifically required of Contractor by the Contract Documents, City will specify all performance and design criteria that such services must satisfy. Contractor shall cause such services or certifications to be provided by a properly licensed professional, whose signature and seal shall appear on all drawings, calculations, specifications, certifications, and Submittals prepared by such professional. Submittals related to the Work designed or certified by such professional, if prepared by others, shall bear such professional’s written approval when submitted to City. 00 73 10- 25 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 25 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 C. City shall be entitled to rely upon the adequacy, accuracy and completeness of the services, certifications or approvals performed by such design professionals, provided City has specified to Contractor performance and design criteria that such services must satisfy. D. Pursuant to this Paragraph 5.19, City’s review and acceptance of design calculations and design drawings will be only for the limited purpose of checking for conformance with performance and design criteria given and the design concept expressed in the Contract Documents. City’s review and acceptance of Submittals (except design calculations and design drawings) will be only for the purpose stated in Paragraph 5.16.C. 5.20 Right to Audit: A. The City reserves the right to audit all projects utilizing City funds B. The Contractor agrees that the City shall, until the expiration of three (3) years after final payment under this Contract, have access to and the right to examine and photocopy any directly pertinent books, documents, papers, and records of the Contractor involving transactions relating to this Contract. Contractor agrees that the City shall have access during Regular Working Hours to all necessary Contractor facilities and shall be provided adequate and appropriate work space in order to conduct audits in compliance with the provisions of this Paragraph. The City shall give Contractor reasonable advance notice of intended audits. C. Contractor further agrees to include in all its subcontracts hereunder a provision to the effect that the subcontractor agrees that the City shall, until the expiration of three (3) years after final payment under this Contract, have access to and the right to examine and photocopy any directly pertinent books, documents, papers, and records of such Subcontractor, involving transactions to the subcontract, and further, that City shall have access during Regular Working Hours to all Subcontractor facilities, and shall be provided adequate and appropriate work space in order to conduct audits in compliance with the provisions of this Paragraph. The City shall give Subcontractor reasonable advance notice of intended audits. D. Contractor and Subcontractor agree to photocopy such documents as may be requested by the City. The City agrees to reimburse Contractor for the cost of the copies as follows at the rate published in the Texas Administrative Code in effect as of the time copying is performed. 5.21 Nondiscrimination A. The City is responsible for operating Public Transportation Programs and implementing transit- related projects, which are funded in part with Federal financial assistance awarded by the U.S. Department of Transportation and the Federal Transit Administration (FTA), without discriminating against any person in the United States on the basis of race, color, or national origin. B.Title VI, Civil Rights Act of 1964 as amended: Contractor shall comply with the requirements of the Act and the Regulations as further defined in the Supplementary Conditions for any project receiving Federal assistance. 00 73 10- 26 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 26 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 ARTICLE 6 – OTHER WORK AT THE SITE 6.01 Related Work at Site A. City may perform other work related to the Project at the Site with City’s employees, or other City contractors, or through other direct contracts therefor, or have other work performed by utility owners. If such other work is not noted in the Contract Documents, then written notice thereof will be given to Contractor prior to starting any such other work; and B. Contractor shall afford each other contractor who is a party to such a direct contract, each utility owner, and City, if City is performing other work with City’s employees or other City contractors, proper and safe access to the Site, provide a reasonable opportunity for the introduction and storage of materials and equipment and the execution of such other work, and properly coordinate the Work with theirs. Contractor shall do all cutting, fitting, and patching of the Work that may be required to properly connect or otherwise make its several parts come together and properly integrate with such other work. Contractor shall not endanger any work of others by cutting, excavating, or otherwise altering such work; provided, however, that Contractor may cut or alter others' work with the written consent of City and the others whose work will be affected. C. If the proper execution or results of any part of Contractor’s Work depends upon work performed by others under this Article 7, Contractor shall inspect such other work and promptly report to City in writing any delays, defects, or deficiencies in such other work that render it unavailable or unsuitable for the proper execution and results of Contractor’s Work. Contractor’s failure to so report will constitute an acceptance of such other work as fit and proper for integration with Contractor’s Work except for latent defects in the work provided by others. ARTICLE 7 – CITY’S RESPONSIBILITIES 7.01 Inspections, Tests, and Approvals City’s responsibility with respect to certain inspections, tests, and approvals is set forth in Paragraph 11.03. 7.02 Limitations on City’s Responsibilities A. The City shall not supervise, direct, or have control or authority over, nor be responsible for, Contractor’s means, methods, techniques, sequences, or procedures of construction, or the safety precautions and programs incident thereto, or for any failure of Contractor to comply with Laws and Regulations applicable to the performance of the Work. City will not be responsible for Contractor’s failure to perform the Work in accordance with the Contract Documents. B. City will notify the Contractor of applicable safety plans pursuant to Paragraph 5.13. 00 73 10- 27 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 27 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 7.03 Compliance with Safety Program While at the Site, City’s employees and representatives shall comply with the specific applicable requirements of Contractor’s safety programs of which City has been informed pursuant to Paragraph 5.13. ARTICLE 8 – CITY’S OBSERVATION STATUS DURING CONSTRUCTION 8.01 City’s Project Representative City will provide one or more Project Representative(s) during the construction period. The duties and responsibilities and the limitations of authority of City’s representative during construction are set forth in the Contract Documents. A. City’s Project Representative will make visits to the Site at intervals appropriate to the various stages of construction as City deems necessary in order to observe the progress that has been made and the quality of the various aspects of Contractor’s executed Work. Based on information obtained during such visits and observations, City’s Project Representative will determine, in general, if the Work is proceeding in accordance with the Contract Documents. City’s Project Representative will not be required to make exhaustive or continuous inspections on the Site to check the quality or quantity of the Work. City’s Project Representative’s efforts will be directed toward providing City a greater degree of confidence that the completed Work will conform generally to the Contract Documents. B. City’s Project Representative’s visits and observations are subject to all the limitations on authority and responsibility in the Contract Documents. 8.02 Authorized Variations in Work City’s Project Representative may authorize minor variations in the Work from the requirements of the Contract Documents which do not involve an adjustment in the Contract Price or the Contract Time and are compatible with the design concept of the completed Project as a functioning whole as indicated by the Contract Documents. These may be accomplished by a Field Order and will be binding on City Developer, and also on Contractor, who shall perform the Work involved promptly. 8.03 Rejecting Defective Work City will have authority to reject Work which City’s Project Representative believes to be defective, or will not produce a completed Project that conforms to the Contract Documents or that will prejudice the integrity of the design concept of the completed Project as a functioning whole as indicated by the Contract Documents. City will have authority to conduct special inspection or testing of the Work as provided in Article 11, whether or not the Work is fabricated, installed, or completed. 00 73 10- 28 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 28 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 8.04 Determinations for Work Performed Contractor will determine the actual quantities and classifications of Work performed. City’s Project Representative will review with Contractor the preliminary determinations on such matters before rendering a written recommendation. City’s written decision will be final (except as modified to reflect changed factual conditions or more accurate data). ARTICLE 9 – CHANGES IN THE WORK 9.01 Authorized Changes in the Work A. Without invalidating the Contract and without notice to any surety, City may, at any time or from time to time, order Extra Work. Upon notice of such Extra Work, Contractor shall promptly proceed with the Work involved which will be performed under the applicable conditions of the Contract Documents (except as otherwise specifically provided). Extra Work shall be memorialized by a Participating Change Order which may or may not precede an order of Extra work. B. For minor changes of Work not requiring changes to Contract Time or Contract Price on a project with City participation, a Field Order may be issued by the City. 9.02 Notification to Surety If the provisions of any bond require notice to be given to a surety of any change affecting the general scope of the Work or the provisions of the Contract Documents (including, but not limited to, Contract Price or Contract Time), the giving of any such notice will be Contractor’s responsibility. The amount of each applicable bond will be adjusted by the Contractor to reflect the effect of any such change. ARTICLE 10 – CHANGE OF CONTRACT PRICE; CHANGE OF CONTRACT TIME 10.01 Change of Contract Price A. The Contract Price may only be changed by a Participating Change Order for projects with City participation. 10.02 Change of Contract Time A. The Contract Time may only be changed by a Participating Change Order for projects with City participation. 10.03 Delays A. If Contractor is delayed, City shall not be liable to Contractor for any claims, costs, losses, or damages (including but not limited to all fees and charges of engineers, architects, attorneys, and other professionals and all court or arbitration or other dispute resolution costs) sustained by Contractor on or in connection with any other project or anticipated project. 00 73 10- 29 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 29 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 ARTICLE 11 – TESTS AND INSPECTIONS; CORRECTION, REMOVAL OR ACCEPTANCE OF DEFECTIVE WORK 11.01 Notice of Defects Notice of all defective Work of which City has actual knowledge will be given to Contractor. Defective Work may be rejected, corrected, or accepted as provided in this Article 13. 11.02 Access to Work City, independent testing laboratories, and governmental agencies with jurisdictional interests will have access to the Site and the Work at reasonable times for their observation, inspection, and testing. Contractor shall provide them proper and safe conditions for such access and advise them of Contractor’s safety procedures and programs so that they may comply therewith as applicable. 11.03 Tests and Inspections A. Contractor shall give City timely notice of readiness of the Work for all required inspections, tests, or approvals and shall cooperate with inspection and testing personnel to facilitate required inspections or tests. B. If Contract Documents, Laws or Regulations of any public body having jurisdiction require any of the Work (or part thereof) to be inspected, tested, or approved, Contractor shall assume full responsibility for arranging and obtaining such independent inspections, tests, retests or approvals, pay all costs in connection therewith, and furnish City the required certificates of inspection or approval; excepting, however, those fees specifically identified in the Supplementary Conditions or any Texas Department of Licensure and Regulation (TDLR) inspections, which shall be paid as described in the Supplementary Conditions. C. Contractor shall be responsible for arranging and obtaining and shall pay all costs in connection with any inspections, tests, re-tests, or approvals required for City’s acceptance of materials or equipment to be incorporated in the Work; or acceptance of materials, mix designs, or equipment submitted for approval prior to Contractor’s purchase thereof for incorporation in the Work. Such inspections, tests, re-tests, or approvals shall be performed by organizations approved by City. D. City may arrange for the services of an independent testing laboratory (“Testing Lab”) to perform any inspections or tests (“Testing”) for any part of the Work, as determined solely by City. 1. City will coordinate such Testing to the extent possible, with Contractor; 2. Should any Testing under this Section 11.03 D result in a “fail”, “did not pass” or other similar negative result, the Contractor shall be responsible for paying for any and all retests. Contractor’s cancellation without cause of City initiated Testing shall be deemed a negative result and require a retest. 00 73 10- 30 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 30 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 3. Any amounts owed for any retest under this Section 11.03 D shall be paid directly to the Testing Lab by Contractor. City will forward all invoices for retests to Developer/Contractor. 4. If Contractor fails to pay the Testing Lab, City will not issue a letter of Final Acceptance until the Testing Lab is Paid E. If any Work (or the work of others) that is to be inspected, tested, or approved is covered by Contractor without written concurrence of City, Contractor shall, if requested by City, uncover such Work for observation. 11.04 Uncovering Work A. If any Work is covered contrary to the Contract Documents or specific instructions by the City, it must, if requested by City, be uncovered for City’s observation and replaced at Contractor’s expense. 11.05 City May Stop the Work If the Work is defective, or Contractor fails to supply sufficient skilled workers or suitable materials or equipment, or fails to perform the Work in such a way that the completed Work will conform to the Contract Documents, City may order Contractor to stop the Work, or any portion thereof, until the cause for such order has been eliminated; however, this right of City to stop the Work shall not give rise to any duty on the part of City to exercise this right for the benefit of Contractor, any Subcontractor, any Supplier, any other individual or entity, or any surety for, or employee or agent of any of them. 11.06 Correction or Removal of Defective Work A. Promptly after receipt of written notice, Contractor shall correct all defective Work pursuant to an acceptable schedule, whether or not fabricated, installed, or completed, or, if the Work has been rejected by City, remove it from the Project and replace it with Work that is not defective. Contractor shall pay all claims, costs, additional testing, losses, and damages (including but not limited to all fees and charges of engineers, architects, attorneys, and other professionals and all court or arbitration or other dispute resolution costs) arising out of or relating to such correction or removal (including but not limited to all costs of repair or replacement of work of others). Failure to require the removal of any defective Work shall not constitute acceptance of such Work. B. When correcting defective Work under the terms of this Paragraph 11.06 or Paragraph 11.07, Contractor shall take no action that would void or otherwise impair City’s special warranty and guarantee, if any, on said Work. 11.07 Correction Period A. If within two (2) years after the date of Final Acceptance (or such longer period of time as may be prescribed by the terms of any applicable special guarantee required by the Contract 00 73 10- 31 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 31 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 Documents), any Work is found to be defective, or if the repair of any damages to the land or areas made available for Contractor’s use by City or permitted by Laws and Regulations as contemplated in Paragraph 5.10.A is found to be defective, Contractor shall promptly, without cost to City and in accordance with City’s written instructions: 1. repair such defective land or areas; or 2. correct such defective Work; or 3. if the defective Work has been rejected by City, remove it from the Project and replace it with Work that is not defective, and 4. satisfactorily correct or repair or remove and replace any damage to other Work, to the work of others or other land or areas resulting therefrom. B. If Contractor does not promptly comply with the terms of City’s written instructions, or in an emergency where delay would cause serious risk of loss or damage, City may have the defective Work corrected or repaired or may have the rejected Work removed and replaced. All claims, costs, losses, and damages (including but not limited to all fees and charges of engineers, architects, attorneys, and other professionals and all court or other dispute resolution costs) arising out of or relating to such correction or repair or such removal and replacement (including but not limited to all costs of repair or replacement of work of others) will be paid by Contractor. C. Where defective Work (and damage to other Work resulting therefrom) has been corrected or removed and replaced under this Paragraph 11.07, the correction period hereunder with respect to such Work may be required to be extended for an additional period of one year after the end of the initial correction period. City shall provide 30 days written notice to Contractor and Developer should such additional warranty coverage be required. Contractor’s obligations under this Paragraph 11.07 are in addition to any other obligation or warranty. The provisions of this Paragraph 11.07 shall not be construed as a substitute for, or a waiver of, the provisions of any applicable statute of limitation or repose. 11.08 City May Correct Defective Work A. If Contractor fails within a reasonable time after written notice from City to correct defective Work, or to remove and replace rejected Work as required by City in accordance with Paragraph 11.06.A, or if Contractor fails to perform the Work in accordance with the Contract Documents, or if Contractor fails to comply with any other provision of the Contract Documents, City may, after seven (7) days written notice to Contractor and the Developer, correct, or remedy any such deficiency. B. In exercising the rights and remedies under this Paragraph 11.09, City shall proceed expeditiously. In connection with such corrective or remedial action, City may exclude Contractor from all or part of the Site, take possession of all or part of the Work and suspend Contractor’s services related thereto, and incorporate in the Work all materials and equipment incorporated in the Work, stored at the Site or for which City has paid Contractor but which are 00 73 10- 32 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 32 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 stored elsewhere. Contractor shall allow City, City’s representatives, agents, consultants, employees, and City’s other contractors, access to the Site to enable City to exercise the rights and remedies under this Paragraph. C. All claims, costs, losses, and damages (including but not limited to all fees and charges of engineers, architects, attorneys, and other professionals and all court or other dispute resolution costs) incurred or sustained by City in exercising the rights and remedies under this Paragraph 13.09 will be charged against Contractor, and a Change Order will be issued incorporating the necessary revisions in the Contract Documents with respect to the Work; and City shall be entitled to an appropriate decrease in the Contract Price. D. Contractor shall not be allowed an extension of the Contract Time because of any delay in the performance of the Work attributable to the exercise of City’s rights and remedies under this Paragraph 11.09. ARTICLE 12 – COMPLETION 12.01 Contractor’s Warranty of Title Contractor warrants and guarantees that title to all Work, materials, and equipment covered by any Application for Payment will pass to City no later than the time of Final Acceptance and shall be free and clear of all Liens. 12.02 Partial Utilization A. Prior to Final Acceptance of all the Work, City may use or occupy any substantially completed part of the Work which has specifically been identified in the Contract Documents, or which City, determines constitutes a separately functioning and usable part of the Work that can be used by City for its intended purpose without significant interference with Contractor’s performance of the remainder of the Work. City at any time may notify Contractor in writing to permit City to use or occupy any such part of the Work which City determines to be ready for its intended use, subject to the following conditions: 1. Contractor at any time may notify City in writing that Contractor considers any such part of the Work ready for its intended use. 2. Within a reasonable time after notification as enumerated in Paragraph 14.05.A.1, City and Contractor shall make an inspection of that part of the Work to determine its status of completion. If City does not consider that part of the Work to be substantially complete, City will notify Contractor in writing giving the reasons therefor. 3. Partial Utilization will not constitute Final Acceptance by City. 12.03 Final Inspection A. Upon written notice from Contractor that the entire Work is complete in accordance with the Contract Documents: 00 73 10- 33 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 33 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 1. within 10 days, City will schedule a Final Inspection with Contractor. 2. City will notify Contractor in writing of all particulars in which this inspection reveals that the Work is incomplete or defective. Contractor shall immediately take such measures as are necessary to complete such Work or remedy such deficiencies. 12.04 Final Acceptance A. Upon completion by Contractor to City’s satisfaction, of any additional Work identified in the Final Inspection, City will issue to Contractor a letter of Final Acceptance upon the satisfaction of the following: 1. All documentation called for in the Contract Documents, including but not limited to the evidence of insurance required by Paragraph 5.03; 2. consent of the surety, if any, to Final Acceptance; 3. a list of all pending or released Damage Claims against City that Contractor believes are unsettled; and 4. affidavits of payments and complete and legally effective releases or waivers (satisfactory to City) of all Lien rights arising out of or Liens filed in connection with the Work. 5. after all Damage Claims have been resolved: a. directly by the Contractor or; b. Contractor provides evidence that the Damage Claim has been reported to Contractor’s insurance provider for resolution. 6. Issuing Final Acceptance by the City shall not relieve the Contractor of any guarantees or other requirements of the Contract Documents which specifically continue thereafter. ARTICLE 13 – SUSPENSION OF WORK 13.01 City May Suspend Work A. At any time and without cause, City may suspend the Work or any portion thereof by written notice to Contractor and which may fix the date on which Work will be resumed. Contractor shall resume the Work on the date so fixed. During temporary suspension of the Work covered by these Contract Documents, for any reason, the City will stop contract time on City participation projects. B. Should the Contractor not be able to complete a portion of the Project due to causes beyond the control of and without the fault or negligence of the Contractor, and should it be determined by mutual consent of the Contractor and City that a solution to allow construction to proceed is not 00 73 10- 34 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 34 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 available within a reasonable period of time, Contractor may request an extension in Contract Time, directly attributable to any such suspension. C. If it should become necessary to suspend the Work for an indefinite period, the Contractor shall store all materials in such a manner that they will not obstruct or impede the public unnecessarily nor become damaged in any way, and he shall take every precaution to prevent damage or deterioration of the work performed; he shall provide suitable drainage about the work, and erect temporary structures where necessary. ARTICLE 14 – MISCELLANEOUS 14.01 Giving Notice A. Whenever any provision of the Contract Documents requires the giving of written notice, it will be deemed to have been validly given if: 1. delivered in person to the individual or to a member of the firm or to an officer of the corporation for whom it is intended; or 2. delivered at or sent by registered or certified mail, postage prepaid, to the last business address known to the giver of the notice. B. Business address changes must be promptly made in writing to the other party. C. Whenever the Contract Documents specifies giving notice by electronic means such electronic notice shall be deemed sufficient upon confirmation of receipt by the receiving party. 14.02 Computation of Times When any period of time is referred to in the Contract Documents by days, it will be computed to exclude the first and include the last day of such period. If the last day of any such period falls on a Saturday or Sunday or on a day made a legal holiday the next Working Day shall become the last day of the period. 14.03 Cumulative Remedies The duties and obligations imposed by these General Conditions and the rights and remedies available hereunder to the parties hereto are in addition to, and are not to be construed in any way as a limitation of, any rights and remedies available to any or all of them which are otherwise imposed or available by Laws or Regulations, by special warranty or guarantee, or by other provisions of the Contract Documents. The provisions of this Paragraph will be as effective as if repeated specifically in the Contract Documents in connection with each particular duty, obligation, right, and remedy to which they apply. 00 73 10- 35 Standard City Conditions Of The Construction Contract For Developer Awarded Projects Page 35 of 35 CITY OF FORT WORTH STANDARD CITY CONDITIONS – DEVELOPER AWARDED PROJECTS Revised: January 10, 2013 14.04 Survival of Obligations All representations, indemnifications, warranties, and guarantees made in, required by, or given in accordance with the Contract Documents, as well as all continuing obligations indicated in the Contract Documents, will survive final payment, completion, and acceptance of the Work or termination or completion of the Contract or termination of the services of Contractor. 14.05 Headings Article and paragraph headings are inserted for convenience only and do not constitute parts of these General Conditions. DIVISION 01 GENERAL REQUIREMENTS  '$36800$5<2):25. 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'HYHORSHU$ZDUGHG3URMHFWV &LW\3URMHFW 5HYLVHG'HFHPEHU  6(&7,21 6800$5<2):25. 3$57*(1(5$/ 6800$5< $6HFWLRQ,QFOXGHV 6XPPDU\RI:RUNWREHSHUIRUPHGLQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWV %'HYLDWLRQVIURPWKLV&LW\RI)RUW:RUWK6WDQGDUG6SHFLILFDWLRQ 1RQH &5HODWHG6SHFLILFDWLRQ6HFWLRQVLQFOXGHEXWDUHQRWQHFHVVDULO\OLPLWHGWR 'LYLVLRQ%LGGLQJ5HTXLUHPHQWV&RQWUDFW)RUPVDQG&RQGLWLRQVRIWKH&RQWUDFW 'LYLVLRQ*HQHUDO5HTXLUHPHQWV 35,&($1'3$<0(17352&('85(6 $0HDVXUHPHQWDQG3D\PHQW :RUNDVVRFLDWHGZLWKWKLV,WHPLVFRQVLGHUHGVXEVLGLDU\WRWKHYDULRXVLWHPVELG 1RVHSDUDWHSD\PHQWZLOOEHDOORZHGIRUWKLV,WHP 5()(5(1&(6>12786('@ $'0,1,675$7,9(5(48,5(0(176 $:RUN&RYHUHGE\&RQWUDFW'RFXPHQWV :RUNLVWRLQFOXGHIXUQLVKLQJDOOODERUPDWHULDOVDQGHTXLSPHQWDQGSHUIRUPLQJ DOO:RUNQHFHVVDU\IRUWKLVFRQVWUXFWLRQSURMHFWDVGHWDLOHGLQWKH'UDZLQJVDQG 6SHFLILFDWLRQV %6XEVLGLDU\:RUN $Q\DQGDOO:RUNVSHFLILFDOO\JRYHUQHGE\GRFXPHQWDU\UHTXLUHPHQWVIRUWKH SURMHFWVXFKDVFRQGLWLRQVLPSRVHGE\WKH'UDZLQJVRU&RQWUDFW'RFXPHQWVLQ ZKLFKQRVSHFLILFLWHPIRUELGKDVEHHQSURYLGHGIRULQWKH3URSRVDODQGWKHLWHPLV QRWDW\SLFDOXQLWELGLWHPLQFOXGHGRQWKHVWDQGDUGELGLWHPOLVWWKHQWKHLWHPVKDOO EHFRQVLGHUHGDVDVXEVLGLDU\LWHPRI:RUNWKHFRVWRIZKLFKVKDOOEHLQFOXGHGLQ WKHSULFHELGLQWKH3URSRVDOIRUYDULRXVELGLWHPV &8VHRI3UHPLVHV &RRUGLQDWHXVHVRISUHPLVHVXQGHUGLUHFWLRQRIWKH&LW\ $VVXPHIXOOUHVSRQVLELOLW\IRUSURWHFWLRQDQGVDIHNHHSLQJRIPDWHULDOVDQG HTXLSPHQWVWRUHGRQWKH6LWH 8VHDQGRFFXS\RQO\SRUWLRQVRIWKHSXEOLFVWUHHWVDQGDOOH\VRURWKHUSXEOLFSODFHV RURWKHUULJKWVRIZD\DVSURYLGHGIRULQWKHRUGLQDQFHVRIWKH&LW\DVVKRZQLQWKH &RQWUDFW'RFXPHQWVRUDVPD\EHVSHFLILFDOO\DXWKRUL]HGLQZULWLQJE\WKH&LW\ D$UHDVRQDEOHDPRXQWRIWRROVPDWHULDOVDQGHTXLSPHQWIRUFRQVWUXFWLRQ SXUSRVHVPD\EHVWRUHGLQVXFKVSDFHEXWQRPRUHWKDQLVQHFHVVDU\WRDYRLG GHOD\LQWKHFRQVWUXFWLRQRSHUDWLRQV  '$36800$5<2):25. 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'HYHORSHU$ZDUGHG3URMHFWV &LW\3URMHFW 5HYLVHG'HFHPEHU  E([FDYDWHGDQGZDVWHPDWHULDOVVKDOOEHVWRUHGLQVXFKDZD\DVQRWWRLQWHUIHUH ZLWKWKHXVHRIVSDFHVWKDWPD\EHGHVLJQDWHGWREHOHIWIUHHDQGXQREVWUXFWHG DQGVRDVQRWWRLQFRQYHQLHQFHRFFXSDQWVRIDGMDFHQWSURSHUW\ F,IWKHVWUHHWLVRFFXSLHGE\UDLOURDGWUDFNVWKH:RUNVKDOOEHFDUULHGRQLQVXFK PDQQHUDVQRWWRLQWHUIHUHZLWKWKHRSHUDWLRQRIWKHUDLOURDG  $OO:RUNVKDOOEHLQDFFRUGDQFHZLWKUDLOURDGUHTXLUHPHQWVVHWIRUWKLQ 'LYLVLRQDVZHOODVWKHUDLOURDGSHUPLW ':RUNZLWKLQ(DVHPHQWV 'RQRWHQWHUXSRQSULYDWHSURSHUW\IRUDQ\SXUSRVHZLWKRXWKDYLQJSUHYLRXVO\ REWDLQHGSHUPLVVLRQIURPWKHRZQHURIVXFKSURSHUW\ 'RQRWVWRUHHTXLSPHQWRUPDWHULDORQSULYDWHSURSHUW\XQOHVVDQGXQWLOWKH VSHFLILHGDSSURYDORIWKHSURSHUW\RZQHUKDVEHHQVHFXUHGLQZULWLQJE\WKH &RQWUDFWRUDQGDFRS\IXUQLVKHGWRWKH&LW\ 8QOHVVVSHFLILFDOO\SURYLGHGRWKHUZLVHFOHDUDOOULJKWVRIZD\RUHDVHPHQWVRI REVWUXFWLRQVZKLFKPXVWEHUHPRYHGWRPDNHSRVVLEOHSURSHUSURVHFXWLRQRIWKH :RUNDVDSDUWRIWKHSURMHFWFRQVWUXFWLRQRSHUDWLRQV 3UHVHUYHDQGXVHHYHU\SUHFDXWLRQWRSUHYHQWGDPDJHWRDOOWUHHVVKUXEEHU\SODQWV ODZQVIHQFHVFXOYHUWVFXUELQJDQGDOORWKHUW\SHVRIVWUXFWXUHVRULPSURYHPHQWV WRDOOZDWHUVHZHUDQGJDVOLQHVWRDOOFRQGXLWVRYHUKHDGSROHOLQHVRU DSSXUWHQDQFHVWKHUHRILQFOXGLQJWKHFRQVWUXFWLRQRIWHPSRUDU\IHQFHVDQGWRDOO RWKHUSXEOLFRUSULYDWHSURSHUW\DGMDFHQWWRWKH:RUN 1RWLI\WKHSURSHUUHSUHVHQWDWLYHVRIWKHRZQHUVRURFFXSDQWVRIWKHSXEOLFRUSULYDWH ODQGVRILQWHUHVWLQODQGVZKLFKPLJKWEHDIIHFWHGE\WKH:RUN D6XFKQRWLFHVKDOOEHPDGHDWOHDVWKRXUVLQDGYDQFHRIWKHEHJLQQLQJRIWKH :RUN E1RWLFHVVKDOOEHDSSOLFDEOHWRERWKSXEOLFDQGSULYDWHXWLOLW\FRPSDQLHVDQGDQ\ FRUSRUDWLRQFRPSDQ\LQGLYLGXDORURWKHUHLWKHUDVRZQHUVRURFFXSDQWV ZKRVHODQGRULQWHUHVWLQODQGPLJKWEHDIIHFWHGE\WKH:RUN F%HUHVSRQVLEOHIRUDOOGDPDJHRULQMXU\WRSURSHUW\RIDQ\FKDUDFWHUUHVXOWLQJ IURPDQ\DFWRPLVVLRQQHJOHFWRUPLVFRQGXFWLQWKHPDQQHURUPHWKRGRU H[HFXWLRQRIWKH:RUNRUDWDQ\WLPHGXHWRGHIHFWLYHZRUNPDWHULDORU HTXLSPHQW )HQFH D5HVWRUHDOOIHQFHVHQFRXQWHUHGDQGUHPRYHGGXULQJFRQVWUXFWLRQRIWKH3URMHFW WRWKHRULJLQDORUDEHWWHUWKDQRULJLQDOFRQGLWLRQ E(UHFWWHPSRUDU\IHQFLQJLQSODFHRIWKHIHQFLQJUHPRYHGZKHQHYHUWKH:RUNLV QRWLQSURJUHVVDQGZKHQWKHVLWHLVYDFDWHGRYHUQLJKWDQGRUDWDOOWLPHVWR SURYLGHVLWHVHFXULW\ F7KHFRVWIRUDOOIHQFHZRUNZLWKLQHDVHPHQWVLQFOXGLQJUHPRYDOWHPSRUDU\ FORVXUHVDQGUHSODFHPHQWVKDOOEHVXEVLGLDU\WRWKHYDULRXVLWHPVELGLQWKH SURMHFWSURSRVDOXQOHVVDELGLWHPLVVSHFLILFDOO\SURYLGHGLQWKHSURSRVDO  '$36800$5<2):25. 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'HYHORSHU$ZDUGHG3URMHFWV &LW\3URMHFW 5HYLVHG'HFHPEHU  68%0,77$/6>12786('@ $&7,2168%0,77$/6,1)250$7,21$/68%0,77$/6>12786('@ &/26(28768%0,77$/6>12786('@ 0$,17(1$1&(0$7(5,$/68%0,77$/6>12786('@ 48$/,7<$6685$1&(>12786('@ '(/,9(5<6725$*($1'+$1'/,1*>12786('@ ),(/'>6,7(@&21',7,216>12786('@ :$55$17<>12786('@ 3$57352'8&76>12786('@ 3$57(;(&87,21>12786('@ (1'2)6(&7,21  5HYLVLRQ/RJ '$7( 1$0( 6800$5<2)&+$1*(       '$368%67,787,21352&('85(6 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$XJXVW  6(&7,21 68%67,787,21352&('85(6 3$57*(1(5$/ 6800$5< $6HFWLRQ,QFOXGHV 7KHSURFHGXUHIRUUHTXHVWLQJWKHDSSURYDORIVXEVWLWXWLRQRIDSURGXFWWKDWLVQRW HTXLYDOHQWWRDSURGXFWZKLFKLVVSHFLILHGE\GHVFULSWLYHRUSHUIRUPDQFHFULWHULDRU GHILQHGE\UHIHUHQFHWRRUPRUHRIWKHIROORZLQJ D1DPHRIPDQXIDFWXUHU E1DPHRIYHQGRU F7UDGHQDPH G&DWDORJQXPEHU 6XEVWLWXWLRQVDUHQRWRUHTXDOV %'HYLDWLRQVIURPWKLV&LW\RI)RUW:RUWK6WDQGDUG6SHFLILFDWLRQ 1RQH &5HODWHG6SHFLILFDWLRQ6HFWLRQVLQFOXGHEXWDUHQRWQHFHVVDULO\OLPLWHGWR 'LYLVLRQ±%LGGLQJ5HTXLUHPHQWV&RQWUDFW)RUPVDQG&RQGLWLRQVRIWKH&RQWUDFW 'LYLVLRQ±*HQHUDO5HTXLUHPHQWV 35,&($1'3$<0(17352&('85(6 $0HDVXUHPHQWDQG3D\PHQW :RUNDVVRFLDWHGZLWKWKLV,WHPLVFRQVLGHUHGVXEVLGLDU\WRWKHYDULRXVLWHPVELG1R VHSDUDWHSD\PHQWZLOOEHDOORZHGIRUWKLV,WHP 5()(5(1&(6>12786('@ $'0,1,675$7,9(5(48,5(0(176 $5HTXHVWIRU6XEVWLWXWLRQ*HQHUDO :LWKLQGD\VDIWHUDZDUGRI&RQWUDFW XQOHVVQRWHGRWKHUZLVH WKH&LW\ZLOO FRQVLGHUIRUPDOUHTXHVWVIURP&RQWUDFWRUIRUVXEVWLWXWLRQRISURGXFWVLQSODFHRI WKRVHVSHFLILHG &HUWDLQW\SHVRIHTXLSPHQWDQGNLQGVRIPDWHULDODUHGHVFULEHGLQ6SHFLILFDWLRQVE\ PHDQVRIUHIHUHQFHVWRQDPHVRIPDQXIDFWXUHUVDQGYHQGRUVWUDGHQDPHVRUFDWDORJ QXPEHUV D:KHQWKLVPHWKRGRIVSHFLI\LQJLVXVHGLWLVQRWLQWHQGHGWRH[FOXGHIURP FRQVLGHUDWLRQRWKHUSURGXFWVEHDULQJRWKHUPDQXIDFWXUHU VRUYHQGRU VQDPHV WUDGHQDPHVRUFDWDORJQXPEHUVSURYLGHGVDLGSURGXFWVDUHRUHTXDOVDV GHWHUPLQHGE\&LW\ 2WKHUW\SHVRIHTXLSPHQWDQGNLQGVRIPDWHULDOPD\EHDFFHSWDEOHVXEVWLWXWLRQV XQGHUWKHIROORZLQJFRQGLWLRQV D2UHTXDOVDUHXQDYDLODEOHGXHWRVWULNHGLVFRQWLQXHGSURGXFWLRQRISURGXFWV PHHWLQJVSHFLILHGUHTXLUHPHQWVRURWKHUIDFWRUVEH\RQGFRQWURORI&RQWUDFWRU RU  '$368%67,787,21352&('85(6 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$XJXVW  E&RQWUDFWRUSURSRVHVDFRVWDQGRUWLPHUHGXFWLRQLQFHQWLYHWRWKH&LW\ 68%0,77$/6 $6HH5HTXHVWIRU6XEVWLWXWLRQ)RUP DWWDFKHG  %3URFHGXUHIRU5HTXHVWLQJ6XEVWLWXWLRQ 6XEVWLWXWLRQVKDOOEHFRQVLGHUHGRQO\ D$IWHUDZDUGRI&RQWUDFW E8QGHUWKHFRQGLWLRQVVWDWHGKHUHLQ 6XEPLWFRSLHVRIHDFKZULWWHQUHTXHVWIRUVXEVWLWXWLRQLQFOXGLQJ D'RFXPHQWDWLRQ  &RPSOHWHGDWDVXEVWDQWLDWLQJFRPSOLDQFHRISURSRVHGVXEVWLWXWLRQZLWK &RQWUDFW'RFXPHQWV  'DWDUHODWLQJWRFKDQJHVLQFRQVWUXFWLRQVFKHGXOHZKHQDUHGXFWLRQLV SURSRVHG  'DWDUHODWLQJWRFKDQJHVLQFRVW E)RUSURGXFWV  3URGXFWLGHQWLILFDWLRQ D 0DQXIDFWXUHU VQDPH E 7HOHSKRQHQXPEHUDQGUHSUHVHQWDWLYHFRQWDFWQDPH F 6SHFLILFDWLRQ6HFWLRQRU'UDZLQJUHIHUHQFHRIRULJLQDOO\VSHFLILHG SURGXFWLQFOXGLQJGLVFUHWHQDPHRUWDJQXPEHUDVVLJQHGWRRULJLQDO SURGXFWLQWKH&RQWUDFW'RFXPHQWV  0DQXIDFWXUHU VOLWHUDWXUHFOHDUO\PDUNHGWRVKRZFRPSOLDQFHRISURSRVHG SURGXFWZLWK&RQWUDFW'RFXPHQWV  ,WHPL]HGFRPSDULVRQRIRULJLQDODQGSURSRVHGSURGXFWDGGUHVVLQJSURGXFW FKDUDFWHULVWLFVLQFOXGLQJEXWQRWQHFHVVDULO\OLPLWHGWR D 6L]H E &RPSRVLWLRQRUPDWHULDOVRIFRQVWUXFWLRQ F :HLJKW G (OHFWULFDORUPHFKDQLFDOUHTXLUHPHQWV  3URGXFWH[SHULHQFH D /RFDWLRQRISDVWSURMHFWVXWLOL]LQJSURGXFW E 1DPHDQGWHOHSKRQHQXPEHURISHUVRQVDVVRFLDWHGZLWKUHIHUHQFHG SURMHFWVNQRZOHGJHDEOHFRQFHUQLQJSURSRVHGSURGXFW F $YDLODEOHILHOGGDWDDQGUHSRUWVDVVRFLDWHGZLWKSURSRVHGSURGXFW  6DPSOHV D 3URYLGHDWUHTXHVWRI&LW\ E 6DPSOHVEHFRPHWKHSURSHUW\RIWKH&LW\ F)RUFRQVWUXFWLRQPHWKRGV  'HWDLOHGGHVFULSWLRQRISURSRVHGPHWKRG  ,OOXVWUDWLRQGUDZLQJV &$SSURYDORU5HMHFWLRQ :ULWWHQDSSURYDORUUHMHFWLRQRIVXEVWLWXWLRQJLYHQE\WKH&LW\ &LW\UHVHUYHVWKHULJKWWRUHTXLUHSURSRVHGSURGXFWWRFRPSO\ZLWKFRORUDQGSDWWHUQ RIVSHFLILHGSURGXFWLIQHFHVVDU\WRVHFXUHGHVLJQLQWHQW ,QWKHHYHQWWKHVXEVWLWXWLRQLVDSSURYHGLIDUHGXFWLRQLQFRVWRUWLPHUHVXOWVLWZLOO EHGRFXPHQWHGE\&KDQJH2UGHU  '$368%67,787,21352&('85(6 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$XJXVW  6XEVWLWXWLRQZLOOEHUHMHFWHGLI D6XEPLWWDOLVQRWWKURXJKWKH&RQWUDFWRUZLWKKLVVWDPSRIDSSURYDO E5HTXHVWLVQRWPDGHLQDFFRUGDQFHZLWKWKLV6SHFLILFDWLRQ6HFWLRQ F,QWKH'HYHORSHU¶VRSLQLRQDFFHSWDQFHZLOOUHTXLUHVXEVWDQWLDOUHYLVLRQRIWKH RULJLQDOGHVLJQ G,QWKH&LW\¶VRU'HYHORSHU¶VRSLQLRQVXEVWLWXWLRQZLOOQRWSHUIRUPDGHTXDWHO\ WKHIXQFWLRQFRQVLVWHQWZLWKWKHGHVLJQLQWHQW $&7,2168%0,77$/6,1)250$7,21$/68%0,77$/6>12786('@ &/26(28768%0,77$/6>12786('@ 0$,17(1$1&(0$7(5,$/68%0,77$/6>12786('@ 48$/,7<$6685$1&( $,QPDNLQJUHTXHVWIRUVXEVWLWXWLRQRULQXVLQJDQDSSURYHGSURGXFWWKH&RQWUDFWRU UHSUHVHQWVWKDWWKH&RQWUDFWRU +DVLQYHVWLJDWHGSURSRVHGSURGXFWDQGKDVGHWHUPLQHGWKDWLWLVDGHTXDWHRU VXSHULRULQDOOUHVSHFWVWRWKDWVSHFLILHGDQGWKDWLWZLOOSHUIRUPIXQFWLRQIRUZKLFKLW LVLQWHQGHG :LOOSURYLGHVDPHJXDUDQWHHIRUVXEVWLWXWHLWHPDVIRUSURGXFWVSHFLILHG :LOOFRRUGLQDWHLQVWDOODWLRQRIDFFHSWHGVXEVWLWXWLRQLQWR:RUNWRLQFOXGHEXLOGLQJ PRGLILFDWLRQVLIQHFHVVDU\PDNLQJVXFKFKDQJHVDVPD\EHUHTXLUHGIRU:RUNWREH FRPSOHWHLQDOOUHVSHFWV :DLYHVDOOFODLPVIRUDGGLWLRQDOFRVWVUHODWHGWRVXEVWLWXWLRQZKLFKVXEVHTXHQWO\ DULVH '(/,9(5<6725$*($1'+$1'/,1*>12786('@ ),(/'>6,7(@&21',7,216>12786('@ :$55$17<>12786('@ 3$57352'8&76>12786('@ 3$57(;(&87,21>12786('@ (1'2)6(&7,21  5HYLVLRQ/RJ '$7( 1$0( 6800$5<2)&+$1*(      '$368%67,787,21352&('85(6 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$XJXVW  (;+,%,7$ 5(48(67)2568%67,787,21)250  72 352-(&7 '$7(  :HKHUHE\VXEPLWIRU\RXUFRQVLGHUDWLRQWKHIROORZLQJSURGXFWLQVWHDGRIWKHVSHFLILHGLWHPIRU WKHDERYHSURMHFW 6(&7,21 3$5$*5$3+63(&,),(',7(0   3URSRVHG6XEVWLWXWLRQ 5HDVRQIRU6XEVWLWXWLRQ ,QFOXGH FRPSOHWH LQIRUPDWLRQ RQ FKDQJHV WR 'UDZLQJV DQGRU 6SHFLILFDWLRQV ZKLFK SURSRVHG VXEVWLWXWLRQZLOOUHTXLUHIRULWVSURSHULQVWDOODWLRQ  )LOOLQ%ODQNV%HORZ $ :LOOWKHXQGHUVLJQHGFRQWUDFWRUSD\IRUFKDQJHVWRWKHEXLOGLQJGHVLJQLQFOXGLQJHQJLQHHULQJ DQGGHWDLOLQJFRVWVFDXVHGE\WKHUHTXHVWHGVXEVWLWXWLRQ"   % :KDWHIIHFWGRHVVXEVWLWXWLRQKDYHRQRWKHUWUDGHV"   & 'LIIHUHQFHVEHWZHHQSURSRVHGVXEVWLWXWLRQDQGVSHFLILHGLWHP"   ' 'LIIHUHQFHVLQSURGXFWFRVWRUSURGXFWGHOLYHU\WLPH"   ( 0DQXIDFWXUHU VJXDUDQWHHVRIWKHSURSRVHGDQGVSHFLILHGLWHPVDUH   (TXDO  %HWWHU H[SODLQRQDWWDFKPHQW  7KHXQGHUVLJQHGVWDWHVWKDWWKHIXQFWLRQDSSHDUDQFHDQGTXDOLW\DUHHTXLYDOHQWRUVXSHULRUWRWKH VSHFLILHGLWHP 6XEPLWWHG%\ )RU8VHE\&LW\  6LJQDWXUH   5HFRPPHQGHG  5HFRPPHQGHG DVQRWHG  )LUP   1RWUHFRPPHQGHG  5HFHLYHGODWH $GGUHVV  %\  'DWH  'DWH  5HPDUNV  7HOHSKRQH     )RU8VHE\&LW\   $SSURYHG  5HMHFWHG &LW\  'DWH  '$335(&216758&7,210((7,1* 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$XJXVW  6(&7,21 35(&216758&7,210((7,1* 3$57*(1(5$/ 6800$5< $6HFWLRQ,QFOXGHV 3URYLVLRQVIRUWKHSUHFRQVWUXFWLRQPHHWLQJWREHKHOGSULRUWRWKHVWDUWRI:RUNWR FODULI\FRQVWUXFWLRQFRQWUDFWDGPLQLVWUDWLRQSURFHGXUHV %'HYLDWLRQVIURPWKLV&LW\RI)RUW:RUWK6WDQGDUG6SHFLILFDWLRQ 1RFRQVWUXFWLRQVFKHGXOHUHTXLUHGXQOHVVUHTXHVWHGE\WKH&LW\ &5HODWHG6SHFLILFDWLRQ6HFWLRQVLQFOXGHEXWDUHQRWQHFHVVDULO\OLPLWHGWR 'LYLVLRQ±%LGGLQJ5HTXLUHPHQWV&RQWUDFW)RUPVDQG&RQGLWLRQVRIWKH&RQWUDFW 'LYLVLRQ±*HQHUDO5HTXLUHPHQWV 35,&($1'3$<0(17352&('85(6 $0HDVXUHPHQWDQG3D\PHQW :RUNDVVRFLDWHGZLWKWKLV,WHPLVFRQVLGHUHGVXEVLGLDU\WRWKHYDULRXVLWHPVELG 1RVHSDUDWHSD\PHQWZLOOEHDOORZHGIRUWKLV,WHP 5()(5(1&(6>12786('@ $'0,1,675$7,9(5(48,5(0(176 $&RRUGLQDWLRQ $WWHQGSUHFRQVWUXFWLRQPHHWLQJ 5HSUHVHQWDWLYHVRI&RQWUDFWRUVXEFRQWUDFWRUVDQGVXSSOLHUVDWWHQGLQJPHHWLQJV VKDOOEHTXDOLILHGDQGDXWKRUL]HGWRDFWRQEHKDOIRIWKHHQWLW\HDFKUHSUHVHQWV 0HHWLQJDGPLQLVWHUHGE\&LW\PD\EHWDSHUHFRUGHG D,IUHFRUGHGWDSHVZLOOEHXVHGWRSUHSDUHPLQXWHVDQGUHWDLQHGE\&LW\IRU IXWXUHUHIHUHQFH %3UHFRQVWUXFWLRQ0HHWLQJ $SUHFRQVWUXFWLRQPHHWLQJZLOOEHKHOGZLWKLQGD\VDIWHUWKHGHOLYHU\RIWKH GLVWULEXWLRQSDFNDJHWRWKH&LW\ D7KHPHHWLQJZLOOEHVFKHGXOHGDQGDGPLQLVWHUHGE\WKH&LW\ 7KH3URMHFW5HSUHVHQWDWLYHZLOOSUHVLGHDWWKHPHHWLQJSUHSDUHWKHQRWHVRIWKH PHHWLQJDQGGLVWULEXWHFRSLHVRIVDPHWRDOOSDUWLFLSDQWVZKRVRUHTXHVWE\IXOO\ FRPSOHWLQJWKHDWWHQGDQFHIRUPWREHFLUFXODWHGDWWKHEHJLQQLQJRIWKHPHHWLQJ $WWHQGDQFHVKDOOLQFOXGH D'HYHORSHUDQG&RQVXOWDQW E&RQWUDFWRU VSURMHFWPDQDJHU F&RQWUDFWRU VVXSHULQWHQGHQW G$Q\VXEFRQWUDFWRURUVXSSOLHUUHSUHVHQWDWLYHVZKRPWKH&RQWUDFWRUPD\GHVLUH WRLQYLWHRUWKH&LW\PD\UHTXHVW  '$335(&216758&7,210((7,1* 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$XJXVW  H2WKHU&LW\UHSUHVHQWDWLYHV I2WKHUVDVDSSURSULDWH 3UHOLPLQDU\$JHQGDPD\LQFOXGH D,QWURGXFWLRQRI3URMHFW3HUVRQQHO E*HQHUDO'HVFULSWLRQRI3URMHFW F6WDWXVRIULJKWRIZD\XWLOLW\FOHDUDQFHVHDVHPHQWVRURWKHUSHUWLQHQWSHUPLWV G&RQWUDFWRU¶VZRUNSODQDQGVFKHGXOH H&RQWUDFW7LPH I1RWLFHWR3URFHHG J&RQVWUXFWLRQ6WDNLQJ K3URJUHVV3D\PHQWV L([WUD:RUNDQG&KDQJH2UGHU3URFHGXUHV M)LHOG2UGHUV N'LVSRVDO6LWH/HWWHUIRU:DVWH0DWHULDO O,QVXUDQFH5HQHZDOV P3D\UROO&HUWLILFDWLRQ Q0DWHULDO&HUWLILFDWLRQVDQG4XDOLW\&RQWURO7HVWLQJ R3XEOLF6DIHW\DQG&RQYHQLHQFH S'RFXPHQWDWLRQRI3UH&RQVWUXFWLRQ&RQGLWLRQV T:HHNHQG:RUN1RWLILFDWLRQ U/HJDO+ROLGD\V V7UHQFK6DIHW\3ODQV W&RQILQHG6SDFH(QWU\6WDQGDUGV X&RRUGLQDWLRQZLWKWKH&LW\¶VUHSUHVHQWDWLYHIRURSHUDWLRQVRIH[LVWLQJZDWHU V\VWHPV Y6WRUP:DWHU3ROOXWLRQ3UHYHQWLRQ3ODQ Z&RRUGLQDWLRQZLWKRWKHU&RQWUDFWRUV [(DUO\:DUQLQJ6\VWHP \&RQWUDFWRU(YDOXDWLRQ ]6SHFLDO&RQGLWLRQVDSSOLFDEOHWRWKHSURMHFW DD'DPDJHV&ODLPV EE6XEPLWWDO3URFHGXUHV FF6XEVWLWXWLRQ3URFHGXUHV GG&RUUHVSRQGHQFH5RXWLQJ HH5HFRUG'UDZLQJV II7HPSRUDU\FRQVWUXFWLRQIDFLOLWLHV JJ0%(6%(SURFHGXUHV KK)LQDO$FFHSWDQFH LL)LQDO3D\PHQW MM4XHVWLRQVRU&RPPHQWV  '$335(&216758&7,210((7,1* 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$XJXVW  68%0,77$/6>12786('@ $&7,2168%0,77$/6,1)250$7,21$/68%0,77$/6>12786('@ &/26(28768%0,77$/6>12786('@ 0$,17(1$1&(0$7(5,$/68%0,77$/6>12786('@ 48$/,7<$6685$1&(>12786('@ '(/,9(5<6725$*($1'+$1'/,1*>12786('@ ),(/'>6,7(@&21',7,216>12786('@ :$55$17<>12786('@ 3$57352'8&76>12786('@ 3$57(;(&87,21>12786('@ (1'2)6(&7,21  5HYLVLRQ/RJ '$7( 1$0( 6800$5<2)&+$1*(       '$335(&216758&7,219,'(2 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$XJXVW  6(&7,21 35(&216758&7,219,'(2 3$57*(1(5$/ 6800$5< $6HFWLRQ,QFOXGHV $GPLQLVWUDWLYHDQGSURFHGXUDOUHTXLUHPHQWVIRU D3UHFRQVWUXFWLRQ9LGHRV %'HYLDWLRQVIURPWKLV&LW\RI)RUW:RUWK6WDQGDUG6SHFLILFDWLRQ 7KRXJKQRWPDQGDWRU\LWLVKLJKO\UHFRPPHQGHGRQLQILOOGHYHORSHUSURMHFWV &5HODWHG6SHFLILFDWLRQ6HFWLRQVLQFOXGHEXWDUHQRWQHFHVVDULO\OLPLWHGWR 'LYLVLRQ±%LGGLQJ5HTXLUHPHQWV&RQWUDFW)RUPVDQG&RQGLWLRQVRIWKH&RQWUDFW 'LYLVLRQ±*HQHUDO5HTXLUHPHQWV 35,&($1'3$<0(17352&('85(6 $0HDVXUHPHQWDQG3D\PHQW :RUNDVVRFLDWHGZLWKWKLV,WHPLVFRQVLGHUHGVXEVLGLDU\WRWKHYDULRXVLWHPVELG 1RVHSDUDWHSD\PHQWZLOOEHDOORZHGIRUWKLV,WHP 5()(5(1&(6>12786('@ $'0,1,675$7,9(5(48,5(0(176 $3UHFRQVWUXFWLRQ9LGHR 3URGXFHDSUHFRQVWUXFWLRQYLGHRRIWKHVLWHDOLJQPHQWLQFOXGLQJDOODUHDVLQWKH YLFLQLW\RIDQGWREHDIIHFWHGE\FRQVWUXFWLRQ D3URYLGHGLJLWDOFRS\RIYLGHRXSRQUHTXHVWE\WKH&LW\ 5HWDLQDFRS\RIWKHSUHFRQVWUXFWLRQYLGHRXQWLOWKHHQGRIWKHPDLQWHQDQFHVXUHW\ SHULRG 68%0,77$/6>12786('@ $&7,2168%0,77$/6,1)250$7,21$/68%0,77$/6>12786('@ &/26(28768%0,77$/6>12786('@ 0$,17(1$1&(0$7(5,$/68%0,77$/6>12786('@ 48$/,7<$6685$1&(>12786('@ '(/,9(5<6725$*($1'+$1'/,1*>12786('@ ),(/'>6,7(@&21',7,216>12786('@ :$55$17<>12786('@ 3$57352'8&76>12786('@  '$335(&216758&7,219,'(2 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$XJXVW  3$57(;(&87,21>12786('@ (1'2)6(&7,21  5HYLVLRQ/RJ '$7( 1$0( 6800$5<2)&+$1*(       '$368%0,77$/6 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$XJXVW  6(&7,21 '$368%0,77$/6 3$57*(1(5$/ 6800$5< $6HFWLRQ,QFOXGHV *HQHUDOPHWKRGVDQGUHTXLUHPHQWVRIVXEPLVVLRQVDSSOLFDEOHWRWKHIROORZLQJ :RUNUHODWHGVXEPLWWDOV D6KRS'UDZLQJV E3URGXFW'DWD LQFOXGLQJ6WDQGDUG3URGXFW/LVWVXEPLWWDOV  F6DPSOHV G0RFN8SV %'HYLDWLRQVIURPWKLV&LW\RI)RUW:RUWK6WDQGDUG6SHFLILFDWLRQ 1RQH &5HODWHG6SHFLILFDWLRQ6HFWLRQVLQFOXGHEXWDUHQRWQHFHVVDULO\OLPLWHGWR 'LYLVLRQ±%LGGLQJ5HTXLUHPHQWV&RQWUDFW)RUPVDQG&RQGLWLRQVRIWKH&RQWUDFW 'LYLVLRQ±*HQHUDO5HTXLUHPHQWV 35,&($1'3$<0(17352&('85(6 $0HDVXUHPHQWDQG3D\PHQW :RUNDVVRFLDWHGZLWKWKLV,WHPLVFRQVLGHUHGVXEVLGLDU\WRWKHYDULRXVLWHPVELG 1RVHSDUDWHSD\PHQWZLOOEHDOORZHGIRUWKLV,WHP 5()(5(1&(6>12786('@ $'0,1,675$7,9(5(48,5(0(176 $&RRUGLQDWLRQ 1RWLI\WKH&LW\LQZULWLQJDWWKHWLPHRIVXEPLWWDORIDQ\GHYLDWLRQVLQWKH VXEPLWWDOVIURPWKHUHTXLUHPHQWVRIWKH&RQWUDFW'RFXPHQWV &RRUGLQDWLRQRI6XEPLWWDO7LPHV D3UHSDUHSULRULWL]HDQGWUDQVPLWHDFKVXEPLWWDOVXIILFLHQWO\LQDGYDQFHRI SHUIRUPLQJWKHUHODWHG:RUNRURWKHUDSSOLFDEOHDFWLYLWLHVRUZLWKLQWKHWLPH VSHFLILHGLQWKHLQGLYLGXDO:RUN6HFWLRQVRIWKH6SHFLILFDWLRQV E&RQWUDFWRULVUHVSRQVLEOHVXFKWKDWWKHLQVWDOODWLRQZLOOQRWEHGHOD\HGE\ SURFHVVLQJWLPHVLQFOXGLQJEXWQRWOLPLWHGWR D 'LVDSSURYDODQGUHVXEPLWWDO LIUHTXLUHG  E &RRUGLQDWLRQZLWKRWKHUVXEPLWWDOV F 7HVWLQJ G 3XUFKDVLQJ H )DEULFDWLRQ I 'HOLYHU\ J 6LPLODUVHTXHQFHGDFWLYLWLHV F1RH[WHQVLRQRIWLPHZLOOEHDXWKRUL]HGEHFDXVHRIWKH&RQWUDFWRU VIDLOXUHWR WUDQVPLWVXEPLWWDOVVXIILFLHQWO\LQDGYDQFHRIWKH:RUN  '$368%0,77$/6 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$XJXVW  G0DNHVXEPLWWDOVSURPSWO\LQDFFRUGDQFHZLWKDSSURYHGVFKHGXOHDQGLQVXFK VHTXHQFHDVWRFDXVHQRGHOD\LQWKH:RUNRULQWKHZRUNRIDQ\RWKHU FRQWUDFWRU %6XEPLWWDO1XPEHULQJ :KHQVXEPLWWLQJVKRSGUDZLQJVRUVDPSOHVXWLOL]HDFKDUDFWHUVXEPLWWDOFURVV UHIHUHQFHLGHQWLILFDWLRQQXPEHULQJV\VWHPLQWKHIROORZLQJPDQQHU D8VHWKHILUVWGLJLWVRIWKHDSSOLFDEOH6SHFLILFDWLRQ6HFWLRQ1XPEHU E)RUWKHQH[WGLJLWVQXPEHUXVHQXPEHUVWRVHTXHQWLDOO\QXPEHUHDFK LQLWLDOVHSDUDWHLWHPRUGUDZLQJVXEPLWWHGXQGHUHDFKVSHFLILF6HFWLRQQXPEHU F/DVWXVHDOHWWHU$=LQGLFDWLQJWKHUHVXEPLVVLRQRIWKHVDPHGUDZLQJ LH $ QGVXEPLVVLRQ% UGVXEPLVVLRQ& WKVXEPLVVLRQHWF $W\SLFDO VXEPLWWDOQXPEHUZRXOGEHDVIROORZV   %   LVWKH6SHFLILFDWLRQ6HFWLRQIRU&RQFUHWH  LVWKHHLJKWKLQLWLDOVXEPLWWDOXQGHUWKLV6SHFLILFDWLRQ6HFWLRQ  %LVWKHWKLUGVXEPLVVLRQ VHFRQGUHVXEPLVVLRQ RIWKDWSDUWLFXODUVKRS GUDZLQJ &&RQWUDFWRU&HUWLILFDWLRQ 5HYLHZVKRSGUDZLQJVSURGXFWGDWDDQGVDPSOHVLQFOXGLQJWKRVHE\ VXEFRQWUDFWRUVSULRUWRVXEPLVVLRQWRGHWHUPLQHDQGYHULI\WKHIROORZLQJ D)LHOGPHDVXUHPHQWV E)LHOGFRQVWUXFWLRQFULWHULD F&DWDORJQXPEHUVDQGVLPLODUGDWD G&RQIRUPDQFHZLWKWKH&RQWUDFW'RFXPHQWV 3URYLGHHDFKVKRSGUDZLQJVDPSOHDQGSURGXFWGDWDVXEPLWWHGE\WKH&RQWUDFWRU ZLWKD&HUWLILFDWLRQ6WDWHPHQWDIIL[HGLQFOXGLQJ D7KH&RQWUDFWRU V&RPSDQ\QDPH E6LJQDWXUHRIVXEPLWWDOUHYLHZHU F&HUWLILFDWLRQ6WDWHPHQW  ³%\WKLVVXEPLWWDO,KHUHE\UHSUHVHQWWKDW,KDYHGHWHUPLQHGDQGYHULILHG ILHOGPHDVXUHPHQWVILHOGFRQVWUXFWLRQFULWHULDPDWHULDOVGLPHQVLRQV FDWDORJQXPEHUVDQGVLPLODUGDWDDQG,KDYHFKHFNHGDQGFRRUGLQDWHGHDFK LWHPZLWKRWKHUDSSOLFDEOHDSSURYHGVKRSGUDZLQJV '6XEPLWWDO)RUPDW )ROGVKRSGUDZLQJVODUJHUWKDQòLQFKHV[LQFKHVWRòLQFKHV[LQFKHV %LQGVKRSGUDZLQJVDQGSURGXFWGDWDVKHHWVWRJHWKHU 2UGHU D&RYHU6KHHW  'HVFULSWLRQRI3DFNHW  &RQWUDFWRU&HUWLILFDWLRQ E/LVWRILWHPV7DEOHRI&RQWHQWV F3URGXFW'DWD6KRS'UDZLQJV6DPSOHV&DOFXODWLRQV (6XEPLWWDO&RQWHQW 7KHGDWHRIVXEPLVVLRQDQGWKHGDWHVRIDQ\SUHYLRXVVXEPLVVLRQV  '$368%0,77$/6 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$XJXVW  7KH3URMHFWWLWOHDQGQXPEHU &RQWUDFWRULGHQWLILFDWLRQ 7KHQDPHVRI D&RQWUDFWRU E6XSSOLHU F0DQXIDFWXUHU ,GHQWLILFDWLRQRIWKHSURGXFWZLWKWKH6SHFLILFDWLRQ6HFWLRQQXPEHUSDJHDQG SDUDJUDSK V  )LHOGGLPHQVLRQVFOHDUO\LGHQWLILHGDVVXFK 5HODWLRQWRDGMDFHQWRUFULWLFDOIHDWXUHVRIWKH:RUNRUPDWHULDOV $SSOLFDEOHVWDQGDUGVVXFKDV$670RU)HGHUDO6SHFLILFDWLRQQXPEHUV ,GHQWLILFDWLRQE\KLJKOLJKWLQJRIGHYLDWLRQVIURP&RQWUDFW'RFXPHQWV ,GHQWLILFDWLRQE\KLJKOLJKWLQJRIUHYLVLRQVRQUHVXEPLWWDOV $QLQFK[LQFKEODQNVSDFHIRU&RQWUDFWRUDQG&LW\VWDPSV )6KRS'UDZLQJV $VVSHFLILHGLQLQGLYLGXDO:RUN6HFWLRQVLQFOXGHVEXWLVQRWQHFHVVDULO\OLPLWHGWR D&XVWRPSUHSDUHGGDWDVXFKDVIDEULFDWLRQDQGHUHFWLRQLQVWDOODWLRQ ZRUNLQJ  GUDZLQJV E6FKHGXOHGLQIRUPDWLRQ F6HWWLQJGLDJUDPV G$FWXDOVKRSZRUNPDQXIDFWXULQJLQVWUXFWLRQV H&XVWRPWHPSODWHV I6SHFLDOZLULQJGLDJUDPV J&RRUGLQDWLRQGUDZLQJV K,QGLYLGXDOV\VWHPRUHTXLSPHQWLQVSHFWLRQDQGWHVWUHSRUWVLQFOXGLQJ  3HUIRUPDQFHFXUYHVDQGFHUWLILFDWLRQV L$VDSSOLFDEOHWRWKH:RUN 'HWDLOV D5HODWLRQRIWKHYDULRXVSDUWVWRWKHPDLQPHPEHUVDQGOLQHVRIWKHVWUXFWXUH E:KHUHFRUUHFWIDEULFDWLRQRIWKH:RUNGHSHQGVXSRQILHOGPHDVXUHPHQWV  3URYLGHVXFKPHDVXUHPHQWVDQGQRWHRQWKHGUDZLQJVSULRUWRVXEPLWWLQJ IRUDSSURYDO *3URGXFW'DWD )RUVXEPLWWDOVRISURGXFWGDWDIRUSURGXFWVLQFOXGHGRQWKH&LW\¶V6WDQGDUG3URGXFW /LVWFOHDUO\LGHQWLI\HDFKLWHPVHOHFWHGIRUXVHRQWKH3URMHFW )RUVXEPLWWDOVRISURGXFWGDWDIRUSURGXFWVQRWLQFOXGHGRQWKH&LW\¶V6WDQGDUG 3URGXFW/LVWVXEPLWWDOGDWDPD\LQFOXGHEXWLVQRWQHFHVVDULO\OLPLWHGWR D6WDQGDUGSUHSDUHGGDWDIRUPDQXIDFWXUHGSURGXFWV VRPHWLPHVUHIHUUHGWRDV FDWDORJGDWD   6XFKDVWKHPDQXIDFWXUHU VSURGXFWVSHFLILFDWLRQDQGLQVWDOODWLRQ LQVWUXFWLRQV  $YDLODELOLW\RIFRORUVDQGSDWWHUQV  0DQXIDFWXUHU VSULQWHGVWDWHPHQWVRIFRPSOLDQFHVDQGDSSOLFDELOLW\  5RXJKLQJLQGLDJUDPVDQGWHPSODWHV  &DWDORJFXWV  3URGXFWSKRWRJUDSKV  '$368%0,77$/6 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$XJXVW   6WDQGDUGZLULQJGLDJUDPV  3ULQWHGSHUIRUPDQFHFXUYHVDQGRSHUDWLRQDOUDQJHGLDJUDPV  3URGXFWLRQRUTXDOLW\FRQWUROLQVSHFWLRQDQGWHVWUHSRUWVDQGFHUWLILFDWLRQV  0LOOUHSRUWV  3URGXFWRSHUDWLQJDQGPDLQWHQDQFHLQVWUXFWLRQVDQGUHFRPPHQGHG VSDUHSDUWVOLVWLQJDQGSULQWHGSURGXFWZDUUDQWLHV  $VDSSOLFDEOHWRWKH:RUN +6DPSOHV $VVSHFLILHGLQLQGLYLGXDO6HFWLRQVLQFOXGHEXWDUHQRWQHFHVVDULO\OLPLWHGWR D3K\VLFDOH[DPSOHVRIWKH:RUNVXFKDV  6HFWLRQVRIPDQXIDFWXUHGRUIDEULFDWHG:RUN  6PDOOFXWVRUFRQWDLQHUVRIPDWHULDOV  &RPSOHWHXQLWVRIUHSHWLWLYHO\XVHGSURGXFWVFRORUWH[WXUHSDWWHUQVZDWFKHV DQGUDQJHVHWV  6SHFLPHQVIRUFRRUGLQDWLRQRIYLVXDOHIIHFW  *UDSKLFV\PEROVDQGXQLWVRI:RUNWREHXVHGE\WKH&LW\IRULQGHSHQGHQW LQVSHFWLRQDQGWHVWLQJDVDSSOLFDEOHWRWKH:RUN ,'RQRWVWDUW:RUNUHTXLULQJDVKRSGUDZLQJVDPSOHRUSURGXFWGDWDQRUDQ\PDWHULDOWR EHIDEULFDWHGRULQVWDOOHGSULRUWRWKHDSSURYDORUTXDOLILHGDSSURYDORIVXFKLWHP )DEULFDWLRQSHUIRUPHGPDWHULDOVSXUFKDVHGRURQVLWHFRQVWUXFWLRQDFFRPSOLVKHG ZKLFKGRHVQRWFRQIRUPWRDSSURYHGVKRSGUDZLQJVDQGGDWDLVDWWKH&RQWUDFWRU V ULVN 7KH&LW\ZLOOQRWEHOLDEOHIRUDQ\H[SHQVHRUGHOD\GXHWRFRUUHFWLRQVRUUHPHGLHV UHTXLUHGWRDFFRPSOLVKFRQIRUPLW\ &RPSOHWHSURMHFW:RUNPDWHULDOVIDEULFDWLRQDQGLQVWDOODWLRQVLQFRQIRUPDQFH ZLWKDSSURYHGVKRSGUDZLQJVDSSOLFDEOHVDPSOHVDQGSURGXFWGDWD -6XEPLWWDO'LVWULEXWLRQ (OHFWURQLF'LVWULEXWLRQ D&RQILUPGHYHORSPHQWRI3URMHFWGLUHFWRU\IRUHOHFWURQLFVXEPLWWDOVWREH XSORDGHGWR&LW\¶V%X]]VDZVLWHRUDQRWKHUH[WHUQDO)73VLWHDSSURYHGE\WKH &LW\ E6KRS'UDZLQJV  8SORDGVXEPLWWDOWRGHVLJQDWHGSURMHFWGLUHFWRU\DQGQRWLI\DSSURSULDWH &LW\UHSUHVHQWDWLYHVYLDHPDLORIVXEPLWWDOSRVWLQJ  +DUG&RSLHV D FRSLHVIRUDOOVXEPLWWDOV E ,I&RQWUDFWRUUHTXLUHVPRUHWKDQKDUGFRS\RI6KRS'UDZLQJV UHWXUQHG&RQWUDFWRUVKDOOVXEPLWPRUHWKDQWKHQXPEHURIFRSLHVOLVWHG DERYH F3URGXFW'DWD  8SORDGVXEPLWWDOWRGHVLJQDWHGSURMHFWGLUHFWRU\DQGQRWLI\DSSURSULDWH &LW\UHSUHVHQWDWLYHVYLDHPDLORIVXEPLWWDOSRVWLQJ  +DUG&RSLHV D FRSLHVIRUDOOVXEPLWWDOV G6DPSOHV  'LVWULEXWHGWRWKH3URMHFW5HSUHVHQWDWLYH +DUG&RS\'LVWULEXWLRQ LIUHTXLUHGLQOLHXRIHOHFWURQLFGLVWULEXWLRQ   '$368%0,77$/6 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$XJXVW  D6KRS'UDZLQJV  'LVWULEXWHGWRWKH&LW\  &RSLHV D FRSLHVIRUPHFKDQLFDOVXEPLWWDOV E FRSLHVIRUDOORWKHUVXEPLWWDOV F ,I&RQWUDFWRUUHTXLUHVPRUHWKDQFRSLHVRI6KRS'UDZLQJVUHWXUQHG &RQWUDFWRUVKDOOVXEPLWPRUHWKDQWKHQXPEHURIFRSLHVOLVWHGDERYH E3URGXFW'DWD  'LVWULEXWHGWRWKH&LW\  &RSLHV D FRSLHV F6DPSOHV  'LVWULEXWHGWRWKH3URMHFW5HSUHVHQWDWLYH  &RSLHV D 6XEPLWWKHQXPEHUVWDWHGLQWKHUHVSHFWLYH6SHFLILFDWLRQ6HFWLRQV 'LVWULEXWHUHSURGXFWLRQVRIDSSURYHGVKRSGUDZLQJVDQGFRSLHVRIDSSURYHG SURGXFWGDWDDQGVDPSOHVZKHUHUHTXLUHGWRWKHMREVLWHILOHDQGHOVHZKHUHDV GLUHFWHGE\WKH&LW\ D3URYLGHQXPEHURIFRSLHVDVGLUHFWHGE\WKH&LW\EXWQRWH[FHHGLQJWKHQXPEHU SUHYLRXVO\VSHFLILHG .6XEPLWWDO5HYLHZ 7KHUHYLHZRIVKRSGUDZLQJVGDWDDQGVDPSOHVZLOOEHIRUJHQHUDOFRQIRUPDQFH ZLWKWKHGHVLJQFRQFHSWDQG&RQWUDFW'RFXPHQWV7KLVLVQRWWREHFRQVWUXHGDV D3HUPLWWLQJDQ\GHSDUWXUHIURPWKH&RQWUDFWUHTXLUHPHQWV E5HOLHYLQJWKH&RQWUDFWRURIUHVSRQVLELOLW\IRUDQ\HUURUVLQFOXGLQJGHWDLOV GLPHQVLRQVDQGPDWHULDOV F$SSURYLQJGHSDUWXUHVIURPGHWDLOVIXUQLVKHGE\WKH&LW\H[FHSWDVRWKHUZLVH SURYLGHGKHUHLQ 7KHUHYLHZDQGDSSURYDORIVKRSGUDZLQJVVDPSOHVRUSURGXFWGDWDE\WKH&LW\ GRHVQRWUHOLHYHWKH&RQWUDFWRUIURPKLVKHUUHVSRQVLELOLW\ZLWKUHJDUGWRWKH IXOILOOPHQWRIWKHWHUPVRIWKH&RQWUDFW D$OOULVNVRIHUURUDQGRPLVVLRQDUHDVVXPHGE\WKH&RQWUDFWRUDQGWKH&LW\ZLOO KDYHQRUHVSRQVLELOLW\WKHUHIRUH 7KH&RQWUDFWRUUHPDLQVUHVSRQVLEOHIRUGHWDLOVDQGDFFXUDF\IRUFRRUGLQDWLQJWKH :RUNZLWKDOORWKHUDVVRFLDWHGZRUNDQGWUDGHVIRUVHOHFWLQJIDEULFDWLRQSURFHVVHV IRUWHFKQLTXHVRIDVVHPEO\DQGIRUSHUIRUPLQJ:RUNLQDVDIHPDQQHU ,IWKHVKRSGUDZLQJVGDWDRUVDPSOHVDVVXEPLWWHGGHVFULEHYDULDWLRQVDQGVKRZD GHSDUWXUHIURPWKH&RQWUDFWUHTXLUHPHQWVZKLFK&LW\ILQGVWREHLQWKHLQWHUHVWRI WKH&LW\DQGWREHVRPLQRUDVQRWWRLQYROYHDFKDQJHLQ&RQWUDFW3ULFHRUWLPHIRU SHUIRUPDQFHWKH&LW\PD\UHWXUQWKHUHYLHZHGGUDZLQJVZLWKRXWQRWLQJDQ H[FHSWLRQ 6XEPLWWDOVZLOOEHUHWXUQHGWRWKH&RQWUDFWRUXQGHURIWKHIROORZLQJFRGHV D&RGH  12(;&(37,2167$.(1LVDVVLJQHGZKHQWKHUHDUHQRQRWDWLRQVRU FRPPHQWVRQWKHVXEPLWWDO D :KHQUHWXUQHGXQGHUWKLVFRGHWKH&RQWUDFWRUPD\UHOHDVHWKH HTXLSPHQWDQGRUPDWHULDOIRUPDQXIDFWXUH E&RGH  '$368%0,77$/6 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$XJXVW   (;&(37,216127('7KLVFRGHLVDVVLJQHGZKHQDFRQILUPDWLRQRI WKHQRWDWLRQVDQGFRPPHQWV,6127UHTXLUHGE\WKH&RQWUDFWRU D 7KH&RQWUDFWRUPD\UHOHDVHWKHHTXLSPHQWRUPDWHULDOIRUPDQXIDFWXUH KRZHYHUDOOQRWDWLRQVDQGFRPPHQWVPXVWEHLQFRUSRUDWHGLQWRWKH ILQDOSURGXFW F&RGH  (;&(37,216127('5(68%0,77KLVFRPELQDWLRQRIFRGHVLV DVVLJQHGZKHQQRWDWLRQVDQGFRPPHQWVDUHH[WHQVLYHHQRXJKWRUHTXLUHD UHVXEPLWWDORIWKHSDFNDJH D 7KH&RQWUDFWRUPD\UHOHDVHWKHHTXLSPHQWRUPDWHULDOIRUPDQXIDFWXUH KRZHYHUDOOQRWDWLRQVDQGFRPPHQWVPXVWEHLQFRUSRUDWHGLQWRWKH ILQDOSURGXFW E 7KLVUHVXEPLWWDOLVWRDGGUHVVDOOFRPPHQWVRPLVVLRQVDQG QRQFRQIRUPLQJLWHPVWKDWZHUHQRWHG F 5HVXEPLWWDOLVWREHUHFHLYHGE\WKH&LW\ZLWKLQ&DOHQGDU'D\VRI WKHGDWHRIWKH&LW\ VWUDQVPLWWDOUHTXLULQJWKHUHVXEPLWWDO G&RGH  127$33529('LVDVVLJQHGZKHQWKHVXEPLWWDOGRHVQRWPHHWWKH LQWHQWRIWKH&RQWUDFW'RFXPHQWV D 7KH&RQWUDFWRUPXVWUHVXEPLWWKHHQWLUHSDFNDJHUHYLVHGWREULQJWKH VXEPLWWDOLQWRFRQIRUPDQFH E ,WPD\EHQHFHVVDU\WRUHVXEPLWXVLQJDGLIIHUHQWPDQXIDFWXUHUYHQGRU WRPHHWWKH&RQWUDFW'RFXPHQWV 5HVXEPLWWDOV D+DQGOHGLQWKHVDPHPDQQHUDVILUVWVXEPLWWDOV  &RUUHFWLRQVRWKHUWKDQUHTXHVWHGE\WKH&LW\  0DUNHGZLWKUHYLVLRQWULDQJOHRURWKHUVLPLODUPHWKRG D $W&RQWUDFWRU¶VULVNLIQRWPDUNHG E6XEPLWWDOVIRUHDFKLWHPZLOOEHUHYLHZHGQRPRUHWKDQWZLFHDWWKH&LW\¶V H[SHQVH  $OOVXEVHTXHQWUHYLHZVZLOOEHSHUIRUPHGDWWLPHVFRQYHQLHQWWRWKH&LW\ DQGDWWKH&RQWUDFWRU VH[SHQVHEDVHGRQWKH&LW\ VRU&LW\ 5HSUHVHQWDWLYH¶VWKHQSUHYDLOLQJUDWHV  3URYLGH&RQWUDFWRUUHLPEXUVHPHQWWRWKH&LW\ZLWKLQ&DOHQGDU'D\VIRU DOOVXFKIHHVLQYRLFHGE\WKH&LW\ F7KHQHHGIRUPRUHWKDQUHVXEPLVVLRQRUDQ\RWKHUGHOD\LQREWDLQLQJ&LW\ V UHYLHZRIVXEPLWWDOVZLOOQRWHQWLWOHWKH&RQWUDFWRUWRDQH[WHQVLRQRI&RQWUDFW 7LPH 3DUWLDO6XEPLWWDOV D&LW\UHVHUYHVWKHULJKWWRQRWUHYLHZVXEPLWWDOVGHHPHGSDUWLDODWWKH&LW\¶V GLVFUHWLRQ E6XEPLWWDOVGHHPHGE\WKH&LW\WREHQRWFRPSOHWHZLOOEHUHWXUQHGWRWKH &RQWUDFWRUDQGZLOOEHFRQVLGHUHG1RW$SSURYHGXQWLOUHVXEPLWWHG F7KH&LW\PD\DWLWVRSWLRQSURYLGHDOLVWRUPDUNWKHVXEPLWWDOGLUHFWLQJWKH &RQWUDFWRUWRWKHDUHDVWKDWDUHLQFRPSOHWH ,IWKH&RQWUDFWRUFRQVLGHUVDQ\FRUUHFWLRQLQGLFDWHGRQWKHVKRSGUDZLQJVWR FRQVWLWXWHDFKDQJHWRWKH&RQWUDFW'RFXPHQWVWKHQZULWWHQQRWLFHPXVWEH SURYLGHGWKHUHRIWRWKH'HYHORSHUDWOHDVW&DOHQGDU'D\VSULRUWRUHOHDVHIRU PDQXIDFWXUH  '$368%0,77$/6 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$XJXVW  :KHQWKHVKRSGUDZLQJVKDYHEHHQFRPSOHWHGWRWKHVDWLVIDFWLRQRIWKH&LW\WKH &RQWUDFWRUPD\FDUU\RXWWKHFRQVWUXFWLRQLQDFFRUGDQFHWKHUHZLWKDQGQRIXUWKHU FKDQJHVWKHUHLQH[FHSWXSRQZULWWHQLQVWUXFWLRQVIURPWKH&LW\ (DFKVXEPLWWDODSSURSULDWHO\FRGHGZLOOEHUHWXUQHGZLWKLQ&DOHQGDU'D\V IROORZLQJUHFHLSWRIVXEPLWWDOE\WKH&LW\ /0RFNXSV 0RFN8SXQLWVDVVSHFLILHGLQLQGLYLGXDO6HFWLRQVLQFOXGHEXWDUHQRWQHFHVVDULO\ OLPLWHGWRFRPSOHWHXQLWVRIWKHVWDQGDUGRIDFFHSWDQFHIRUWKDWW\SHRI:RUNWREH XVHGRQWKH3URMHFW5HPRYHDWWKHFRPSOHWLRQRIWKH:RUNRUZKHQGLUHFWHG 04XDOLILFDWLRQV ,IVSHFLILFDOO\UHTXLUHGLQRWKHU6HFWLRQVRIWKHVH6SHFLILFDWLRQVVXEPLWD3( &HUWLILFDWLRQIRUHDFKLWHPUHTXLUHG 15HTXHVWIRU,QIRUPDWLRQ 5),  &RQWUDFWRU5HTXHVWIRUDGGLWLRQDOLQIRUPDWLRQ D&ODULILFDWLRQRULQWHUSUHWDWLRQRIWKHFRQWUDFWGRFXPHQWV E:KHQWKH&RQWUDFWRUEHOLHYHVWKHUHLVDFRQIOLFWEHWZHHQ&RQWUDFW'RFXPHQWV F:KHQWKH&RQWUDFWRUEHOLHYHVWKHUHLVDFRQIOLFWEHWZHHQWKH'UDZLQJVDQG 6SHFLILFDWLRQV  ,GHQWLI\WKHFRQIOLFWDQGUHTXHVWFODULILFDWLRQ 6XIILFLHQWLQIRUPDWLRQVKDOOEHDWWDFKHGWRSHUPLWDZULWWHQUHVSRQVHZLWKRXWIXUWKHU LQIRUPDWLRQ     68%0,77$/6>12786('@ $&7,2168%0,77$/6,1)250$7,21$/68%0,77$/6>12786('@ &/26(28768%0,77$/6>12786('@ 0$,17(1$1&(0$7(5,$/68%0,77$/6>12786('@ 48$/,7<$6685$1&(>12786('@ '(/,9(5<6725$*($1'+$1'/,1*>12786('@ ),(/'>6,7(@&21',7,216>12786('@ :$55$17<>12786('@  '$368%0,77$/6 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$XJXVW  3$57352'8&76>12786('@ 3$57(;(&87,21>12786('@ (1'2)6(&7,21  5HYLVLRQ/RJ '$7( 1$0( 6800$5<2)&+$1*(  '-RKQVRQ .:RUNLQJ'D\VPRGLILHGWR&DOHQGDU'D\V     '$363(&,$/352-(&7352&('85(6 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$XJXVW  6(&7,21 63(&,$/352-(&7352&('85(6 3$57*(1(5$/ 6800$5< $6HFWLRQ,QFOXGHV 7KHSURFHGXUHVIRUVSHFLDOSURMHFWFLUFXPVWDQFHVWKDWLQFOXGHVEXWLVQRWOLPLWHGWR D&RRUGLQDWLRQZLWKWKH7H[DV'HSDUWPHQWRI7UDQVSRUWDWLRQ E:RUNQHDU+LJK9ROWDJH/LQHV F&RQILQHG6SDFH(QWU\3URJUDP G$LU3ROOXWLRQ:DWFK'D\V H8VHRI([SORVLYHV'URS:HLJKW(WF I:DWHU'HSDUWPHQW1RWLILFDWLRQ J3XEOLF1RWLILFDWLRQ3ULRUWR%HJLQQLQJ&RQVWUXFWLRQ K&RRUGLQDWLRQZLWK8QLWHG6WDWHV$UP\&RUSVRI(QJLQHHUV L&RRUGLQDWLRQZLWKLQ5DLOURDGSHUPLWVDUHDV M'XVW&RQWURO N(PSOR\HH3DUNLQJ %'HYLDWLRQVIURPWKLV&LW\RI)RUW:RUWK6WDQGDUG6SHFLILFDWLRQ 1RQH &5HODWHG6SHFLILFDWLRQ6HFWLRQVLQFOXGHEXWDUHQRWQHFHVVDULO\OLPLWHGWR 'LYLVLRQ±%LGGLQJ5HTXLUHPHQWV&RQWUDFW)RUPVDQG&RQGLWLRQVRIWKH&RQWUDFW 'LYLVLRQ±*HQHUDO5HTXLUHPHQWV 6HFWLRQ±&RQQHFWLRQWR([LVWLQJ:DWHU0DLQV  5()(5(1&(6 $5HIHUHQFH6WDQGDUGV 5HIHUHQFHVWDQGDUGVFLWHGLQWKLV6SHFLILFDWLRQUHIHUWRWKHFXUUHQWUHIHUHQFH VWDQGDUGSXEOLVKHGDWWKHWLPHRIWKHODWHVWUHYLVLRQGDWHORJJHGDWWKHHQGRIWKLV 6SHFLILFDWLRQXQOHVVDGDWHLVVSHFLILFDOO\FLWHG +HDOWKDQG6DIHW\&RGH7LWOH6DIHW\6XEWLWOH$3XEOLF6DIHW\&KDSWHU +LJK9ROWDJH2YHUKHDG/LQHV 1RUWK&HQWUDO7H[DV&RXQFLORI*RYHUQPHQWV 1&7&2* ±&OHDQ&RQVWUXFWLRQ 6SHFLILFDWLRQ $'0,1,675$7,9(5(48,5(0(176 $&RRUGLQDWLRQZLWKWKH7H[DV'HSDUWPHQWRI7UDQVSRUWDWLRQ :KHQZRUNLQWKHULJKWRIZD\ZKLFKLVXQGHUWKHMXULVGLFWLRQRIWKH7H[DV 'HSDUWPHQWRI7UDQVSRUWDWLRQ 7['27  D1RWLI\WKH7H[DV'HSDUWPHQWRI7UDQVSRUWDWLRQSULRUWRFRPPHQFLQJDQ\ZRUN WKHUHLQLQDFFRUGDQFHZLWKWKHSURYLVLRQVRIWKHSHUPLW  '$363(&,$/352-(&7352&('85(6 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$XJXVW  E$OOZRUNSHUIRUPHGLQWKH7['27ULJKWRIZD\VKDOOEHSHUIRUPHGLQ FRPSOLDQFHZLWKDQGVXEMHFWWRDSSURYDOIURPWKH7H[DV'HSDUWPHQWRI 7UDQVSRUWDWLRQ %:RUNQHDU+LJK9ROWDJH/LQHV 5HJXODWRU\5HTXLUHPHQWV D$OO:RUNQHDU+LJK9ROWDJH/LQHV PRUHWKDQYROWVPHDVXUHGEHWZHHQ FRQGXFWRUVRUEHWZHHQDFRQGXFWRUDQGWKHJURXQG VKDOOEHLQDFFRUGDQFHZLWK +HDOWKDQG6DIHW\&RGH7LWOH6XEWLWOH$&KDSWHU :DUQLQJVLJQ D3URYLGHVLJQRIVXIILFLHQWVL]HPHHWLQJDOO26+$UHTXLUHPHQWV (TXLSPHQWRSHUDWLQJZLWKLQIHHWRIKLJKYROWDJHOLQHVZLOOUHTXLUHWKHIROORZLQJ VDIHW\IHDWXUHV D,QVXODWLQJFDJHW\SHRIJXDUGDERXWWKHERRPRUDUP E,QVXODWRUOLQNVRQWKHOLIWKRRNFRQQHFWLRQVIRUEDFNKRHVRUGLSSHUV F(TXLSPHQWPXVWPHHWWKHVDIHW\UHTXLUHPHQWVDVVHWIRUWKE\26+$DQGWKH VDIHW\UHTXLUHPHQWVRIWKHRZQHURIWKHKLJKYROWDJHOLQHV :RUNZLWKLQIHHWRIKLJKYROWDJHHOHFWULFOLQHV D1RWLILFDWLRQVKDOOEHJLYHQWR  7KHSRZHUFRPSDQ\ H[DPSOH21&25  D 0DLQWDLQDQDFFXUDWHORJRIDOOVXFKFDOOVWRSRZHUFRPSDQ\DQGUHFRUG DFWLRQWDNHQLQHDFKFDVH E&RRUGLQDWLRQZLWKSRZHUFRPSDQ\  $IWHUQRWLILFDWLRQFRRUGLQDWHZLWKWKHSRZHUFRPSDQ\WR D (UHFWWHPSRUDU\PHFKDQLFDOEDUULHUVGHHQHUJL]HWKHOLQHVRUUDLVHRU ORZHUWKHOLQHV F1RSHUVRQQHOPD\ZRUNZLWKLQIHHWRIDKLJKYROWDJHOLQHEHIRUHWKHDERYH UHTXLUHPHQWVKDYHEHHQPHW &&RQILQHG6SDFH(QWU\3URJUDP 3URYLGHDQGIROORZDSSURYHG&RQILQHG6SDFH(QWU\3URJUDPLQDFFRUGDQFHZLWK 26+$UHTXLUHPHQWV &RQILQHG6SDFHVLQFOXGH D0DQKROHV E$OORWKHUFRQILQHGVSDFHVLQDFFRUGDQFHZLWK26+$¶V3HUPLW5HTXLUHGIRU &RQILQHG6SDFHV '8VHRI([SORVLYHV'URS:HLJKW(WF :KHQ&RQWUDFW'RFXPHQWVSHUPLWRQWKHSURMHFWWKHIROORZLQJZLOODSSO\ D3XEOLF1RWLILFDWLRQ  6XEPLWQRWLFHWR&LW\DQGSURRIRIDGHTXDWHLQVXUDQFHFRYHUDJHKRXUV SULRUWRFRPPHQFLQJ  0LQLPXPKRXUSXEOLFQRWLILFDWLRQLQDFFRUGDQFHZLWK6HFWLRQ (:DWHU'HSDUWPHQW&RRUGLQDWLRQ 'XULQJWKHFRQVWUXFWLRQRIWKLVSURMHFWLWZLOOEHQHFHVVDU\WRGHDFWLYDWHIRUD SHULRGRIWLPHH[LVWLQJOLQHV7KH&RQWUDFWRUVKDOOEHUHTXLUHGWRFRRUGLQDWHZLWK WKH:DWHU'HSDUWPHQWWRGHWHUPLQHWKHEHVWWLPHVIRUGHDFWLYDWLQJDQGDFWLYDWLQJ WKRVHOLQHV  '$363(&,$/352-(&7352&('85(6 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$XJXVW  &RRUGLQDWHDQ\HYHQWWKDWZLOOUHTXLUHFRQQHFWLQJWRRUWKHRSHUDWLRQRIDQH[LVWLQJ &LW\ZDWHUOLQHV\VWHPZLWKWKH&LW\¶VUHSUHVHQWDWLYH D&RRUGLQDWLRQVKDOOEHLQDFFRUGDQFHZLWK6HFWLRQ E,IQHHGHGREWDLQDK\GUDQWZDWHUPHWHUIURPWKH:DWHU'HSDUWPHQWIRUXVH GXULQJWKHOLIHRIQDPHGSURMHFW F,QWKHHYHQWWKDWDZDWHUYDOYHRQDQH[LVWLQJOLYHV\VWHPEHWXUQHGRIIDQGRQ WRDFFRPPRGDWHWKHFRQVWUXFWLRQRIWKHSURMHFWLVUHTXLUHGFRRUGLQDWHWKLV DFWLYLW\WKURXJKWKHDSSURSULDWH&LW\UHSUHVHQWDWLYH  'RQRWRSHUDWHZDWHUOLQHYDOYHVRIH[LVWLQJZDWHUV\VWHP D )DLOXUHWRFRPSO\ZLOOUHQGHUWKH&RQWUDFWRULQYLRODWLRQRI7H[DV3HQDO &RGH7LWOH&KDSWHU &ULPLQDO0LVFKLHI DQGWKH&RQWUDFWRU ZLOOEHSURVHFXWHGWRWKHIXOOH[WHQWRIWKHODZ E ,QDGGLWLRQWKH&RQWUDFWRUZLOODVVXPHDOOOLDELOLWLHVDQG UHVSRQVLELOLWLHVDVDUHVXOWRIWKHVHDFWLRQV )3XEOLF1RWLILFDWLRQ3ULRUWR%HJLQQLQJ&RQVWUXFWLRQ 3ULRUWREHJLQQLQJFRQVWUXFWLRQRQDQ\EORFNLQWKHSURMHFWRQDEORFNE\EORFN EDVLVSUHSDUHDQGGHOLYHUDQRWLFHRUIO\HURIWKHSHQGLQJFRQVWUXFWLRQWRWKHIURQW GRRURIHDFKUHVLGHQFHRUEXVLQHVVWKDWZLOOEHLPSDFWHGE\FRQVWUXFWLRQ7KHQRWLFH VKDOOEHSUHSDUHGDVIROORZV D3RVWQRWLFHRUIO\HUGD\VSULRUWREHJLQQLQJDQ\FRQVWUXFWLRQDFWLYLW\RQHDFK EORFNLQWKHSURMHFWDUHD  3UHSDUHIO\HURQWKH&RQWUDFWRU¶VOHWWHUKHDGDQGLQFOXGHWKHIROORZLQJ LQIRUPDWLRQ D 1DPHRI3URMHFW E &LW\3URMHFW1R &31  F 6FRSHRI3URMHFW LHW\SHRIFRQVWUXFWLRQDFWLYLW\  G $FWXDOFRQVWUXFWLRQGXUDWLRQZLWKLQWKHEORFN H 1DPHRIWKHFRQWUDFWRU¶VIRUHPDQDQGSKRQHQXPEHU I 1DPHRIWKH&LW\¶VLQVSHFWRUDQGSKRQHQXPEHU J &LW\¶VDIWHUKRXUVSKRQHQXPEHU  $VDPSOHRIWKHµSUHFRQVWUXFWLRQQRWLILFDWLRQ¶IO\HULVDWWDFKHGDV([KLELW $  6XEPLWVFKHGXOHVKRZLQJWKHFRQVWUXFWLRQVWDUWDQGILQLVKWLPHIRUHDFK EORFNRIWKHSURMHFWWRWKHLQVSHFWRU  'HOLYHUIO\HUWRWKH&LW\,QVSHFWRUIRUUHYLHZSULRUWRGLVWULEXWLRQ E1RFRQVWUXFWLRQZLOOEHDOORZHGWREHJLQRQDQ\EORFNXQWLOWKHIO\HULV GHOLYHUHGWRDOOUHVLGHQWVRIWKHEORFN *3XEOLF1RWLILFDWLRQRI7HPSRUDU\:DWHU6HUYLFH,QWHUUXSWLRQGXULQJ&RQVWUXFWLRQ ,QWKHHYHQWLWEHFRPHVQHFHVVDU\WRWHPSRUDULO\VKXWGRZQZDWHUVHUYLFHWR UHVLGHQWVRUEXVLQHVVHVGXULQJFRQVWUXFWLRQSUHSDUHDQGGHOLYHUDQRWLFHRUIO\HURI WKHSHQGLQJLQWHUUXSWLRQWRWKHIURQWGRRURIHDFKDIIHFWHGUHVLGHQW 3UHSDUHGQRWLFHDVIROORZV D7KHQRWLILFDWLRQRUIO\HUVKDOOEHSRVWHGKRXUVSULRUWRWKHWHPSRUDU\ LQWHUUXSWLRQ E3UHSDUHIO\HURQWKHFRQWUDFWRU¶VOHWWHUKHDGDQGLQFOXGHWKHIROORZLQJ LQIRUPDWLRQ  1DPHRIWKHSURMHFW  &LW\3URMHFW1XPEHU  '$363(&,$/352-(&7352&('85(6 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$XJXVW   'DWHRIWKHLQWHUUXSWLRQRIVHUYLFH  3HULRGWKHLQWHUUXSWLRQZLOOWDNHSODFH  1DPHRIWKHFRQWUDFWRU¶VIRUHPDQDQGSKRQHQXPEHU  1DPHRIWKH&LW\¶VLQVSHFWRUDQGSKRQHQXPEHU F$VDPSOHRIWKHWHPSRUDU\ZDWHUVHUYLFHLQWHUUXSWLRQQRWLILFDWLRQLVDWWDFKHGDV ([KLELW% G'HOLYHUDFRS\RIWKHWHPSRUDU\LQWHUUXSWLRQQRWLILFDWLRQWRWKH&LW\LQVSHFWRU IRUUHYLHZSULRUWREHLQJGLVWULEXWHG H1RLQWHUUXSWLRQRIZDWHUVHUYLFHFDQRFFXUXQWLOWKHIO\HUKDVEHHQGHOLYHUHGWR DOODIIHFWHGUHVLGHQWVDQGEXVLQHVVHV I(OHFWURQLFYHUVLRQVRIWKHVDPSOHIO\HUVFDQEHREWDLQHGIURPWKH3URMHFW &RQVWUXFWLRQ,QVSHFWRU +&RRUGLQDWLRQZLWK8QLWHG6WDWHV$UP\&RUSVRI(QJLQHHUV 86$&(  $WORFDWLRQVLQWKH3URMHFWZKHUHFRQVWUXFWLRQDFWLYLWLHVRFFXULQDUHDVZKHUH 86$&(SHUPLWVDUHUHTXLUHGPHHWDOOUHTXLUHPHQWVVHWIRUWKLQHDFKGHVLJQDWHG SHUPLW ,&RRUGLQDWLRQZLWKLQ5DLOURDG3HUPLW$UHDV $WORFDWLRQVLQWKHSURMHFWZKHUHFRQVWUXFWLRQDFWLYLWLHVRFFXULQDUHDVZKHUH UDLOURDGSHUPLWVDUHUHTXLUHGPHHWDOOUHTXLUHPHQWVVHWIRUWKLQHDFKGHVLJQDWHG UDLOURDGSHUPLW7KLVLQFOXGHVEXWLVQRWOLPLWHGWRSURYLVLRQVIRU D)ODJPHQ E,QVSHFWRUV F6DIHW\WUDLQLQJ G$GGLWLRQDOLQVXUDQFH H,QVXUDQFHFHUWLILFDWHV I2WKHUHPSOR\HHVUHTXLUHGWRSURWHFWWKHULJKWRIZD\DQGSURSHUW\RIWKH 5DLOURDG&RPSDQ\IURPGDPDJHDULVLQJRXWRIDQGRUIURPWKHFRQVWUXFWLRQRI WKHSURMHFW3URSHUXWLOLW\FOHDUDQFHSURFHGXUHVVKDOOEHXVHGLQDFFRUGDQFH ZLWKWKHSHUPLWJXLGHOLQHV 2EWDLQDQ\VXSSOHPHQWDOLQIRUPDWLRQQHHGHGWRFRPSO\ZLWKWKHUDLOURDG¶V UHTXLUHPHQWV -'XVW&RQWURO 8VHDFFHSWDEOHPHDVXUHVWRFRQWUROGXVWDWWKH6LWH D,IZDWHULVXVHGWRFRQWUROGXVWFDSWXUHDQGSURSHUO\GLVSRVHRIZDVWHZDWHU E,IZHWVDZFXWWLQJLVSHUIRUPHGFDSWXUHDQGSURSHUO\GLVSRVHRIVOXUU\ .(PSOR\HH3DUNLQJ 3URYLGHSDUNLQJIRUHPSOR\HHVDWORFDWLRQVDSSURYHGE\WKH&LW\  '$363(&,$/352-(&7352&('85(6 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$XJXVW  68%0,77$/6>12786('@ $&7,2168%0,77$/6,1)250$7,21$/68%0,77$/6>12786('@ &/26(28768%0,77$/6>12786('@ 0$,17(1$1&(0$7(5,$/68%0,77$/6>12786('@ 48$/,7<$6685$1&(>12786('@ '(/,9(5<6725$*($1'+$1'/,1*>12786('@ ),(/'>6,7(@&21',7,216>12786('@ :$55$17<>12786('@ 3$57352'8&76>12786('@ 3$57(;(&87,21>12786('@ (1'2)6(&7,21  5HYLVLRQ/RJ '$7( 1$0( 6800$5<2)&+$1*(  '-RKQVRQ %±$GGHGUHTXLUHPHQWRIFRPSOLDQFHZLWK+HDOWKDQG6DIHW\&RGH7LWOH 6DIHW\6XEWLWOH$3XEOLF6DIHW\&KDSWHU+LJK9ROWDJH2YHUKHDG/LQHV     '$363(&,$/352-(&7352&('85(6 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$XJXVW  (;+,%,7$ 7REHSULQWHGRQ&RQWUDFWRU¶V/HWWHUKHDG     'DWH     &311R 3URMHFW1DPH 0DSVFR/RFDWLRQ /LPLWVRI&RQVWUXFWLRQ     7+,6,672,1)250<287+$781'(5$&2175$&7:,7+7+(&,7<2))257 :257+285&203$1<:,//:25.2187,/,7</,1(62125$5281'<285 3523(57<  &216758&7,21:,//%(*,1$3352;,0$7(/<6(9(1'$<6)5207+('$7( 2)7+,6127,&(  ,)<28+$9(48(67,216$%287$&&(666(&85,7<6$)(7<25$1<27+(5 ,668(3/($6(&$//   0U&2175$&725¶6683(5,17(1'(17!$77(/(3+21(12!  25  0U&,7<,163(&725!$77(/(3+21(12!  $)7(5302521:((.(1'63/($6(&$//    PLEASE KEEP THIS FLYER HANDY WHEN YOU CALL  '$363(&,$/352-(&7352&('85(6 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$XJXVW  (;+,%,7%    01 45 23 DAP TESTING AND INSPECTION SERVICES Page 1 of 2 CITY OF FORT WORTH STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS 7H[DV,QGXVWULHV$GGLWLRQ 1R/RW%ORFN &LW\3URMHFWRevised March 20, 2020 SECTION 01 45 23 TESTING AND INSPECTION SERVICES PART 1 - GENERAL 1.1 SUMMARY A. Section Includes: 1. Testing and inspection services procedures and coordination B. Deviations from this City of Fort Worth Standard Specification 1. None. C. Related Specification Sections include, but are not necessarily limited to: 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 2. Division 1 – General Requirements 1.2 PRICE AND PAYMENT PROCEDURES A. Measurement and Payment 1. Work associated with this Item is considered subsidiary to the various Items bid. No separate payment will be allowed for this Item. a. Contractor is responsible for performing, coordinating, and payment of all Quality Control testing. b. City is responsible for performing and payment for first set of Quality Assurance testing. 1) If the first Quality Assurance test performed by the City fails, the Contractor is responsible for payment of subsequent Quality Assurance testing until a passing test occurs. a) Final acceptance will not be issued by City until all required payments for testing by Contractor have been paid in full. 1.3 REFERENCES [NOT USED] 1.4 ADMINISTRATIVE REQUIREMENTS A. Testing 1. Complete testing in accordance with the Contract Documents. 2. Coordination a. When testing is required to be performed by the City, notify City, sufficiently in advance, when testing is needed. b. When testing is required to be completed by the Contractor, notify City, sufficiently in advance, that testing will be performed. 3. Distribution of Testing Reports a. Electronic Distribution 1) Confirm development of Project directory for electronic submittals to be uploaded to the City’s document management system, or another form of distribution approved by the City. 01 45 23 DAP TESTING AND INSPECTION SERVICES Page 2 of 2 CITY OF FORT WORTH STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS 7H[DV,QGXVWULHV$GGLWLRQ1R /RW%ORFN &LW\3URMHFWRevised March 20, 2020 2) Upload test reports to designated project directory and notify appropriate City representatives via email of submittal posting. 3) Hard Copies a) 1 copy for all submittals submitted to the Project Representative b. Hard Copy Distribution (if required in lieu of electronic distribution) 1) Tests performed by City a) Distribute 1 hard copy to the Contractor 2) Tests performed by the Contractor a) Distribute 3 hard copies to City’s Project Representative 4. Provide City’s Project Representative with trip tickets for each delivered load of Concrete or Lime material including the following information: a. Name of pit b. Date of delivery c. Material delivered B. Inspection 1. Inspection or lack of inspection does not relieve the Contractor from obligation to perform work in accordance with the Contract Documents. 1.5 SUBMITTALS [NOT USED] 1.6 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS [NOT USED] 1.7 CLOSEOUT SUBMITTALS [NOT USED] 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 1.9 QUALITY ASSURANCE [NOT USED] 1.10 DELIVERY, STORAGE, AND HANDLING [NOT USED] 1.11 FIELD [SITE] CONDITIONS [NOT USED] 1.12 WARRANTY [NOT USED] PART 2 - PRODUCTS [NOT USED] PART 3 - EXECUTION [NOT USED] END OF SECTION Revision Log DATE NAME SUMMARY OF CHANGE 03/20/2020 D.V. Magaña Removed reference to Buzzsaw and noted that electronic submittals be uploaded through the City’s document management system.  '$37(0325$5<)$&,/,7,(6$1'&21752/6 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG-8/<  6(&7,21 7(0325$5<)$&,/,7,(6$1'&21752/6 3$57*(1(5$/ 6800$5< $6HFWLRQ,QFOXGHV 3URYLGHWHPSRUDU\IDFLOLWLHVDQGFRQWUROVQHHGHGIRUWKH:RUNLQFOXGLQJEXWQRW QHFHVVDULO\OLPLWHGWR D7HPSRUDU\XWLOLWLHV E6DQLWDU\IDFLOLWLHV F6WRUDJH6KHGVDQG%XLOGLQJV G'XVWFRQWURO H7HPSRUDU\IHQFLQJRIWKHFRQVWUXFWLRQVLWH %'HYLDWLRQVIURPWKLV&LW\RI)RUW:RUWK6WDQGDUG6SHFLILFDWLRQ 1RQH &5HODWHG6SHFLILFDWLRQ6HFWLRQVLQFOXGHEXWDUHQRWQHFHVVDULO\OLPLWHGWR 'LYLVLRQ±%LGGLQJ5HTXLUHPHQWV&RQWUDFW)RUPVDQG&RQGLWLRQVRIWKH&RQWUDFW 'LYLVLRQ±*HQHUDO5HTXLUHPHQWV 35,&($1'3$<0(17352&('85(6 $0HDVXUHPHQWDQG3D\PHQW :RUNDVVRFLDWHGZLWKWKLV,WHPLVFRQVLGHUHGVXEVLGLDU\WRWKHYDULRXV,WHPVELG 1RVHSDUDWHSD\PHQWZLOOEHDOORZHGIRUWKLV,WHP 5()(5(1&(6>12786('@ $'0,1,675$7,9(5(48,5(0(176 $7HPSRUDU\8WLOLWLHV 2EWDLQLQJ7HPSRUDU\6HUYLFH D0DNHDUUDQJHPHQWVZLWKXWLOLW\VHUYLFHFRPSDQLHVIRUWHPSRUDU\VHUYLFHV E$ELGHE\UXOHVDQGUHJXODWLRQVRIXWLOLW\VHUYLFHFRPSDQLHVRUDXWKRULWLHV KDYLQJMXULVGLFWLRQ F%HUHVSRQVLEOHIRUXWLOLW\VHUYLFHFRVWVXQWLO:RUNLVDSSURYHGIRU)LQDO $FFHSWDQFH  ,QFOXGHGDUHIXHOSRZHUOLJKWKHDWDQGRWKHUXWLOLW\VHUYLFHVQHFHVVDU\IRU H[HFXWLRQFRPSOHWLRQWHVWLQJDQGLQLWLDORSHUDWLRQRI:RUN :DWHU D&RQWUDFWRUWRSURYLGHZDWHUUHTXLUHGIRUDQGLQFRQQHFWLRQZLWK:RUNWREH SHUIRUPHGDQGIRUVSHFLILHGWHVWVRISLSLQJHTXLSPHQWGHYLFHVRURWKHUXVHDV UHTXLUHGIRUWKHFRPSOHWLRQRIWKH:RUN E3URYLGHDQGPDLQWDLQDGHTXDWHVXSSO\RISRWDEOHZDWHUIRUGRPHVWLF FRQVXPSWLRQE\&RQWUDFWRUSHUVRQQHODQG&LW\¶V3URMHFW5HSUHVHQWDWLYHV F&RRUGLQDWLRQ  &RQWDFW&LW\ZHHNEHIRUHZDWHUIRUFRQVWUXFWLRQLVGHVLUHG  '$37(0325$5<)$&,/,7,(6$1'&21752/6 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG-8/<  G&RQWUDFWRU3D\PHQWIRU&RQVWUXFWLRQ:DWHU  2EWDLQFRQVWUXFWLRQZDWHUPHWHUIURP&LW\IRUSD\PHQWDVELOOHGE\&LW\¶V HVWDEOLVKHGUDWHV (OHFWULFLW\DQG/LJKWLQJ D3URYLGHDQGSD\IRUHOHFWULFSRZHUHGVHUYLFHDVUHTXLUHGIRU:RUNLQFOXGLQJ WHVWLQJRI:RUN  3URYLGHSRZHUIRUOLJKWLQJRSHUDWLRQRIHTXLSPHQWRURWKHUXVH E(OHFWULFSRZHUVHUYLFHLQFOXGHVWHPSRUDU\SRZHUVHUYLFHRUJHQHUDWRUWR PDLQWDLQRSHUDWLRQVGXULQJVFKHGXOHGVKXWGRZQ 7HOHSKRQH D3URYLGHHPHUJHQF\WHOHSKRQHVHUYLFHDW6LWHIRUXVHE\&RQWUDFWRUSHUVRQQHO DQGRWKHUVSHUIRUPLQJZRUNRUIXUQLVKLQJVHUYLFHVDW6LWH 7HPSRUDU\+HDWDQG9HQWLODWLRQ D3URYLGHWHPSRUDU\KHDWDVQHFHVVDU\IRUSURWHFWLRQRUFRPSOHWLRQRI:RUN E3URYLGHWHPSRUDU\KHDWDQGYHQWLODWLRQWRDVVXUHVDIHZRUNLQJFRQGLWLRQV %6DQLWDU\)DFLOLWLHV 3URYLGHDQGPDLQWDLQVDQLWDU\IDFLOLWLHVIRUSHUVRQVRQ6LWH D&RPSO\ZLWKUHJXODWLRQVRI6WDWHDQGORFDOGHSDUWPHQWVRIKHDOWK (QIRUFHXVHRIVDQLWDU\IDFLOLWLHVE\FRQVWUXFWLRQSHUVRQQHODWMREVLWH D(QFORVHDQGDQFKRUVDQLWDU\IDFLOLWLHV E1RGLVFKDUJHZLOOEHDOORZHGIURPWKHVHIDFLOLWLHV F&ROOHFWDQGVWRUHVHZDJHDQGZDVWHVRDVQRWWRFDXVHQXLVDQFHRUKHDOWK SUREOHP G+DXOVHZDJHDQGZDVWHRIIVLWHDWQROHVVWKDQZHHNO\LQWHUYDOVDQGSURSHUO\ GLVSRVHLQDFFRUGDQFHZLWKDSSOLFDEOHUHJXODWLRQ /RFDWHIDFLOLWLHVQHDU:RUN6LWHDQGNHHSFOHDQDQGPDLQWDLQHGWKURXJKRXW3URMHFW 5HPRYHIDFLOLWLHVDWFRPSOHWLRQRI3URMHFW &6WRUDJH6KHGVDQG%XLOGLQJV 3URYLGHDGHTXDWHO\YHQWLODWHGZDWHUWLJKWZHDWKHUSURRIVWRUDJHIDFLOLWLHVZLWKIORRU DERYHJURXQGOHYHOIRUPDWHULDOVDQGHTXLSPHQWVXVFHSWLEOHWRZHDWKHUGDPDJH 6WRUDJHRIPDWHULDOVQRWVXVFHSWLEOHWRZHDWKHUGDPDJHPD\EHRQEORFNVRII JURXQG 6WRUHPDWHULDOVLQDQHDWDQGRUGHUO\PDQQHU D3ODFHPDWHULDOVDQGHTXLSPHQWWRSHUPLWHDV\DFFHVVIRULGHQWLILFDWLRQ LQVSHFWLRQDQGLQYHQWRU\ (TXLSEXLOGLQJZLWKORFNDEOHGRRUVDQGOLJKWLQJDQGSURYLGHHOHFWULFDOVHUYLFHIRU HTXLSPHQWVSDFHKHDWHUVDQGKHDWLQJRUYHQWLODWLRQDVQHFHVVDU\WRSURYLGHVWRUDJH HQYLURQPHQWVDFFHSWDEOHWRVSHFLILHGPDQXIDFWXUHUV )LOODQGJUDGHVLWHIRUWHPSRUDU\VWUXFWXUHVWRSURYLGHGUDLQDJHDZD\IURP WHPSRUDU\DQGH[LVWLQJEXLOGLQJV 5HPRYHEXLOGLQJIURPVLWHSULRUWR)LQDO$FFHSWDQFH '7HPSRUDU\)HQFLQJ 3URYLGHDQGPDLQWDLQIRUWKHGXUDWLRQRUFRQVWUXFWLRQZKHQUHTXLUHGLQFRQWUDFW GRFXPHQWV ('XVW&RQWURO  '$37(0325$5<)$&,/,7,(6$1'&21752/6 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG-8/<  &RQWUDFWRULVUHVSRQVLEOHIRUPDLQWDLQLQJGXVWFRQWUROWKURXJKWKHGXUDWLRQRIWKH SURMHFW D&RQWUDFWRUUHPDLQVRQFDOODWDOOWLPHV E0XVWUHVSRQGLQDWLPHO\PDQQHU )7HPSRUDU\3URWHFWLRQRI&RQVWUXFWLRQ &RQWUDFWRURUVXEFRQWUDFWRUVDUHUHVSRQVLEOHIRUSURWHFWLQJ:RUNIURPGDPDJHGXH WRZHDWKHU 68%0,77$/6>12786('@ $&7,2168%0,77$/6,1)250$7,21$/68%0,77$/6>12786('@ &/26(28768%0,77$/6>12786('@ 0$,17(1$1&(0$7(5,$/68%0,77$/6>12786('@ 48$/,7<$6685$1&(>12786('@ '(/,9(5<6725$*($1'+$1'/,1*>12786('@ ),(/'>6,7(@&21',7,216>12786('@ :$55$17<>12786('@ 3$57352'8&76>12786('@ 3$57(;(&87,21>12786('@ ,167$//(56>12786('@ (;$0,1$7,21>12786('@ 35(3$5$7,21>12786('@ ,167$//$7,21 $7HPSRUDU\)DFLOLWLHV 0DLQWDLQDOOWHPSRUDU\IDFLOLWLHVIRUGXUDWLRQRIFRQVWUXFWLRQDFWLYLWLHVDVQHHGHG >5(3$,5@>5(6725$7,21@ 5(,167$//$7,21 ),(/'>25@6,7(48$/,7<&21752/>12786('@ 6<67(067$5783>12786('@ $'-867,1*>12786('@ &/($1,1*>12786('@ &/26(287$&7,9,7,(6 $7HPSRUDU\)DFLOLWLHV  '$37(0325$5<)$&,/,7,(6$1'&21752/6 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG-8/<  5HPRYHDOOWHPSRUDU\IDFLOLWLHVDQGUHVWRUHDUHDDIWHUFRPSOHWLRQRIWKH:RUNWRD FRQGLWLRQHTXDOWRRUEHWWHUWKDQSULRUWRVWDUWRI:RUN 3527(&7,21>12786('@ 0$,17(1$1&(>12786('@ $77$&+0(176>12786('@ (1'2)6(&7,21  5HYLVLRQ/RJ '$7( 1$0( 6800$5<2)&+$1*(       '$3675((786(3(50,7$1'02',),&$7,2167275$)),&&21752/ 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG-XO\  6(&7,21 675((786(3(50,7$1'02',),&$7,2167275$)),&&21752/ 3$57*(1(5$/ 6800$5< $6HFWLRQ,QFOXGHV $GPLQLVWUDWLYHSURFHGXUHVIRU D6WUHHW8VH3HUPLW E0RGLILFDWLRQRIDSSURYHGWUDIILFFRQWURO F5HPRYDORI6WUHHW6LJQV %'HYLDWLRQVIURPWKLV&LW\RI)RUW:RUWK6WDQGDUG6SHFLILFDWLRQ 1RQH &5HODWHG6SHFLILFDWLRQ6HFWLRQVLQFOXGHEXWDUHQRWQHFHVVDULO\OLPLWHGWR 'LYLVLRQ±%LGGLQJ5HTXLUHPHQWV&RQWUDFW)RUPVDQG&RQGLWLRQVRIWKH&RQWUDFW 'LYLVLRQ±*HQHUDO5HTXLUHPHQWV 6HFWLRQ±7UDIILF&RQWURO 35,&($1'3$<0(17352&('85(6 $0HDVXUHPHQWDQG3D\PHQW :RUNDVVRFLDWHGZLWKWKLV,WHPLVFRQVLGHUHGVXEVLGLDU\WRWKHYDULRXV,WHPVELG 1RVHSDUDWHSD\PHQWZLOOEHDOORZHGIRUWKLV,WHP 5()(5(1&(6 $5HIHUHQFH6WDQGDUGV 5HIHUHQFHVWDQGDUGVFLWHGLQWKLVVSHFLILFDWLRQUHIHUWRWKHFXUUHQWUHIHUHQFHVWDQGDUG SXEOLVKHGDWWKHWLPHRIWKHODWHVWUHYLVLRQGDWHORJJHGDWWKHHQGRIWKLV VSHFLILFDWLRQXQOHVVDGDWHLVVSHFLILFDOO\FLWHG 7H[DV0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV 7087&'  $'0,1,675$7,9(5(48,5(0(176 $7UDIILF&RQWURO *HQHUDO D:KHQWUDIILFFRQWUROSODQVDUHLQFOXGHGLQWKH'UDZLQJVSURYLGH7UDIILF &RQWUROLQDFFRUGDQFHZLWK'UDZLQJVDQG6HFWLRQ E:KHQWUDIILFFRQWUROSODQVDUHQRWLQFOXGHGLQWKH'UDZLQJVSUHSDUHWUDIILF FRQWUROSODQVLQDFFRUGDQFHZLWK6HFWLRQDQGVXEPLWWR&LW\IRU UHYLHZ  $OORZPLQLPXPZRUNLQJGD\VIRUUHYLHZRISURSRVHG7UDIILF&RQWURO %6WUHHW8VH3HUPLW 3ULRUWRLQVWDOODWLRQRI7UDIILF&RQWUROD&LW\6WUHHW8VH3HUPLWLVUHTXLUHG D7RREWDLQ6WUHHW8VH3HUPLWVXEPLW7UDIILF&RQWURO3ODQVWR&LW\ 7UDQVSRUWDWLRQDQG3XEOLF:RUNV'HSDUWPHQW  '$3675((786(3(50,7$1'02',),&$7,2167275$)),&&21752/ 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG-XO\   $OORZDPLQLPXPRIZRUNLQJGD\VIRUSHUPLWUHYLHZ  &RQWUDFWRU¶VUHVSRQVLELOLW\WRFRRUGLQDWHUHYLHZRI7UDIILF&RQWUROSODQVIRU 6WUHHW8VH3HUPLWVXFKWKDWFRQVWUXFWLRQLVQRWGHOD\HG &0RGLILFDWLRQWR$SSURYHG7UDIILF&RQWURO 3ULRUWRLQVWDOODWLRQWUDIILFFRQWURO D6XEPLWUHYLVHGWUDIILFFRQWUROSODQVWR&LW\'HSDUWPHQW7UDQVSRUWDWLRQDQG 3XEOLF:RUNV'HSDUWPHQW  5HYLVH7UDIILF&RQWUROSODQVLQDFFRUGDQFHZLWK6HFWLRQ  $OORZPLQLPXPZRUNLQJGD\VIRUUHYLHZRIUHYLVHG7UDIILF&RQWURO  ,WLVWKH&RQWUDFWRU¶VUHVSRQVLELOLW\WRFRRUGLQDWHUHYLHZRI7UDIILF&RQWURO SODQVIRU6WUHHW8VH3HUPLWVXFKWKDWFRQVWUXFWLRQLVQRWGHOD\HG '5HPRYDORI6WUHHW6LJQ ,ILWLVGHWHUPLQHGWKDWDVWUHHWVLJQPXVWEHUHPRYHGIRUFRQVWUXFWLRQWKHQFRQWDFW &LW\7UDQVSRUWDWLRQDQG3XEOLF:RUNV'HSDUWPHQW6LJQVDQG0DUNLQJV'LYLVLRQWR UHPRYHWKHVLJQ (7HPSRUDU\6LJQDJH ,QWKHFDVHRIUHJXODWRU\VLJQVUHSODFHSHUPDQHQWVLJQZLWKWHPSRUDU\VLJQPHHWLQJ UHTXLUHPHQWVRIWKHODWHVWHGLWLRQRIWKH7H[DV0DQXDORQ8QLIRUP7UDIILF&RQWURO 'HYLFHV 087&'  ,QVWDOOWHPSRUDU\VLJQEHIRUHWKHUHPRYDORISHUPDQHQWVLJQ :KHQFRQVWUXFWLRQLVFRPSOHWHWRWKHH[WHQWWKDWWKHSHUPDQHQWVLJQFDQEH UHLQVWDOOHGFRQWDFWWKH&LW\7UDQVSRUWDWLRQDQG3XEOLF:RUNV'HSDUWPHQW6LJQV DQG0DUNLQJV'LYLVLRQWRUHLQVWDOOWKHSHUPDQHQWVLJQ )7UDIILF&RQWURO6WDQGDUGV 7UDIILF&RQWURO6WDQGDUGVFDQEHIRXQGRQWKH&LW\¶V%X]]VDZZHEVLWH 68%0,77$/6>12786('@ $&7,2168%0,77$/6,1)250$7,21$/68%0,77$/6>12786('@ &/26(28768%0,77$/6>12786('@ 0$,17(1$1&(0$7(5,$/68%0,77$/6>12786('@ 48$/,7<$6685$1&(>12786('@ '(/,9(5<6725$*($1'+$1'/,1*>12786('@ ),(/'>6,7(@&21',7,216>12786('@ :$55$17<>12786('@ 3$57352'8&76>12786('@ 3$57(;(&87,21>12786('@ (1'2)6(&7,21  '$3675((786(3(50,7$1'02',),&$7,2167275$)),&&21752/ 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG-XO\   5HYLVLRQ/RJ '$7( 1$0( 6800$5<2)&+$1*(       '$367250:$7(532//87,2135(9(17,21 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG-XO\  6(&7,21 67250:$7(532//87,2135(9(17,21 3$57*(1(5$/ 6800$5< $6HFWLRQ,QFOXGHV 3URFHGXUHVIRU6WRUP:DWHU3ROOXWLRQ3UHYHQWLRQ3ODQV %'HYLDWLRQVIURPWKLV&LW\RI)RUW:RUWK6WDQGDUG6SHFLILFDWLRQ 1RQH &5HODWHG6SHFLILFDWLRQ6HFWLRQVLQFOXGHEXWDUHQRWQHFHVVDULO\OLPLWHGWR 'LYLVLRQ±%LGGLQJ5HTXLUHPHQWV&RQWUDFW)RUPVDQG&RQGLWLRQVRIWKH &RQWUDFW 'LYLVLRQ±*HQHUDO5HTXLUHPHQWV 6HFWLRQ±(URVLRQDQG6HGLPHQW&RQWURO 35,&($1'3$<0(17352&('85(6 $0HDVXUHPHQWDQG3D\PHQW &RQVWUXFWLRQ$FWLYLWLHVUHVXOWLQJLQOHVVWKDQDFUHRIGLVWXUEDQFH D:RUNDVVRFLDWHGZLWKWKLV,WHPLVFRQVLGHUHGVXEVLGLDU\WRWKHYDULRXV,WHPV ELG1RVHSDUDWHSD\PHQWZLOOEHDOORZHGIRUWKLV,WHP &RQVWUXFWLRQ$FWLYLWLHVUHVXOWLQJLQJUHDWHUWKDQDFUHRIGLVWXUEDQFH D0HDVXUHPHQWDQG3D\PHQWVKDOOEHLQDFFRUGDQFHZLWK6HFWLRQ 5()(5(1&(6 $$EEUHYLDWLRQVDQG$FURQ\PV 1RWLFHRI,QWHQW12, 1RWLFHRI7HUPLQDWLRQ127 6WRUP:DWHU3ROOXWLRQ3UHYHQWLRQ3ODQ6:333 7H[DV&RPPLVVLRQRQ(QYLURQPHQWDO4XDOLW\7&(4 1RWLFHRI&KDQJH12& $5HIHUHQFH6WDQGDUGV 5HIHUHQFHVWDQGDUGVFLWHGLQWKLV6SHFLILFDWLRQUHIHUWRWKHFXUUHQWUHIHUHQFH VWDQGDUGSXEOLVKHGDWWKHWLPHRIWKHODWHVWUHYLVLRQGDWHORJJHGDWWKHHQGRIWKLV 6SHFLILFDWLRQXQOHVVDGDWHLVVSHFLILFDOO\FLWHG ,QWHJUDWHG6WRUP0DQDJHPHQW L6:0 7HFKQLFDO0DQXDOIRU&RQVWUXFWLRQ &RQWUROV $'0,1,675$7,9(5(48,5(0(176 $*HQHUDO &RQWUDFWRULVUHVSRQVLEOHIRUUHVROXWLRQDQGSD\PHQWRIDQ\ILQHVLVVXHGDVVRFLDWHG ZLWKFRPSOLDQFHWR6WRUPZDWHU3ROOXWLRQ3UHYHQWLRQ3ODQ  '$367250:$7(532//87,2135(9(17,21 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG-XO\  %&RQVWUXFWLRQ$FWLYLWLHVUHVXOWLQJLQ /HVVWKDQDFUHRIGLVWXUEDQFH D3URYLGHHURVLRQDQGVHGLPHQWFRQWUROLQDFFRUGDQFHZLWK6HFWLRQDQG 'UDZLQJV WROHVVWKDQDFUHVRIGLVWXUEDQFH D7H[DV3ROOXWDQW'LVFKDUJH(OLPLQDWLRQ6\VWHP 73'(6 *HQHUDO&RQVWUXFWLRQ 3HUPLWLVUHTXLUHG E&RPSOHWH6:333LQDFFRUGDQFHZLWK7&(4UHTXLUHPHQWV  7&(46PDOO&RQVWUXFWLRQ6LWH1RWLFH5HTXLUHGXQGHUJHQHUDOSHUPLW 7;5 D 6LJQDQGSRVWDWMREVLWH E 3ULRUWR3UHFRQVWUXFWLRQ0HHWLQJVHQGFRS\WR&LW\'HSDUWPHQWRI 7UDQVSRUWDWLRQDQG3XEOLF:RUNV(QYLURQPHQWDO'LYLVLRQ     3URYLGHHURVLRQDQGVHGLPHQWFRQWUROLQDFFRUGDQFHZLWK D 6HFWLRQ E 7KH'UDZLQJV F 7;5*HQHUDO3HUPLW G 6:333 H 7&(4UHTXLUHPHQWV DFUHVRUPRUHRI'LVWXUEDQFH D7H[DV3ROOXWDQW'LVFKDUJH(OLPLQDWLRQ6\VWHP 73'(6 *HQHUDO&RQVWUXFWLRQ 3HUPLWLVUHTXLUHG E&RPSOHWH6:333LQDFFRUGDQFHZLWK7&(4UHTXLUHPHQWV  3UHSDUHD7&(412,IRUPDQGVXEPLWWR7&(4DORQJZLWKUHTXLUHGIHH D 6LJQDQGSRVWDWMREVLWH E 6HQGFRS\WR&LW\'HSDUWPHQWRI7UDQVSRUWDWLRQDQG3XEOLF:RUNV (QYLURQPHQWDO'LYLVLRQ    7&(41RWLFHRI&KDQJHUHTXLUHGLIPDNLQJFKDQJHVRUXSGDWHVWR12,  3URYLGHHURVLRQDQGVHGLPHQWFRQWUROLQDFFRUGDQFHZLWK D 6HFWLRQ E 7KH'UDZLQJV F 7;5*HQHUDO3HUPLW G 6:333 H 7&(4UHTXLUHPHQWV  2QFHWKHSURMHFWKDVEHHQFRPSOHWHGDQGDOOWKHFORVHRXWUHTXLUHPHQWVRI 7&(4KDYHEHHQPHWD7&(41RWLFHRI7HUPLQDWLRQFDQEHVXEPLWWHG D 6HQGFRS\WR&LW\'HSDUWPHQWRI7UDQVSRUWDWLRQDQG3XEOLF:RUNV (QYLURQPHQWDO'LYLVLRQ   68%0,77$/6 $6:333 6XEPLWLQDFFRUGDQFHZLWK6HFWLRQH[FHSWDVVWDWHGKHUHLQ D3ULRUWRWKH3UHFRQVWUXFWLRQ0HHWLQJVXEPLWDGUDIWFRS\RI6:333WRWKH&LW\ DVIROORZV  FRS\WRWKH&LW\3URMHFW0DQDJHU D &LW\3URMHFW0DQDJHUZLOOIRUZDUGWRWKH&LW\'HSDUWPHQWRI 7UDQVSRUWDWLRQDQG3XEOLF:RUNV(QYLURQPHQWDO'LYLVLRQIRUUHYLHZ  '$367250:$7(532//87,2135(9(17,21 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG-XO\  %0RGLILHG6:333 ,IWKH6:333LVUHYLVHGGXULQJFRQVWUXFWLRQUHVXEPLWPRGLILHG6:333WRWKH&LW\ LQDFFRUGDQFHZLWK6HFWLRQ $&7,2168%0,77$/6,1)250$7,21$/68%0,77$/6>12786('@ &/26(28768%0,77$/6>12786('@ 0$,17(1$1&(0$7(5,$/68%0,77$/6>12786('@ 48$/,7<$6685$1&(>12786('@ '(/,9(5<6725$*($1'+$1'/,1*>12786('@ ),(/'>6,7(@&21',7,216>12786('@ :$55$17<>12786('@ 3$57352'8&76>12786('@ 3$57(;(&87,21>12786('@ (1'2)6(&7,21  5HYLVLRQ/RJ '$7( 1$0( 6800$5<2)&+$1*(      01 60 00 DAP PRODUCT REQUIREMENTS Page 1 of 2 CITY OF FORT WORTH STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS 7H[DV,QGXVWULHV$GGLWLRQ1R /RW%ORFN &LW\3URMHFWRevised March 20, 2020 SECTION 01 60 00 PRODUCT REQUIREMENTS PART 1 - GENERAL 1.1 SUMMARY A. Section Includes: 1. References for Product Requirements and City Standard Products List B. Deviations from this City of Fort Worth Standard Specification 1. None. C. Related Specification Sections include, but are not necessarily limited to: 1. Division 0 – Bidding Requirements, Contract Forms and Conditions of the Contract 2. Division 1 – General Requirements 1.2 PRICE AND PAYMENT PROCEDURES [NOT USED] 1.3 REFERENCES [NOT USED] 1.4 ADMINISTRATIVE REQUIREMENTS A list of City approved products for use is available through the City’s website at: https://apps.fortworthtexas.gov/ProjectResources/ and following the directory path: 02 - Construction Documents\Standard Products List A. Only products specifically included on City’s Standard Product List in these Contract Documents shall be allowed for use on the Project. 1. Any subsequently approved products will only be allowed for use upon specific approval by the City. B. Any specific product requirements in the Contract Documents supersede similar products included on the City’s Standard Product List. 1. The City reserves the right to not allow products to be used for certain projects even though the product is listed on the City’s Standard Product List. C. Although a specific product is included on City’s Standard Product List, not all products from that manufacturer are approved for use, including but not limited to, that manufacturer’s standard product. D. See Section 01 33 00 for submittal requirements of Product Data included on City’s Standard Product List. 1.5 SUBMITTALS [NOT USED] 1.6 ACTION SUBMITTALS/INFORMATIONAL SUBMITTALS [NOT USED] 1.7 CLOSEOUT SUBMITTALS [NOT USED] 1.8 MAINTENANCE MATERIAL SUBMITTALS [NOT USED] 1.9 QUALITY ASSURANCE [NOT USED] 01 60 00 DAP PRODUCT REQUIREMENTS Page 2 of 2 CITY OF FORT WORTH STANDARD CONSTRUCTION SPECIFICATION DOCUMENTS – DEVELOPER AWARDED PROJECTS 7H[DV,QGXVWULHV$GGLWLRQ 1R/RW%ORFN &LW\3URMHFWRevised March 20, 2020 1.10 DELIVERY, STORAGE, AND HANDLING [NOT USED] 1.11 FIELD [SITE] CONDITIONS [NOT USED] 1.12 WARRANTY [NOT USED] PART 2 - PRODUCTS [NOT USED] PART 3 - EXECUTION [NOT USED] END OF SECTION Revision Log DATE NAME SUMMARY OF CHANGE 10/12/12 D. Johnson Modified Location of City’s Standard Product List 4/7/2014 M.Domenech Revised for DAP application 03/20/2020 D.V. Magaña Removed reference to Buzzsaw and noted that the City approved products list is accessible through the City’s website.  '$3352'8&76725$*($1'+$1'/,1*5(48,5(0(176 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$SULO  6(&7,21 352'8&76725$*($1'+$1'/,1*5(48,5(0(176 3$57*(1(5$/ 6800$5< $6HFWLRQ,QFOXGHV 6FKHGXOLQJRISURGXFWGHOLYHU\ 3DFNDJLQJRISURGXFWVIRUGHOLYHU\ 3URWHFWLRQRISURGXFWVDJDLQVWGDPDJHIURP D+DQGOLQJ E([SRVXUHWRHOHPHQWVRUKDUVKHQYLURQPHQWV %'HYLDWLRQVIURPWKLV&LW\RI)RUW:RUWK6WDQGDUG6SHFLILFDWLRQ 1RQH &5HODWHG6SHFLILFDWLRQ6HFWLRQVLQFOXGHEXWDUHQRWQHFHVVDULO\OLPLWHGWR 'LYLVLRQ±%LGGLQJ5HTXLUHPHQWV&RQWUDFW)RUPVDQG&RQGLWLRQVRIWKH&RQWUDFW 'LYLVLRQ±*HQHUDO5HTXLUHPHQWV 35,&($1'3$<0(17352&('85(6 $0HDVXUHPHQWDQG3D\PHQW :RUNDVVRFLDWHGZLWKWKLV,WHPLVFRQVLGHUHGVXEVLGLDU\WRWKHYDULRXV,WHPVELG 1RVHSDUDWHSD\PHQWZLOOEHDOORZHGIRUWKLV,WHP 5()(5(1&(6>12786('@ $'0,1,675$7,9(5(48,5(0(176>12786('@ 68%0,77$/6>12786('@ $&7,2168%0,77$/6,1)250$7,21$/68%0,77$/6>12786('@ &/26(28768%0,77$/6>12786('@ 0$,17(1$1&(0$7(5,$/68%0,77$/6>12786('@ 48$/,7<$6685$1&(>12786('@ '(/,9(5<$1'+$1'/,1* $'HOLYHU\5HTXLUHPHQWV 6FKHGXOHGHOLYHU\RISURGXFWVRUHTXLSPHQWDVUHTXLUHGWRDOORZWLPHO\LQVWDOODWLRQ DQGWRDYRLGSURORQJHGVWRUDJH 3URYLGHDSSURSULDWHSHUVRQQHODQGHTXLSPHQWWRUHFHLYHGHOLYHULHV 'HOLYHU\WUXFNVZLOOQRWEHSHUPLWWHGWRZDLWH[WHQGHGSHULRGVRIWLPHRQWKH6LWH IRUSHUVRQQHORUHTXLSPHQWWRUHFHLYHWKHGHOLYHU\  '$3352'8&76725$*($1'+$1'/,1*5(48,5(0(176 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$SULO  'HOLYHUSURGXFWVRUHTXLSPHQWLQPDQXIDFWXUHU VRULJLQDOXQEURNHQFDUWRQVRURWKHU FRQWDLQHUVGHVLJQHGDQGFRQVWUXFWHGWRSURWHFWWKHFRQWHQWVIURPSK\VLFDORU HQYLURQPHQWDOGDPDJH &OHDUO\DQGIXOO\PDUNDQGLGHQWLI\DVWRPDQXIDFWXUHULWHPDQGLQVWDOODWLRQ ORFDWLRQ 3URYLGHPDQXIDFWXUHU VLQVWUXFWLRQVIRUVWRUDJHDQGKDQGOLQJ %+DQGOLQJ5HTXLUHPHQWV +DQGOHSURGXFWVRUHTXLSPHQWLQDFFRUGDQFHZLWKWKHVH&RQWUDFW'RFXPHQWVDQG PDQXIDFWXUHU¶VUHFRPPHQGDWLRQVDQGLQVWUXFWLRQV &6WRUDJH5HTXLUHPHQWV 6WRUHPDWHULDOVLQDFFRUGDQFHZLWKPDQXIDFWXUHU¶VUHFRPPHQGDWLRQVDQG UHTXLUHPHQWVRIWKHVH6SHFLILFDWLRQV 0DNHQHFHVVDU\SURYLVLRQVIRUVDIHVWRUDJHRIPDWHULDOVDQGHTXLSPHQW D3ODFHORRVHVRLOPDWHULDOVDQGPDWHULDOVWREHLQFRUSRUDWHGLQWR:RUNWRSUHYHQW GDPDJHWRDQ\SDUWRI:RUNRUH[LVWLQJIDFLOLWLHVDQGWRPDLQWDLQIUHHDFFHVVDW DOOWLPHVWRDOOSDUWVRI:RUNDQGWRXWLOLW\VHUYLFHFRPSDQ\LQVWDOODWLRQVLQ YLFLQLW\RI:RUN .HHSPDWHULDOVDQGHTXLSPHQWQHDWO\DQGFRPSDFWO\VWRUHGLQORFDWLRQVWKDWZLOO FDXVHPLQLPXPLQFRQYHQLHQFHWRRWKHUFRQWUDFWRUVSXEOLFWUDYHODGMRLQLQJRZQHUV WHQDQWVDQGRFFXSDQWV D$UUDQJHVWRUDJHWRSURYLGHHDV\DFFHVVIRULQVSHFWLRQ 5HVWULFWVWRUDJHWRDUHDVDYDLODEOHRQFRQVWUXFWLRQVLWHIRUVWRUDJHRIPDWHULDODQG HTXLSPHQWDVVKRZQRQ'UDZLQJVRUDSSURYHGE\&LW\¶V3URMHFW5HSUHVHQWDWLYH 3URYLGHRIIVLWHVWRUDJHDQGSURWHFWLRQZKHQRQVLWHVWRUDJHLVQRWDGHTXDWH D3URYLGHDGGUHVVHVRIDQGDFFHVVWRRIIVLWHVWRUDJHORFDWLRQVIRULQVSHFWLRQE\ &LW\¶V3URMHFW5HSUHVHQWDWLYH 'RQRWXVHODZQVJUDVVSORWVRURWKHUSULYDWHSURSHUW\IRUVWRUDJHSXUSRVHVZLWKRXW ZULWWHQSHUPLVVLRQRIRZQHURURWKHUSHUVRQLQSRVVHVVLRQRUFRQWURORISUHPLVHV 6WRUHLQPDQXIDFWXUHUV¶XQRSHQHGFRQWDLQHUV 1HDWO\VDIHO\DQGFRPSDFWO\VWDFNPDWHULDOVGHOLYHUHGDQGVWRUHGDORQJOLQHRI :RUNWRDYRLGLQFRQYHQLHQFHDQGGDPDJHWRSURSHUW\RZQHUVDQGJHQHUDOSXEOLF DQGPDLQWDLQDWOHDVWIHHWIURPILUHK\GUDQW .HHSSXEOLFDQGSULYDWHGULYHZD\VDQGVWUHHWFURVVLQJVRSHQ 5HSDLURUUHSODFHGDPDJHGODZQVVLGHZDONVVWUHHWVRURWKHULPSURYHPHQWVWR VDWLVIDFWLRQRI&LW\¶V3URMHFW5HSUHVHQWDWLYH D7RWDOOHQJWKZKLFKPDWHULDOVPD\EHGLVWULEXWHGDORQJURXWHRIFRQVWUXFWLRQDW RQHWLPHLVOLQHDUIHHWXQOHVVRWKHUZLVHDSSURYHGLQZULWLQJE\&LW\¶V 3URMHFW5HSUHVHQWDWLYH  '$3352'8&76725$*($1'+$1'/,1*5(48,5(0(176 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$SULO  ),(/'>6,7(@&21',7,216>12786('@ :$55$17<>12786('@ 3$57352'8&76>12786('@ 3$57(;(&87,21 ,167$//(56>12786('@ (;$0,1$7,21>12786('@ 35(3$5$7,21>12786('@ (5(&7,21>12786('@ 5(3$,55(6725$7,21>12786('@ 5(,167$//$7,21>12786('@ ),(/'>25@6,7(48$/,7<&21752/ $7HVWVDQG,QVSHFWLRQV ,QVSHFWDOOSURGXFWVRUHTXLSPHQWGHOLYHUHGWRWKHVLWHSULRUWRXQORDGLQJ %1RQ&RQIRUPLQJ:RUN 5HMHFWDOOSURGXFWVRUHTXLSPHQWWKDWDUHGDPDJHGXVHGRULQDQ\RWKHUZD\ XQVDWLVIDFWRU\IRUXVHRQWKHSURMHFW 6<67(067$5783>12786('@ $'-867,1*>12786('@ &/($1,1*>12786('@ &/26(287$&7,9,7,(6>12786('@ 3527(&7,21 $3URWHFWDOOSURGXFWVRUHTXLSPHQWLQDFFRUGDQFHZLWKPDQXIDFWXUHU VZULWWHQGLUHFWLRQV %6WRUHSURGXFWVRUHTXLSPHQWLQORFDWLRQWRDYRLGSK\VLFDOGDPDJHWRLWHPVZKLOHLQ VWRUDJH &3URWHFWHTXLSPHQWIURPH[SRVXUHWRHOHPHQWVDQGNHHSWKRURXJKO\GU\LIUHTXLUHGE\ WKHPDQXIDFWXUHU 0$,17(1$1&(>12786('@ $77$&+0(176>12786('@ (1'2)6(&7,21   '$3352'8&76725$*($1'+$1'/,1*5(48,5(0(176 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$SULO  5HYLVLRQ/RJ '$7( 1$0( 6800$5<2)&+$1*(  0'RPHQHFK 5HYLVHGIRU'$3DSSOLFDWLRQ       '$302%,/,=$7,21$1'5(02%,/,=$7,21 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$SULO  6(&7,21 02%,/,=$7,21$1'5(02%,/,=$7,21 3$57*(1(5$/ 6800$5< $6HFWLRQ,QFOXGHV 0RELOL]DWLRQDQG'HPRELOL]DWLRQ D0RELOL]DWLRQ  7UDQVSRUWDWLRQRI&RQWUDFWRU¶VSHUVRQQHOHTXLSPHQWDQGRSHUDWLQJVXSSOLHV WRWKH6LWH  (VWDEOLVKPHQWRIQHFHVVDU\JHQHUDOIDFLOLWLHVIRUWKH&RQWUDFWRU¶VRSHUDWLRQ DWWKH6LWH  3UHPLXPVSDLGIRUSHUIRUPDQFHDQGSD\PHQWERQGV  7UDQVSRUWDWLRQRI&RQWUDFWRU¶VSHUVRQQHOHTXLSPHQWDQGRSHUDWLQJVXSSOLHV WRDQRWKHUORFDWLRQZLWKLQWKHGHVLJQDWHG6LWH  5HORFDWLRQRIQHFHVVDU\JHQHUDOIDFLOLWLHVIRUWKH&RQWUDFWRU¶VRSHUDWLRQ IURPORFDWLRQWRDQRWKHUORFDWLRQRQWKH6LWH E'HPRELOL]DWLRQ  7UDQVSRUWDWLRQRI&RQWUDFWRU¶VSHUVRQQHOHTXLSPHQWDQGRSHUDWLQJVXSSOLHV DZD\IURPWKH6LWHLQFOXGLQJGLVDVVHPEO\  6LWH&OHDQXS  5HPRYDORIDOOEXLOGLQJVDQGRURWKHUIDFLOLWLHVDVVHPEOHGDWWKH6LWHIRUWKLV &RQWUDFW F0RELOL]DWLRQDQG'HPRELOL]DWLRQGRQRWLQFOXGHDFWLYLWLHVIRUVSHFLILFLWHPVRI ZRUNWKDWDUHIRUZKLFKSD\PHQWLVSURYLGHGHOVHZKHUHLQWKHFRQWUDFW 5HPRELOL]DWLRQ D5HPRELOL]DWLRQIRU6XVSHQVLRQRI:RUNVSHFLILFDOO\UHTXLUHGLQWKH&RQWUDFW 'RFXPHQWVRUDVUHTXLUHGE\&LW\LQFOXGHV  'HPRELOL]DWLRQ D 7UDQVSRUWDWLRQRI&RQWUDFWRU¶VSHUVRQQHOHTXLSPHQWDQGRSHUDWLQJ VXSSOLHVIURPWKH6LWHLQFOXGLQJGLVDVVHPEO\RUWHPSRUDULO\VHFXULQJ HTXLSPHQWVXSSOLHVDQGRWKHUIDFLOLWLHVDVGHVLJQDWHGE\WKH&RQWUDFW 'RFXPHQWVQHFHVVDU\WRVXVSHQGWKH:RUN E 6LWH&OHDQXSDVGHVLJQDWHGLQWKH&RQWUDFW'RFXPHQWV  5HPRELOL]DWLRQ D 7UDQVSRUWDWLRQRI&RQWUDFWRU¶VSHUVRQQHOHTXLSPHQWDQGRSHUDWLQJ VXSSOLHVWRWKH6LWHQHFHVVDU\WRUHVXPHWKH:RUN E (VWDEOLVKPHQWRIQHFHVVDU\JHQHUDOIDFLOLWLHVIRUWKH&RQWUDFWRU¶V RSHUDWLRQDWWKH6LWHQHFHVVDU\WRUHVXPHWKH:RUN  1R3D\PHQWVZLOOEHPDGHIRU D 0RELOL]DWLRQDQG'HPRELOL]DWLRQIURPRQHORFDWLRQWRDQRWKHURQWKH 6LWHLQWKHQRUPDOSURJUHVVRISHUIRUPLQJWKH:RUN E 6WDQGE\RULGOHWLPH F /RVWSURILWV 0RELOL]DWLRQVDQG'HPRELOL]DWLRQIRU0LVFHOODQHRXV3URMHFWV D0RELOL]DWLRQDQG'HPRELOL]DWLRQ  '$302%,/,=$7,21$1'5(02%,/,=$7,21 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$SULO   0RELOL]DWLRQVKDOOFRQVLVWRIWKHDFWLYLWLHVDQGFRVWRQD:RUN2UGHUEDVLV QHFHVVDU\IRU D 7UDQVSRUWDWLRQRI&RQWUDFWRU¶VSHUVRQQHOHTXLSPHQWDQGRSHUDWLQJ VXSSOLHVWRWKH6LWHIRUWKHLVVXHG:RUN2UGHU E (VWDEOLVKPHQWRIQHFHVVDU\JHQHUDOIDFLOLWLHVIRUWKH&RQWUDFWRU¶V RSHUDWLRQDWWKH6LWHIRUWKHLVVXHG:RUN2UGHU  'HPRELOL]DWLRQVKDOOFRQVLVWRIWKHDFWLYLWLHVDQGFRVWQHFHVVDU\IRU D 7UDQVSRUWDWLRQRI&RQWUDFWRU¶VSHUVRQQHOHTXLSPHQWDQGRSHUDWLQJ VXSSOLHVIURPWKH6LWHLQFOXGLQJGLVDVVHPEO\IRUHDFKLVVXHG:RUN 2UGHU E 6LWH&OHDQXSIRUHDFKLVVXHG:RUN2UGHU F 5HPRYDORIDOOEXLOGLQJVRURWKHUIDFLOLWLHVDVVHPEOHGDWWKH6LWHIRU HDFK:RUN2GHU E0RELOL]DWLRQDQG'HPRELOL]DWLRQGRQRWLQFOXGHDFWLYLWLHVIRUVSHFLILFLWHPVRI ZRUNIRUZKLFKSD\PHQWLVSURYLGHGHOVHZKHUHLQWKHFRQWUDFW (PHUJHQF\0RELOL]DWLRQVDQG'HPRELOL]DWLRQIRU0LVFHOODQHRXV3URMHFWV D$0RELOL]DWLRQIRU0LVFHOODQHRXV3URMHFWVZKHQGLUHFWHGE\WKH&LW\DQGWKH PRELOL]DWLRQRFFXUVZLWKLQKRXUVRIWKHLVVXDQFHRIWKH:RUN2UGHU %'HYLDWLRQVIURPWKLV&LW\RI)RUW:RUWK6WDQGDUG6SHFLILFDWLRQ 1RQH &5HODWHG6SHFLILFDWLRQ6HFWLRQVLQFOXGHEXWDUHQRWQHFHVVDULO\OLPLWHGWR 'LYLVLRQ±%LGGLQJ5HTXLUHPHQWV&RQWUDFW)RUPVDQG&RQGLWLRQVRIWKH&RQWUDFW 'LYLVLRQ±*HQHUDO5HTXLUHPHQWV 35,&($1'3$<0(17352&('85(6 $0HDVXUHPHQWDQG3D\PHQW 0RELOL]DWLRQDQG'HPRELOL]DWLRQ D0HDVXUH  7KLV,WHPLVFRQVLGHUHGVXEVLGLDU\WRWKHYDULRXV,WHPVELG E3D\PHQW  7KHZRUNSHUIRUPHGDQGPDWHULDOVIXUQLVKHGLQDFFRUGDQFHZLWKWKLV,WHP DUHVXEVLGLDU\WRWKHYDULRXV,WHPVELGDQGQRRWKHUFRPSHQVDWLRQZLOOEH DOORZHG 5HPRELOL]DWLRQIRUVXVSHQVLRQRI:RUNDVVSHFLILFDOO\UHTXLUHGLQWKH&RQWUDFW 'RFXPHQWV D0HDVXUHPHQW  0HDVXUHPHQWIRUWKLV,WHPVKDOOEHSHUHDFKUHPRELOL]DWLRQSHUIRUPHG E3D\PHQW  7KHZRUNSHUIRUPHGDQGPDWHULDOVIXUQLVKHGLQDFFRUGDQFHZLWKWKLV,WHP DQGPHDVXUHGDVSURYLGHGXQGHU³0HDVXUHPHQW´ZLOOEHSDLGIRUDWWKHXQLW SULFHSHUHDFK³6SHFLILHG5HPRELOL]DWLRQ´LQDFFRUGDQFHZLWK&RQWUDFW 'RFXPHQWV F7KHSULFHVKDOOLQFOXGH  'HPRELOL]DWLRQDVGHVFULEHGLQ6HFWLRQ$D   5HPRELOL]DWLRQDVGHVFULEHGLQ6HFWLRQ$D  G1RSD\PHQWVZLOOEHPDGHIRUVWDQGE\LGOHWLPHRUORVWSURILWVDVVRFLDWHGWKLV ,WHP  '$302%,/,=$7,21$1'5(02%,/,=$7,21 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$SULO  5HPRELOL]DWLRQIRUVXVSHQVLRQRI:RUNDVUHTXLUHGE\&LW\ D0HDVXUHPHQWDQG3D\PHQW  7KLVVKDOOEHVXEPLWWHGDVD&RQWUDFW&ODLPLQDFFRUGDQFHZLWK$UWLFOH RI6HFWLRQ  1RSD\PHQWVZLOOEHPDGHIRUVWDQGE\LGOHWLPHRUORVWSURILWVDVVRFLDWHG ZLWKWKLV,WHP 0RELOL]DWLRQVDQG'HPRELOL]DWLRQVIRU0LVFHOODQHRXV3URMHFWV D0HDVXUHPHQW  0HDVXUHPHQWIRUWKLV,WHPVKDOOEHIRUHDFK0RELOL]DWLRQDQG 'HPRELOL]DWLRQUHTXLUHGE\WKH&RQWUDFW'RFXPHQWV E3D\PHQW  7KH:RUNSHUIRUPHGDQGPDWHULDOVIXUQLVKHGLQDFFRUGDQFHZLWKWKLV,WHP DQGPHDVXUHGDVSURYLGHGXQGHU³0HDVXUHPHQW´ZLOOEHSDLGIRUDWWKHXQLW SULFHSHUHDFK³:RUN2UGHU0RELOL]DWLRQ´LQDFFRUGDQFHZLWK&RQWUDFW 'RFXPHQWV'HPRELOL]DWLRQVKDOOEHFRQVLGHUHGVXEVLGLDU\WRPRELOL]DWLRQ DQGVKDOOQRWEHSDLGIRUVHSDUDWHO\ F7KHSULFHVKDOOLQFOXGH  0RELOL]DWLRQDVGHVFULEHGLQ6HFWLRQ$D   'HPRELOL]DWLRQDVGHVFULEHGLQ6HFWLRQ$D  G1RSD\PHQWVZLOOEHPDGHIRUVWDQGE\LGOHWLPHRUORVWSURILWVDVVRFLDWHGWKLV ,WHP (PHUJHQF\0RELOL]DWLRQVDQG'HPRELOL]DWLRQVIRU0LVFHOODQHRXV3URMHFWV D0HDVXUHPHQW  0HDVXUHPHQWIRUWKLV,WHPVKDOOEHIRUHDFK0RELOL]DWLRQDQG 'HPRELOL]DWLRQUHTXLUHGE\WKH&RQWUDFW'RFXPHQWV E3D\PHQW  7KH:RUNSHUIRUPHGDQGPDWHULDOVIXUQLVKHGLQDFFRUGDQFHZLWKWKLV,WHP DQGPHDVXUHGDVSURYLGHGXQGHU³0HDVXUHPHQW´ZLOOEHSDLGIRUDWWKHXQLW SULFHSHUHDFK³:RUN2UGHU(PHUJHQF\0RELOL]DWLRQ´LQDFFRUGDQFHZLWK &RQWUDFW'RFXPHQWV'HPRELOL]DWLRQVKDOOEHFRQVLGHUHGVXEVLGLDU\WR PRELOL]DWLRQDQGVKDOOQRWEHSDLGIRUVHSDUDWHO\ F7KHSULFHVKDOOLQFOXGH  0RELOL]DWLRQDVGHVFULEHGLQ6HFWLRQ$D   'HPRELOL]DWLRQDVGHVFULEHGLQ6HFWLRQ$D  G1RSD\PHQWVZLOOEHPDGHIRUVWDQGE\LGOHWLPHRUORVWSURILWVDVVRFLDWHGWKLV ,WHP 5()(5(1&(6>12786('@ $'0,1,675$7,9(5(48,5(0(176>12786('@ 68%0,77$/6>12786('@ ,1)250$7,21$/68%0,77$/6>12786('@ &/26(28768%0,77$/6>12786('@ 0$,17(1$1&(0$7(5,$/68%0,77$/6>12786('@ 48$/,7<$6685$1&(>12786('@ '(/,9(5<6725$*($1'+$1'/,1*>12786('@  '$302%,/,=$7,21$1'5(02%,/,=$7,21 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$SULO  ),(/'>6,7(@&21',7,216>12786('@ :$55$17<>12786('@ 3$57352'8&76>12786('@ 3$57(;(&87,21>12786('@ (1'2)6(&7,21  5HYLVLRQ/RJ '$7( 1$0( 6800$5<2)&+$1*(  0'RPHQHFK 5HYLVHGIRU'$3DSSOLFDWLRQ       &216758&7,2167$.,1*$1'6859(< 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG)HEUXDU\ 6(&7,21 &216758&7,2167$.,1*$1'6859(< 3$57*(1(5$/ 6800$5< $6HFWLRQ,QFOXGHV 5HTXLUHPHQWVIRUFRQVWUXFWLRQVWDNLQJDQGFRQVWUXFWLRQVXUYH\ %'HYLDWLRQVIURPWKLV&LW\RI)RUW:RUWK6WDQGDUG6SHFLILFDWLRQ 6HH&KDQJHV +LJKOLJKWHGLQ<HOORZ  &5HODWHG6SHFLILFDWLRQ6HFWLRQVLQFOXGHEXWDUHQRWQHFHVVDULO\OLPLWHGWR 'LYLVLRQ±%LGGLQJ5HTXLUHPHQWV&RQWUDFW)RUPVDQG&RQGLWLRQVRIWKH&RQWUDFW 'LYLVLRQ±*HQHUDO5HTXLUHPHQWV 35,&($1'3$<0(17352&('85(6 $0HDVXUHPHQWDQG3D\PHQW &RQVWUXFWLRQ6WDNLQJ D0HDVXUHPHQW  7KLV,WHPLVFRQVLGHUHGVXEVLGLDU\WRWKHYDULRXV,WHPVELG E3D\PHQW  7KHZRUNSHUIRUPHGDQGWKHPDWHULDOVIXUQLVKHGLQDFFRUGDQFHZLWKWKLV ,WHPDUHVXEVLGLDU\WRWKHYDULRXV,WHPVELGDQGQRRWKHUFRPSHQVDWLRQZLOO EHDOORZHG &RQVWUXFWLRQ6XUYH\ D0HDVXUHPHQW  7KLV,WHPLVFRQVLGHUHGVXEVLGLDU\WRWKHYDULRXV,WHPVELG E3D\PHQW  7KHZRUNSHUIRUPHGDQGWKHPDWHULDOVIXUQLVKHGLQDFFRUGDQFHZLWKWKLV ,WHPDUHVXEVLGLDU\WRWKHYDULRXV,WHPVELGDQGQRRWKHUFRPSHQVDWLRQZLOOEH DOORZHG $V%XLOW6XUYH\ D0HDVXUHPHQW  7KLV,WHPLVFRQVLGHUHGVXEVLGLDU\WRWKHYDULRXV,WHPVELG E3D\PHQW  7KHZRUNSHUIRUPHGDQGWKHPDWHULDOVIXUQLVKHGLQDFFRUGDQFHZLWKWKLV ,WHPDUHVXEVLGLDU\WRWKHYDULRXV,WHPVELGDQGQRRWKHUFRPSHQVDWLRQZLOOEH DOORZHG        &216758&7,2167$.,1*$1'6859(< 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG)HEUXDU\ 5()(5(1&(6 $'HILQLWLRQV &RQVWUXFWLRQ6XUYH\7KHVXUYH\PHDVXUHPHQWVPDGHSULRUWRRUZKLOH FRQVWUXFWLRQLVLQSURJUHVVWRFRQWUROHOHYDWLRQKRUL]RQWDOSRVLWLRQGLPHQVLRQVDQG FRQILJXUDWLRQRIVWUXFWXUHVLPSURYHPHQWVLQFOXGHGLQWKH3URMHFW'UDZLQJV $VEXLOW6XUYH\±7KHPHDVXUHPHQWVPDGHDIWHUWKHFRQVWUXFWLRQRIWKH LPSURYHPHQWIHDWXUHVDUHFRPSOHWHWRSURYLGHSRVLWLRQFRRUGLQDWHVIRUWKHIHDWXUHV RIDSURMHFW &RQVWUXFWLRQ6WDNLQJ±7KHSODFHPHQWRIVWDNHVDQGPDUNLQJVWRSURYLGHRIIVHWV DQGHOHYDWLRQVWRFXWDQGILOOLQRUGHUWRORFDWHRQWKHJURXQGWKHGHVLJQHG VWUXFWXUHVLPSURYHPHQWVLQFOXGHGLQWKH3URMHFW'UDZLQJV&RQVWUXFWLRQVWDNLQJ VKDOOLQFOXGHVWDNLQJHDVHPHQWVDQGRUULJKWRIZD\LILQGLFDWHGRQWKHSODQV 6XUYH\³)LHOG&KHFNV´±0HDVXUHPHQWVPDGHDIWHUFRQVWUXFWLRQVWDNLQJLV FRPSOHWHGDQGEHIRUHFRQVWUXFWLRQZRUNEHJLQVWRHQVXUHWKDWVWUXFWXUHVPDUNHGRQ WKHJURXQGDUHDFFXUDWHO\ORFDWHGSHU3URMHFW'UDZLQJV %7HFKQLFDO5HIHUHQFHV &LW\RI)RUW:RUWK±&RQVWUXFWLRQ6WDNLQJ6WDQGDUGV DYDLODEOHRQ&LW\¶V%X]]VDZ ZHEVLWH ±B$WWDFKPHQW$B6XUYH\6WDNLQJ6WDQGDUGV &LW\RI)RUW:RUWK6WDQGDUG6XUYH\'DWD&ROOHFWRU/LEUDU\ I[O ILOHV DYDLODEOH RQ&LW\¶V%X]]VDZZHEVLWH  7H[DV'HSDUWPHQWRI7UDQVSRUWDWLRQ 7['27 6XUYH\0DQXDOODWHVWUHYLVLRQ 7H[DV6RFLHW\RI3URIHVVLRQDO/DQG6XUYH\RUV 7636 0DQXDORI3UDFWLFHIRU/DQG 6XUYH\LQJLQWKH6WDWHRI7H[DV&DWHJRU\  $'0,1,675$7,9(5(48,5(0(176 $7KH&RQWUDFWRU¶VVHOHFWLRQRIDVXUYH\RUPXVWFRPSO\ZLWK7H[DV*RYHUQPHQW &RGH TXDOLILFDWLRQVEDVHGVHOHFWLRQ IRUWKLVSURMHFW 68%0,77$/6 $6XEPLWWDOVLIUHTXLUHGVKDOOEHLQDFFRUGDQFHZLWK6HFWLRQ %$OOVXEPLWWDOVVKDOOEHUHFHLYHGDQGUHYLHZHGE\WKH&LW\SULRUWRGHOLYHU\RIZRUN $&7,2168%0,77$/6,1)250$7,21$/68%0,77$/6 $)LHOG4XDOLW\&RQWURO6XEPLWWDOV 'RFXPHQWDWLRQYHULI\LQJDFFXUDF\RIILHOGHQJLQHHULQJZRUNLQFOXGLQJFRRUGLQDWH FRQYHUVLRQVLISODQVGRQRWLQGLFDWHJULGRUJURXQGFRRUGLQDWHV 6XEPLW³&XW6KHHWV´FRQIRUPLQJWRWKHVWDQGDUGWHPSODWHSURYLGHGE\WKH&LW\ UHIHUWR±$WWDFKPHQW$±6XUYH\6WDNLQJ6WDQGDUGV   &/26(28768%0,77$/6 %$VEXLOW5HGOLQH'UDZLQJ6XEPLWWDO  &216758&7,2167$.,1*$1'6859(< 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG)HEUXDU\ 6XEPLW$V%XLOW6XUYH\5HGOLQH'UDZLQJVGRFXPHQWLQJWKHORFDWLRQVHOHYDWLRQVRI FRQVWUXFWHGLPSURYHPHQWVVLJQHGDQGVHDOHGE\5HJLVWHUHG3URIHVVLRQDO/DQG 6XUYH\RU 53/6 UHVSRQVLEOHIRUWKHZRUN UHIHUWR±$WWDFKPHQW$ ±6XUYH\6WDNLQJ6WDQGDUGV  &RQWUDFWRUVKDOOVXEPLWWKHSURSRVHGDVEXLOWDQGFRPSOHWHGUHGOLQHGUDZLQJ VXEPLWWDORQH  ZHHNSULRUWRVFKHGXOLQJWKHSURMHFWILQDOLQVSHFWLRQIRU&LW\ UHYLHZDQGFRPPHQW5HYLVLRQVLIQHFHVVDU\VKDOOEHPDGHWRWKHDVEXLOWUHGOLQH GUDZLQJVDQGUHVXEPLWWHGWRWKH&LW\SULRUWRVFKHGXOLQJWKHFRQVWUXFWLRQILQDO LQVSHFWLRQ 0$,17(1$1&(0$7(5,$/68%0,77$/6>12786('@ 48$/,7<$6685$1&( $&RQVWUXFWLRQ6WDNLQJ &RQVWUXFWLRQVWDNLQJZLOOEHSHUIRUPHGE\WKH&RQWUDFWRU &RRUGLQDWLRQ D&RQWDFW&LW\DQG'HYHORSHU¶V3URMHFW5HSUHVHQWDWLYHDWOHDVWRQHZHHNLQ DGYDQFHQRWLI\LQJWKH&LW\RIZKHQ&RQVWUXFWLRQ6WDNLQJLVVFKHGXOHG E,WLVWKH&RQWUDFWRU¶VUHVSRQVLELOLW\WRFRRUGLQDWHVWDNLQJVXFKWKDW FRQVWUXFWLRQDFWLYLWLHVDUHQRWGHOD\HGRUQHJDWLYHO\LPSDFWHG *HQHUDO D&RQWUDFWRULVUHVSRQVLEOHIRUSUHVHUYLQJDQGPDLQWDLQLQJVWDNHV,I&LW\ VXUYH\RUVRU'HYHORSHU¶V3URMHFW5HSUHVHQWDWLYHDUHUHTXLUHGWRUHVWDNHIRU DQ\UHDVRQWKH&RQWUDFWRUZLOOEHUHVSRQVLEOHIRUFRVWVWRSHUIRUPVWDNLQJ,I LQWKHRSLQLRQRIWKH&LW\DVXIILFLHQWQXPEHURIVWDNHVRUPDUNLQJVKDYHEHHQ ORVWGHVWUR\HGGLVWXUEHGRURPLWWHGWKDWWKHFRQWUDFWHG:RUNFDQQRWWDNHSODFH WKHQWKH&RQWUDFWRUZLOOEHUHTXLUHGWRVWDNHRUUHVWDNHWKHGHILFLHQWDUHDV %&RQVWUXFWLRQ6XUYH\ &RQVWUXFWLRQ6XUYH\ZLOOEHSHUIRUPHGE\WKH&RQWUDFWRU &RRUGLQDWLRQ D&RQWUDFWRUWRYHULI\WKDWKRUL]RQWDODQGYHUWLFDOFRQWUROGDWDHVWDEOLVKHGLQWKH GHVLJQVXUYH\DQGUHTXLUHGIRUFRQVWUXFWLRQVXUYH\LVDYDLODEOHDQGLQSODFH *HQHUDO D&RQVWUXFWLRQVXUYH\ZLOOEHSHUIRUPHGLQRUGHUWRFRQVWUXFWWKHZRUNVKRZQ RQWKH&RQVWUXFWLRQ'UDZLQJVDQGVSHFLILHGLQWKH&RQWUDFW'RFXPHQWV E)RUFRQVWUXFWLRQPHWKRGVRWKHUWKDQRSHQFXWWKH&RQWUDFWRUVKDOOSHUIRUP FRQVWUXFWLRQVXUYH\DQGYHULI\FRQWUROGDWDLQFOXGLQJEXWQRWOLPLWHGWRWKH IROORZLQJ  9HULILFDWLRQWKDWHVWDEOLVKHGEHQFKPDUNVDQGFRQWURODUHDFFXUDWH  8VHRI%HQFKPDUNVWRIXUQLVKDQGPDLQWDLQDOOUHIHUHQFHOLQHVDQGJUDGHV IRUWXQQHOLQJ  8VHRIOLQHDQGJUDGHVWRHVWDEOLVKWKHORFDWLRQRIWKHSLSH  6XEPLWWRWKH&LW\FRSLHVRIILHOGQRWHVXVHGWRHVWDEOLVKDOOOLQHVDQG JUDGHVLIUHTXHVWHGDQGDOORZWKH&LW\WRFKHFNJXLGDQFHV\VWHPVHWXSSULRU WREHJLQQLQJHDFKWXQQHOLQJGULYH  3URYLGHDFFHVVIRUWKH&LW\LIUHTXHVWHGWRYHULI\WKHJXLGDQFHV\VWHPDQG WKHOLQHDQGJUDGHRIWKHFDUULHUSLSH  &216758&7,2167$.,1*$1'6859(< 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG)HEUXDU\  7KH&RQWUDFWRUUHPDLQVIXOO\UHVSRQVLEOHIRUWKHDFFXUDF\RIWKHZRUNDQG FRUUHFWLRQRILWDVUHTXLUHG  0RQLWRUOLQHDQGJUDGHFRQWLQXRXVO\GXULQJFRQVWUXFWLRQ  5HFRUGGHYLDWLRQZLWKUHVSHFWWRGHVLJQOLQHDQGJUDGHRQFHDWHDFKSLSH MRLQWDQGVXEPLWGDLO\UHFRUGVWRWKH&LW\  ,IWKHLQVWDOODWLRQGRHVQRWPHHWWKHVSHFLILHGWROHUDQFHV DVRXWOLQHGLQ 6HFWLRQVDQGRU LPPHGLDWHO\QRWLI\WKH&LW\DQGFRUUHFW WKHLQVWDOODWLRQLQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWV &$V%XLOW6XUYH\ 5HTXLUHG$V%XLOW6XUYH\ZLOOEHSHUIRUPHGE\WKH&RQWUDFWRU &RRUGLQDWLRQ D&RQWUDFWRULVWRFRRUGLQDWHZLWK&LW\WRFRQILUPZKLFKIHDWXUHVUHTXLUHDV EXLOWVXUYH\LQJ E,WLVWKH&RQWUDFWRU¶VUHVSRQVLELOLW\WRFRRUGLQDWHWKHDVEXLOWVXUYH\DQG UHTXLUHGPHDVXUHPHQWVIRULWHPVWKDWDUHWREHEXULHGVXFKWKDWFRQVWUXFWLRQ DFWLYLWLHVDUHQRWGHOD\HGRUQHJDWLYHO\LPSDFWHG F)RUVHZHUPDLQVDQGZDWHUPDLQV´DQGXQGHULQGLDPHWHULWLVDFFHSWDEOH WRSK\VLFDOO\PHDVXUHGHSWKDQGPDUNWKHORFDWLRQGXULQJWKHSURJUHVVRI FRQVWUXFWLRQDQGWDNHDVEXLOWVXUYH\DIWHUWKHIDFLOLW\KDVEHHQEXULHG7KH &RQWUDFWRULVUHVSRQVLEOHIRUWKHTXDOLW\FRQWUROQHHGHGWRHQVXUHDFFXUDF\ *HQHUDO D7KH&RQWUDFWRUVKDOOSURYLGHDVEXLOWVXUYH\LQFOXGLQJWKHHOHYDWLRQDQG ORFDWLRQ DQGSURYLGHZULWWHQGRFXPHQWDWLRQWRWKH&LW\ RIFRQVWUXFWLRQ IHDWXUHVGXULQJWKHSURJUHVVRIWKHFRQVWUXFWLRQLQFOXGLQJWKHIROORZLQJ  :DWHU/LQHV D 7RSRISLSHHOHYDWLRQVDQGFRRUGLQDWHVIRUZDWHUOLQHVDWWKHIROORZLQJ ORFDWLRQV  0LQLPXPHYHU\OLQHDUIHHWLQFOXGLQJ  +RUL]RQWDODQGYHUWLFDOSRLQWVRILQIOHFWLRQFXUYDWXUH HWF  )LUHOLQHWHH  3OXJVVWXERXWVGHDGHQGOLQHV  &DVLQJSLSH HDFKHQG DQGDOOEXULHGILWWLQJV  6DQLWDU\6HZHU D 7RSRISLSHHOHYDWLRQVDQGFRRUGLQDWHVIRUIRUFHPDLQVDQGVLSKRQ VDQLWDU\VHZHUOLQHV QRQJUDYLW\IDFLOLWLHV DWWKHIROORZLQJORFDWLRQV  0LQLPXPHYHU\OLQHDUIHHWDQGDQ\EXULHGILWWLQJV  +RUL]RQWDODQGYHUWLFDOSRLQWVRILQIOHFWLRQFXUYDWXUH HWF  6WRUPZDWHU±1RW$SSOLFDEOH E7KH&RQWUDFWRUVKDOOSURYLGHDVEXLOWVXUYH\LQFOXGLQJWKHHOHYDWLRQDQG ORFDWLRQ DQGSURYLGHZULWWHQGRFXPHQWDWLRQWRWKH&LW\ RIFRQVWUXFWLRQ IHDWXUHVDIWHUWKHFRQVWUXFWLRQLVFRPSOHWHGLQFOXGLQJWKHIROORZLQJ  0DQKROHV D 5LPDQGIORZOLQHHOHYDWLRQVDQGFRRUGLQDWHVIRUHDFKPDQKROH  :DWHU/LQHV D &DWKRGLFSURWHFWLRQWHVWVWDWLRQV E 6DPSOLQJVWDWLRQV F 0HWHUER[HVYDXOWV $OOVL]HV   &216758&7,2167$.,1*$1'6859(< 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG)HEUXDU\ G )LUHK\GUDQWV H 9DOYHV JDWHEXWWHUIO\HWF  I $LU5HOHDVHYDOYHV 0DQKROHULPDQGYHQWSLSH  J %ORZRIIYDOYHV 0DQKROHULPDQGYDOYHOLG  K 3UHVVXUHSODQHYDOYHV L 8QGHUJURXQG9DXOWV  5LPDQGIORZOLQHHOHYDWLRQVDQGFRRUGLQDWHVIRUHDFK 8QGHUJURXQG9DXOW  6DQLWDU\6HZHU D &OHDQRXWV  5LPDQGIORZOLQHHOHYDWLRQVDQGFRRUGLQDWHVIRUHDFK E 0DQKROHVDQG-XQFWLRQ6WUXFWXUHV  5LPDQGIORZOLQHHOHYDWLRQVDQGFRRUGLQDWHVIRUHDFK PDQKROHDQGMXQFWLRQVWUXFWXUH  6WRUPZDWHU±1RW$SSOLFDEOH '(/,9(5<6725$*($1'+$1'/,1*>12786('@ ),(/'>6,7(@&21',7,216>12786('@ :$55$17< 3$57352'8&76 $$FRQVWUXFWLRQVXUYH\ZLOOSURGXFHEXWZLOOQRWEHOLPLWHGWR 5HFRYHU\RIUHOHYDQWFRQWUROSRLQWVSRLQWVRIFXUYDWXUHDQGSRLQWVRILQWHUVHFWLRQ (VWDEOLVKWHPSRUDU\KRUL]RQWDODQGYHUWLFDOFRQWUROHOHYDWLRQV EHQFKPDUNV  VXIILFLHQWO\SHUPDQHQWDQGORFDWHGLQDPDQQHUWREHXVHGWKURXJKRXWFRQVWUXFWLRQ 7KHORFDWLRQRISODQQHGIDFLOLWLHVHDVHPHQWVDQGLPSURYHPHQWV D(VWDEOLVKLQJILQDOOLQHDQGJUDGHVWDNHVIRUSLHUVIORRUVJUDGHEHDPVSDUNLQJ DUHDVXWLOLWLHVVWUHHWVKLJKZD\VWXQQHOVDQGRWKHUFRQVWUXFWLRQ E$UHFRUGRIUHYLVLRQVRUFRUUHFWLRQVQRWHGLQDQRUGHUO\PDQQHUIRUUHIHUHQFH F$GUDZLQJZKHQUHTXLUHGE\WKHFOLHQWLQGLFDWLQJWKHKRUL]RQWDODQGYHUWLFDO ORFDWLRQRIIDFLOLWLHVHDVHPHQWVDQGLPSURYHPHQWVDVEXLOW &XWVKHHWVVKDOOEHSURYLGHGWRWKH&LW\LQVSHFWRUDQG6XUYH\6XSHULQWHQGHQWIRUDOO FRQVWUXFWLRQVWDNLQJSURMHFWV7KHVHFXWVKHHWVVKDOOEHRQWKHVWDQGDUGFLW\WHPSODWH ZKLFKFDQEHREWDLQHGIURPWKH6XUYH\6XSHULQWHQGHQW   'LJLWDOVXUYH\ILOHVLQWKHIROORZLQJIRUPDWVVKDOOEHDFFHSWDEOH D$XWR&$' GZJ  E(65,6KDSHILOH VKS  F&69ILOH FVY IRUPDWWHGZLWK;DQG<FRRUGLQDWHVLQVHSDUDWHFROXPQV XVH VWDQGDUGWHPSODWHVLIDYDLODEOH  6XUYH\ILOHVVKDOOLQFOXGHYHUWLFDODQGKRUL]RQWDOGDWDWLHGWRRULJLQDOSURMHFW FRQWURODQGEHQFKPDUNVDQGVKDOOLQFOXGHIHDWXUHGHVFULSWLRQV 3$57(;(&87,21 ,167$//(56  &216758&7,2167$.,1*$1'6859(< 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG)HEUXDU\ $7ROHUDQFHV  7KHVWDNHGORFDWLRQRIDQ\LPSURYHPHQWRUIDFLOLW\VKRXOGEHDVDFFXUDWHDV SUDFWLFDODQGQHFHVVDU\7KHGHJUHHRISUHFLVLRQUHTXLUHGLVGHSHQGHQWRQPDQ\ IDFWRUVDOORIZKLFKPXVWUHPDLQMXGJPHQWDO7KHWROHUDQFHVOLVWHGKHUHDIWHUDUH EDVHGRQJHQHUDOLWLHVDQGXQGHUFHUWDLQFLUFXPVWDQFHVVKDOO\LHOGWRVSHFLILF UHTXLUHPHQWV7KHVXUYH\RUVKDOODVVHVVDQ\VLWXDWLRQE\UHYLHZRIWKHRYHUDOOSODQV DQGWKURXJKFRQVXOWDWLRQZLWKUHVSRQVLEOHSDUWLHVDVWRWKHQHHGIRUVSHFLILF WROHUDQFHV D(DUWKZRUN*UDGHVIRUHDUWKZRUNRUURXJKFXWVKRXOGQRWH[FHHGIWYHUWLFDO WROHUDQFH+RUL]RQWDODOLJQPHQWIRUHDUWKZRUNDQGURXJKFXWVKRXOGQRWH[FHHG IWWROHUDQFH E+RUL]RQWDODOLJQPHQWRQDVWUXFWXUHVKDOOEHZLWKLQIWWROHUDQFH F3DYLQJRUFRQFUHWHIRUVWUHHWVFXUEVJXWWHUVSDUNLQJDUHDVGULYHVDOOH\VDQG ZDONZD\VVKDOOEHORFDWHGZLWKLQWKHFRQILQHVRIWKHVLWHERXQGDULHVDQG RFFDVLRQDOO\DORQJDERXQGDU\RUDQ\RWKHUUHVWULFWLYHOLQH$ZD\IURPDQ\ UHVWULFWLYHOLQHWKHVHIDFLOLWLHVVKRXOGEHVWDNHGZLWKDQDFFXUDF\SURGXFLQJQR PRUHWKDQIWWROHUDQFHIURPWKHLUVSHFLILHGORFDWLRQV G8QGHUJURXQGDQGRYHUKHDGXWLOLWLHVVXFKDVVHZHUVJDVZDWHUWHOHSKRQHDQG HOHFWULFOLQHVVKDOOEHORFDWHGKRUL]RQWDOO\ZLWKLQWKHLUSUHVFULEHGDUHDVRU HDVHPHQWV:LWKLQDVVLJQHGDUHDVWKHVHXWLOLWLHVVKRXOGEHVWDNHGZLWKDQ DFFXUDF\SURGXFLQJQRPRUHWKDQIWWROHUDQFHIURPDVSHFLILHGORFDWLRQ H7KHDFFXUDF\UHTXLUHGIRUWKHYHUWLFDOORFDWLRQRIXWLOLWLHVYDULHVZLGHO\0DQ\ XQGHUJURXQGXWLOLWLHVUHTXLUHRQO\DPLQLPXPFRYHUDQGDWROHUDQFHRIIW VKRXOGEHPDLQWDLQHG8QGHUJURXQGDQGRYHUKHDGXWLOLWLHVRQSODQQHGSURILOH EXWQRWGHSHQGLQJRQJUDYLW\IORZIRUSHUIRUPDQFHVKRXOGQRWH[FHHGIW WROHUDQFH %6XUYH\LQJLQVWUXPHQWVVKDOOEHNHSWLQFORVHDGMXVWPHQWDFFRUGLQJWRPDQXIDFWXUHU¶V VSHFLILFDWLRQVRULQFRPSOLDQFHWRVWDQGDUGV7KH&LW\UHVHUYHVWKHULJKWWRUHTXHVWD FDOLEUDWLRQUHSRUWDWDQ\WLPHDQGUHFRPPHQGVUHJXODUPDLQWHQDQFHVFKHGXOHEH SHUIRUPHGE\DFHUWLILHGWHFKQLFLDQHYHU\PRQWKV )LHOGPHDVXUHPHQWVRIDQJOHVDQGGLVWDQFHVVKDOOEHGRQHLQVXFKIDVKLRQDVWR VDWLVI\WKHFORVXUHVDQGWROHUDQFHVH[SUHVVHGLQ3DUW$ 9HUWLFDOORFDWLRQVVKDOOEHHVWDEOLVKHGIURPDSUHHVWDEOLVKHGEHQFKPDUNDQG FKHFNHGE\FORVLQJWRDGLIIHUHQWEHQFKPDUNRQWKHVDPHGDWXP &RQVWUXFWLRQVXUYH\ILHOGZRUNVKDOOFRUUHVSRQGWRWKHFOLHQW¶VSODQV,UUHJXODULWLHV RUFRQIOLFWVIRXQGVKDOOEHUHSRUWHGSURPSWO\WRWKH&LW\ 5HYLVLRQVFRUUHFWLRQVDQGRWKHUSHUWLQHQWGDWDVKDOOEHORJJHGIRUIXWXUHUHIHUHQFH  (;$0,1$7,21>12786('@ 35(3$5$7,21>12786('@ $33/,&$7,21 5(3$,55(6725$7,21 $,IWKH&RQWUDFWRU¶VZRUNGDPDJHVRUGHVWUR\VRQHRUPRUHRIWKHFRQWURO PRQXPHQWVSRLQWVVHWE\WKH&LW\RU'HYHORSHU¶V3URMHFW5HSUHVHQWDWLYHWKHPRQXPHQWV VKDOOEHDGHTXDWHO\UHIHUHQFHGIRUH[SHGLHQWUHVWRUDWLRQ  &216758&7,2167$.,1*$1'6859(< 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG)HEUXDU\ 1RWLI\&LW\RU'HYHORSHU¶V3URMHFW5HSUHVHQWDWLYHLIDQ\FRQWUROGDWDQHHGVWREH UHVWRUHGRUUHSODFHGGXHWRGDPDJHFDXVHGGXULQJFRQVWUXFWLRQRSHUDWLRQV D&RQWUDFWRUVKDOOSHUIRUPUHSODFHPHQWVDQGRUUHVWRUDWLRQV E7KH&LW\RU'HYHORSHU¶V3URMHFW5HSUHVHQWDWLYHPD\UHTXLUHDWDQ\WLPHD VXUYH\³)LHOG&KHFN´RIDQ\PRQXPHQWRUEHQFKPDUNVWKDWDUHVHWEHYHULILHG E\WKH&LW\VXUYH\RUVRU'HYHORSHU¶V3URMHFW5HSUHVHQWDWLYHEHIRUHIXUWKHU DVVRFLDWHGZRUNFDQPRYHIRUZDUG 5(,167$//$7,21>12786('@ ),(/'>25@6,7(48$/,7<&21752/ $,WLVWKH&RQWUDFWRU¶VUHVSRQVLELOLW\WRPDLQWDLQDOOVWDNHVDQGFRQWUROGDWDSODFHGE\WKH &LW\RU'HYHORSHU¶V3URMHFW5HSUHVHQWDWLYHLQDFFRUGDQFHZLWKWKLV6SHFLILFDWLRQ7KLV LQFOXGHVHDVHPHQWVDQGULJKWRIZD\LIQRWHGRQWKHSODQV %'RQRWFKDQJHRUUHORFDWHVWDNHVRUFRQWUROGDWDZLWKRXWDSSURYDOIURPWKH&LW\ 6<67(067$5783 $6XUYH\&KHFNV 7KH&LW\UHVHUYHVWKHULJKWWRSHUIRUPD6XUYH\&KHFNDWDQ\WLPHGHHPHG QHFHVVDU\ &KHFNVE\&LW\SHUVRQQHORUUGSDUW\FRQWUDFWHGVXUYH\RUDUHQRWLQWHQGHGWR UHOLHYHWKHFRQWUDFWRURIKLVKHUUHVSRQVLELOLW\IRUDFFXUDF\  $'-867,1*>12786('@ &/($1,1*>12786('@ &/26(287$&7,9,7,(6>12786('@ 3527(&7,21>12786('@ 0$,17(1$1&(>12786('@ $77$&+0(176>12786('@ (1'2)6(&7,21  5HYLVLRQ/RJ '$7( 1$0( 6800$5<2)&+$1*(  '-RKQVRQ   02ZHQ $GGHGLQVWUXFWLRQDQGPRGLILHGPHDVXUHPHQW SD\PHQWXQGHUDGGHG GHILQLWLRQVDQGUHIHUHQFHVXQGHUPRGLILHGDGGHGFORVHRXWVXEPLWWDO UHTXLUHPHQWVPRGLILHG4XDOLW\$VVXUDQFHDGGHG3$57±352'8&76 $GGHG,QVWDOOHUVDGGHG5HSDLU5HVWRUDWLRQDQGDGGHG6\VWHP6WDUWXS 02ZHQ 5HPRYHG³EOXHWH[W´UHYLVHGPHDVXUHPHQWDQGSD\PHQWVHFWLRQVIRU&RQVWUXFWLRQ 6WDNLQJDQG$V%XLOW6XUYH\DGGHGUHIHUHQFHWRVHOHFWLRQFRPSOLDQFHZLWK7*& UHYLVHGDFWLRQDQG&ORVHRXWVXEPLWWDOUHTXLUHPHQWVDGGHGDFFHSWDEOHGHSWK  &216758&7,2167$.,1*$1'6859(< 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG)HEUXDU\ PHDVXUHPHQWFULWHULDUHYLVHGOLVWRILWHPVUHTXLULQJDVEXLOWVXUYH\³GXULQJ´DQG ³DIWHU´FRQVWUXFWLRQDQGUHYLVHGDFFHSWDEOHGLJLWDOVXUYH\ILOHIRUPDW   '$3&/($1,1* 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$SULO  6(&7,21 &/($1,1* 3$57*(1(5$/ 6800$5< $6HFWLRQ,QFOXGHV ,QWHUPHGLDWHDQGILQDOFOHDQLQJIRU:RUNQRWLQFOXGLQJVSHFLDOFOHDQLQJRIFORVHG V\VWHPVVSHFLILHGHOVHZKHUH %'HYLDWLRQVIURPWKLV&LW\RI)RUW:RUWK6WDQGDUG6SHFLILFDWLRQ 1RQH &5HODWHG6SHFLILFDWLRQ6HFWLRQVLQFOXGHEXWDUHQRWQHFHVVDULO\OLPLWHGWR 'LYLVLRQ±%LGGLQJ5HTXLUHPHQWV&RQWUDFW)RUPVDQG&RQGLWLRQVRIWKH&RQWUDFW 'LYLVLRQ±*HQHUDO5HTXLUHPHQWV 6HFWLRQ±+\GUR0XOFKLQJ6HHGLQJDQG6RGGLQJ 35,&($1'3$<0(17352&('85(6 $0HDVXUHPHQWDQG3D\PHQW :RUNDVVRFLDWHGZLWKWKLV,WHPLVFRQVLGHUHGVXEVLGLDU\WRWKHYDULRXV,WHPVELG 1RVHSDUDWHSD\PHQWZLOOEHDOORZHGIRUWKLV,WHP 5()(5(1&(6>12786('@ $'0,1,675$7,9(5(48,5(0(176 $6FKHGXOLQJ 6FKHGXOHFOHDQLQJRSHUDWLRQVVRWKDWGXVWDQGRWKHUFRQWDPLQDQWVGLVWXUEHGE\ FOHDQLQJSURFHVVZLOOQRWIDOORQQHZO\SDLQWHGVXUIDFHV 6FKHGXOHILQDOFOHDQLQJXSRQFRPSOHWLRQRI:RUNDQGLPPHGLDWHO\SULRUWRILQDO LQVSHFWLRQ 68%0,77$/6>12786('@ $&7,2168%0,77$/6,1)250$7,21$/68%0,77$/6>12786('@ &/26(28768%0,77$/6>12786('@ 0$,17(1$1&(0$7(5,$/68%0,77$/6>12786('@ 48$/,7<$6685$1&(>12786('@ 6725$*($1'+$1'/,1* $6WRUDJHDQG+DQGOLQJ5HTXLUHPHQWV 6WRUHFOHDQLQJSURGXFWVDQGFOHDQLQJZDVWHVLQFRQWDLQHUVVSHFLILFDOO\GHVLJQHGIRU WKRVHPDWHULDOV  '$3&/($1,1* 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$SULO  ),(/'>6,7(@&21',7,216>12786('@ :$55$17<>12786('@ 3$57352'8&76 2:1(5)851,6+('>25@2:1(56833/,('352'8&76>12786('@ 0$7(5,$/6 $&OHDQLQJ$JHQWV &RPSDWLEOHZLWKVXUIDFHEHLQJFOHDQHG 1HZDQGXQFRQWDPLQDWHG )RUPDQXIDFWXUHGVXUIDFHV D0DWHULDOUHFRPPHQGHGE\PDQXIDFWXUHU $&&(6625,(6>12786('@ 6285&(48$/,7<&21752/>12786('@ 3$57(;(&87,21 ,167$//(56>12786('@ (;$0,1$7,21>12786('@ 35(3$5$7,21>12786('@ $33/,&$7,21>12786('@ 5(3$,55(6725$7,21>12786('@ 5(,167$//$7,21>12786('@ ),(/'>25@6,7(48$/,7<&21752/>12786('@ 6<67(067$5783>12786('@ $'-867,1*>12786('@ &/($1,1* $*HQHUDO 3UHYHQWDFFXPXODWLRQRIZDVWHVWKDWFUHDWHKD]DUGRXVFRQGLWLRQV &RQGXFWFOHDQLQJDQGGLVSRVDORSHUDWLRQVWRFRPSO\ZLWKODZVDQGVDIHW\RUGHUVRI JRYHUQLQJDXWKRULWLHV 'RQRWGLVSRVHRIYRODWLOHZDVWHVVXFKDVPLQHUDOVSLULWVRLORUSDLQWWKLQQHULQ VWRUPRUVDQLWDU\GUDLQVRUVHZHUV 'LVSRVHRIGHJUDGDEOHGHEULVDWDQDSSURYHGVROLGZDVWHGLVSRVDOVLWH 'LVSRVHRIQRQGHJUDGDEOHGHEULVDWDQDSSURYHGVROLGZDVWHGLVSRVDOVLWHRULQDQ DOWHUQDWHPDQQHUDSSURYHGE\&LW\DQGUHJXODWRU\DJHQFLHV  '$3&/($1,1* 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$SULO  +DQGOHPDWHULDOVLQDFRQWUROOHGPDQQHUZLWKDVIHZKDQGOLQJVDVSRVVLEOH 7KRURXJKO\FOHDQVZHHSZDVKDQGSROLVKDOO:RUNDQGHTXLSPHQWDVVRFLDWHGZLWK WKLVSURMHFW 5HPRYHDOOVLJQVRIWHPSRUDU\FRQVWUXFWLRQDQGDFWLYLWLHVLQFLGHQWDOWRFRQVWUXFWLRQ RIUHTXLUHGSHUPDQHQW:RUN ,ISURMHFWLVQRWFOHDQHGWRWKHVDWLVIDFWLRQRIWKH&LW\WKH&LW\UHVHUYHVWKHULJKWWR KDYHWKHFOHDQLQJFRPSOHWHGDWWKHH[SHQVHRIWKH&RQWUDFWRU 'RQRWEXUQRQVLWH %,QWHUPHGLDWH&OHDQLQJGXULQJ&RQVWUXFWLRQ .HHS:RUNDUHDVFOHDQVRDVQRWWRKLQGHUKHDOWKVDIHW\RUFRQYHQLHQFHRI SHUVRQQHOLQH[LVWLQJIDFLOLW\RSHUDWLRQV $WPD[LPXPZHHNO\LQWHUYDOVGLVSRVHRIZDVWHPDWHULDOVGHEULVDQGUXEELVK &RQILQHFRQVWUXFWLRQGHEULVGDLO\LQVWUDWHJLFDOO\ORFDWHGFRQWDLQHU V  D&RYHUWRSUHYHQWEORZLQJE\ZLQG E6WRUHGHEULVDZD\IURPFRQVWUXFWLRQRURSHUDWLRQDODFWLYLWLHV F+DXOIURPVLWHDWDPLQLPXPRIRQFHSHUZHHN 9DFXXPFOHDQLQWHULRUDUHDVZKHQUHDG\WRUHFHLYHILQLVKSDLQWLQJ D&RQWLQXHYDFXXPFOHDQLQJRQDQDVQHHGHGEDVLVXQWLO)LQDO$FFHSWDQFH 3ULRUWRVWRUPHYHQWVWKRURXJKO\FOHDQVLWHRIDOOORRVHRUXQVHFXUHGLWHPVZKLFK PD\EHFRPHDLUERUQHRUWUDQVSRUWHGE\IORZLQJZDWHUGXULQJWKHVWRUP &([WHULRU 6LWHRU5LJKWRI:D\ )LQDO&OHDQLQJ 5HPRYHWUDVKDQGGHEULVFRQWDLQHUVIURPVLWH D5HVHHGDUHDVGLVWXUEHGE\ORFDWLRQRIWUDVKDQGGHEULVFRQWDLQHUVLQDFFRUGDQFH ZLWK6HFWLRQ 6ZHHSURDGZD\WRUHPRYHDOOURFNVSLHFHVRIDVSKDOWFRQFUHWHRUDQ\RWKHUREMHFW WKDWPD\KLQGHURUGLVUXSWWKHIORZRIWUDIILFDORQJWKHURDGZD\ &OHDQDQ\LQWHULRUDUHDVLQFOXGLQJEXWQRWOLPLWHGWRYDXOWVPDQKROHVVWUXFWXUHV MXQFWLRQER[HVDQGLQOHWV ,IQRORQJHUUHTXLUHGIRUPDLQWHQDQFHRIHURVLRQIDFLOLWLHVDQGXSRQDSSURYDOE\ &LW\UHPRYHHURVLRQFRQWUROIURPVLWH &OHDQVLJQVOLJKWVVLJQDOVHWF &/26(287$&7,9,7,(6>12786('@ 3527(&7,21>12786('@ 0$,17(1$1&(>12786('@ $77$&+0(176>12786('@       '$3&/($1,1* 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$SULO  (1'2)6(&7,21  5HYLVLRQ/RJ '$7( 1$0( 6800$5<2)&+$1*(  0'RPHQHFK 5HYLVHGIRU'$3DSSOLFDWLRQ       '$3&/26(2875(48,5(0(176 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$SULO   6(&7,21 &/26(2875(48,5(0(176 3$57*(1(5$/ 6800$5< $6HFWLRQ,QFOXGHV 7KHSURFHGXUHIRUFORVLQJRXWDFRQWUDFW %'HYLDWLRQVIURPWKLV&LW\RI)RUW:RUWK6WDQGDUG6SHFLILFDWLRQ 1RQH &5HODWHG6SHFLILFDWLRQ6HFWLRQVLQFOXGHEXWDUHQRWQHFHVVDULO\OLPLWHGWR 'LYLVLRQ±%LGGLQJ5HTXLUHPHQWV&RQWUDFW)RUPVDQG&RQGLWLRQVRIWKH&RQWUDFW 'LYLVLRQ±*HQHUDO5HTXLUHPHQWV 35,&($1'3$<0(17352&('85(6 $0HDVXUHPHQWDQG3D\PHQW :RUNDVVRFLDWHGZLWKWKLV,WHPLVFRQVLGHUHGVXEVLGLDU\WRWKHYDULRXV,WHPVELG 1RVHSDUDWHSD\PHQWZLOOEHDOORZHGIRUWKLV,WHP 5()(5(1&(6>12786('@ $'0,1,675$7,9(5(48,5(0(176 $*XDUDQWHHV%RQGVDQG$IILGDYLWV 1RDSSOLFDWLRQIRUILQDOSD\PHQWZLOOEHDFFHSWHGXQWLODOOJXDUDQWHHVERQGV FHUWLILFDWHVOLFHQVHVDQGDIILGDYLWVUHTXLUHGIRU:RUNRUHTXLSPHQWDVVSHFLILHGDUH VDWLVIDFWRULO\ILOHGZLWKWKH&LW\ %5HOHDVHRI/LHQVRU&ODLPV 1RDSSOLFDWLRQIRUILQDOSD\PHQWZLOOEHDFFHSWHGXQWLOVDWLVIDFWRU\HYLGHQFHRI UHOHDVHRIOLHQVKDVEHHQVXEPLWWHGWRWKH&LW\ 68%0,77$/6 $6XEPLWDOOUHTXLUHGGRFXPHQWDWLRQWR&LW\¶V3URMHFW5HSUHVHQWDWLYH  '$3&/26(2875(48,5(0(176 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$SULO   ,1)250$7,21$/68%0,77$/6>12786('@ &/26(28768%0,77$/6>12786('@ 3$57352'8&76>12786('@ 3$57(;(&87,21 ,167$//(56>12786('@ (;$0,1$7,21>12786('@ 35(3$5$7,21>12786('@ &/26(287352&('85( $3ULRUWRUHTXHVWLQJ)LQDO,QVSHFWLRQVXEPLW 3URMHFW5HFRUG'RFXPHQWVLQDFFRUGDQFHZLWK6HFWLRQ 2SHUDWLRQDQG0DLQWHQDQFH'DWDLIUHTXLUHGLQDFFRUGDQFHZLWK6HFWLRQ %3ULRUWRUHTXHVWLQJ)LQDO,QVSHFWLRQSHUIRUPILQDOFOHDQLQJLQDFFRUGDQFHZLWK6HFWLRQ  &)LQDO,QVSHFWLRQ $IWHUILQDOFOHDQLQJSURYLGHQRWLFHWRWKH&LW\3URMHFW5HSUHVHQWDWLYHWKDWWKH:RUN LVFRPSOHWHG D7KH&LW\ZLOOPDNHDQLQLWLDO)LQDO,QVSHFWLRQZLWKWKH&RQWUDFWRUSUHVHQW E8SRQFRPSOHWLRQRIWKLVLQVSHFWLRQWKH&LW\ZLOOQRWLI\WKH&RQWUDFWRULQ ZULWLQJZLWKLQEXVLQHVVGD\VRIDQ\SDUWLFXODUVLQZKLFKWKLVLQVSHFWLRQ UHYHDOVWKDWWKH:RUNLVGHIHFWLYHRULQFRPSOHWH 8SRQUHFHLYLQJZULWWHQQRWLFHIURPWKH&LW\LPPHGLDWHO\XQGHUWDNHWKH:RUN UHTXLUHGWRUHPHG\GHILFLHQFLHVDQGFRPSOHWHWKH:RUNWRWKHVDWLVIDFWLRQRIWKH &LW\ 8SRQFRPSOHWLRQRI:RUNDVVRFLDWHGZLWKWKHLWHPVOLVWHGLQWKH&LW\ VZULWWHQ QRWLFHLQIRUPWKH&LW\WKDWWKHUHTXLUHG:RUNKDVEHHQFRPSOHWHG8SRQUHFHLSW RIWKLVQRWLFHWKH&LW\LQWKHSUHVHQFHRIWKH&RQWUDFWRUZLOOPDNHDVXEVHTXHQW )LQDO,QVSHFWLRQRIWKHSURMHFW 3URYLGHDOOVSHFLDODFFHVVRULHVUHTXLUHGWRSODFHHDFKLWHPRIHTXLSPHQWLQIXOO RSHUDWLRQ7KHVHVSHFLDODFFHVVRU\LWHPVLQFOXGHEXWDUHQRWOLPLWHGWR D6SHFLILHGVSDUHSDUWV E$GHTXDWHRLODQGJUHDVHDVUHTXLUHGIRUWKHILUVWOXEULFDWLRQRIWKHHTXLSPHQW F,QLWLDOILOOXSRIDOOFKHPLFDOWDQNVDQGIXHOWDQNV G/LJKWEXOEV H)XVHV I9DXOWNH\V J+DQGZKHHOV K2WKHUH[SHQGDEOHLWHPVDVUHTXLUHGIRULQLWLDOVWDUWXSDQGRSHUDWLRQRIDOO HTXLSPHQW '1RWLFHRI3URMHFW&RPSOHWLRQ  '$3&/26(2875(48,5(0(176 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$SULO   2QFHWKH&LW\3URMHFW5HSUHVHQWDWLYHILQGVWKH:RUNVXEVHTXHQWWR)LQDO,QVSHFWLRQ WREHVDWLVIDFWRU\WKH&LW\ZLOOLVVXHD1RWLFHRI3URMHFW&RPSOHWLRQ *UHHQ6KHHW  (6XSSRUWLQJ'RFXPHQWDWLRQ &RRUGLQDWHZLWKWKH&LW\3URMHFW5HSUHVHQWDWLYHWRFRPSOHWHWKHIROORZLQJ DGGLWLRQDOIRUPV D)LQDO3D\PHQW5HTXHVW E6WDWHPHQWRI&RQWUDFW7LPH F$IILGDYLWRI3D\PHQWDQG5HOHDVHRI/LHQV G&RQVHQWRI6XUHW\WR)LQDO3D\PHQW H3LSH5HSRUW LIUHTXLUHG  I&RQWUDFWRU¶V(YDOXDWLRQRI&LW\ J3HUIRUPDQFH(YDOXDWLRQRI&RQWUDFWRU )/HWWHURI)LQDO$FFHSWDQFH 8SRQUHYLHZDQGDFFHSWDQFHRI1RWLFHRI3URMHFW&RPSOHWLRQDQG6XSSRUWLQJ 'RFXPHQWDWLRQLQDFFRUGDQFHZLWK*HQHUDO&RQGLWLRQV&LW\ZLOOLVVXH/HWWHURI )LQDO$FFHSWDQFHDQGUHOHDVHWKH)LQDO3D\PHQW5HTXHVWIRUSD\PHQW 5(3$,55(6725$7,21>12786('@ 5(,167$//$7,21>12786('@ ),(/'>25@6,7(48$/,7<&21752/>12786('@ 6<67(067$5783>12786('@ $'-867,1*>12786('@ &/($1,1*>12786('@ &/26(287$&7,9,7,(6>12786('@ 3527(&7,21>12786('@ 0$,17(1$1&(>12786('@ $77$&+0(176>12786('@ (1'2)6(&7,21  5HYLVLRQ/RJ '$7( 1$0( 6800$5<2)&+$1*(  0'RPHQHFK 5HYLVHGIRU'$3DSSOLFDWLRQ     '$323(5$7,21$1'0$,17(1$1&('$7$ 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$SULO   6(&7,21 23(5$7,21$1'0$,17(1$1&('$7$ 3$57*(1(5$/ 6800$5< $6HFWLRQ,QFOXGHV 3URGXFWGDWDDQGUHODWHGLQIRUPDWLRQDSSURSULDWHIRU&LW\ VPDLQWHQDQFHDQG RSHUDWLRQRISURGXFWVIXUQLVKHGXQGHU&RQWUDFW 6XFKSURGXFWVPD\LQFOXGHEXWDUHQRWOLPLWHGWR D7UDIILF&RQWUROOHUV E,UULJDWLRQ&RQWUROOHUV WREHRSHUDWHGE\WKH&LW\  F%XWWHUIO\9DOYHV %'HYLDWLRQVIURPWKLV&LW\RI)RUW:RUWK6WDQGDUG6SHFLILFDWLRQ 1RQH &5HODWHG6SHFLILFDWLRQ6HFWLRQVLQFOXGHEXWDUHQRWQHFHVVDULO\OLPLWHGWR 'LYLVLRQ±%LGGLQJ5HTXLUHPHQWV&RQWUDFW)RUPVDQG&RQGLWLRQVRIWKH&RQWUDFW 'LYLVLRQ±*HQHUDO5HTXLUHPHQWV 35,&($1'3$<0(17352&('85(6 $0HDVXUHPHQWDQG3D\PHQW :RUNDVVRFLDWHGZLWKWKLV,WHPLVFRQVLGHUHGVXEVLGLDU\WRWKHYDULRXV,WHPVELG 1RVHSDUDWHSD\PHQWZLOOEHDOORZHGIRUWKLV,WHP 5()(5(1&(6>12786('@ $'0,1,675$7,9(5(48,5(0(176 $6FKHGXOH 6XEPLWPDQXDOVLQILQDOIRUPWRWKH&LW\ZLWKLQFDOHQGDUGD\VRISURGXFW VKLSPHQWWRWKHSURMHFWVLWH 68%0,77$/6 $6XEPLWWDOVVKDOOEHLQDFFRUGDQFHZLWK6HFWLRQ$OOVXEPLWWDOVVKDOOEH DSSURYHGE\WKH&LW\SULRUWRGHOLYHU\ ,1)250$7,21$/68%0,77$/6 $6XEPLWWDO)RUP 3UHSDUHGDWDLQIRUPRIDQLQVWUXFWLRQDOPDQXDOIRUXVHE\&LW\SHUVRQQHO )RUPDW D6L]HòLQFKHV[LQFKHV E3DSHU  SRXQGPLQLPXPZKLWHIRUW\SHGSDJHV  +ROHVUHLQIRUFHGZLWKSODVWLFFORWKRUPHWDO F7H[W0DQXIDFWXUHU¶VSULQWHGGDWDRUQHDWO\W\SHZULWWHQ  '$323(5$7,21$1'0$,17(1$1&('$7$ 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$SULO   G'UDZLQJV  3URYLGHUHLQIRUFHGSXQFKHGELQGHUWDEELQGLQZLWKWH[W  5HGXFHODUJHUGUDZLQJVDQGIROGWRVL]HRIWH[WSDJHV H3URYLGHIO\OHDIIRUHDFKVHSDUDWHSURGXFWRUHDFKSLHFHRIRSHUDWLQJ HTXLSPHQW  3URYLGHW\SHGGHVFULSWLRQRISURGXFWDQGPDMRUFRPSRQHQWSDUWVRI HTXLSPHQW  3URYLGHLQGH[HGWDEV I&RYHU  ,GHQWLI\HDFKYROXPHZLWKW\SHGRUSULQWHGWLWOH23(5$7,1*$1' 0$,17(1$1&(,16758&7,216  /LVW D 7LWOHRI3URMHFW E ,GHQWLW\RIVHSDUDWHVWUXFWXUHDVDSSOLFDEOH F ,GHQWLW\RIJHQHUDOVXEMHFWPDWWHUFRYHUHGLQWKHPDQXDO %LQGHUV D&RPPHUFLDOTXDOLW\ULQJELQGHUVZLWKGXUDEOHDQGFOHDQDEOHSODVWLFFRYHUV E:KHQPXOWLSOHELQGHUVDUHXVHGFRUUHODWHWKHGDWDLQWRUHODWHGFRQVLVWHQW JURXSLQJV ,IDYDLODEOHSURYLGHDQHOHFWURQLFIRUPRIWKH2 00DQXDO %0DQXDO&RQWHQW 1HDWO\W\SHZULWWHQWDEOHRIFRQWHQWVIRUHDFKYROXPHDUUDQJHGLQV\VWHPDWLFRUGHU D&RQWUDFWRUQDPHRIUHVSRQVLEOHSULQFLSDODGGUHVVDQGWHOHSKRQHQXPEHU E$OLVWRIHDFKSURGXFWUHTXLUHGWREHLQFOXGHGLQGH[HGWRFRQWHQWRIWKHYROXPH F/LVWZLWKHDFKSURGXFW  7KHQDPHDGGUHVVDQGWHOHSKRQHQXPEHURIWKHVXEFRQWUDFWRURULQVWDOOHU  $OLVWRIHDFKSURGXFWUHTXLUHGWREHLQFOXGHGLQGH[HGWRFRQWHQWRIWKH YROXPH  ,GHQWLI\DUHDRIUHVSRQVLELOLW\RIHDFK  /RFDOVRXUFHRIVXSSO\IRUSDUWVDQGUHSODFHPHQW G,GHQWLI\HDFKSURGXFWE\SURGXFWQDPHDQGRWKHULGHQWLI\LQJV\PEROVDVVHW IRUWKLQ&RQWUDFW'RFXPHQWV 3URGXFW'DWD D,QFOXGHRQO\WKRVHVKHHWVZKLFKDUHSHUWLQHQWWRWKHVSHFLILFSURGXFW E$QQRWDWHHDFKVKHHWWR  &OHDUO\LGHQWLI\VSHFLILFSURGXFWRUSDUWLQVWDOOHG  &OHDUO\LGHQWLI\GDWDDSSOLFDEOHWRLQVWDOODWLRQ  'HOHWHUHIHUHQFHVWRLQDSSOLFDEOHLQIRUPDWLRQ 'UDZLQJV D6XSSOHPHQWSURGXFWGDWDZLWKGUDZLQJVDVQHFHVVDU\WRFOHDUO\LOOXVWUDWH  5HODWLRQVRIFRPSRQHQWSDUWVRIHTXLSPHQWDQGV\VWHPV  &RQWURODQGIORZGLDJUDPV E&RRUGLQDWHGUDZLQJVZLWKLQIRUPDWLRQLQ3URMHFW5HFRUG'RFXPHQWVWRDVVXUH FRUUHFWLOOXVWUDWLRQRIFRPSOHWHGLQVWDOODWLRQ F'RQRWXVH3URMHFW5HFRUG'UDZLQJVDVPDLQWHQDQFHGUDZLQJV :ULWWHQWH[WDVUHTXLUHGWRVXSSOHPHQWSURGXFWGDWDIRUWKHSDUWLFXODULQVWDOODWLRQ D2UJDQL]HLQFRQVLVWHQWIRUPDWXQGHUVHSDUDWHKHDGLQJVIRUGLIIHUHQWSURFHGXUHV E3URYLGHORJLFDOVHTXHQFHRILQVWUXFWLRQVRIHDFKSURFHGXUH  '$323(5$7,21$1'0$,17(1$1&('$7$ 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$SULO   &RS\RIHDFKZDUUDQW\ERQGDQGVHUYLFHFRQWUDFWLVVXHG D3URYLGHLQIRUPDWLRQVKHHWIRU&LW\SHUVRQQHOJLYLQJ  3URSHUSURFHGXUHVLQHYHQWRIIDLOXUH  ,QVWDQFHVZKLFKPLJKWDIIHFWYDOLGLW\RIZDUUDQWLHVRUERQGV &0DQXDOIRU0DWHULDOVDQG)LQLVKHV 6XEPLWFRSLHVRIFRPSOHWHPDQXDOLQILQDOIRUP &RQWHQWIRUDUFKLWHFWXUDOSURGXFWVDSSOLHGPDWHULDOVDQGILQLVKHV D0DQXIDFWXUHU VGDWDJLYLQJIXOOLQIRUPDWLRQRQSURGXFWV  &DWDORJQXPEHUVL]HFRPSRVLWLRQ  &RORUDQGWH[WXUHGHVLJQDWLRQV  ,QIRUPDWLRQUHTXLUHGIRUUHRUGHULQJVSHFLDOPDQXIDFWXUHGSURGXFWV E,QVWUXFWLRQVIRUFDUHDQGPDLQWHQDQFH  0DQXIDFWXUHU VUHFRPPHQGDWLRQIRUW\SHVRIFOHDQLQJDJHQWVDQGPHWKRGV  &DXWLRQVDJDLQVWFOHDQLQJDJHQWVDQGPHWKRGVZKLFKDUHGHWULPHQWDOWR SURGXFW  5HFRPPHQGHGVFKHGXOHIRUFOHDQLQJDQGPDLQWHQDQFH &RQWHQWIRUPRLVWXUHSURWHFWLRQDQGZHDWKHUH[SRVXUHSURGXFWV D0DQXIDFWXUHU VGDWDJLYLQJIXOOLQIRUPDWLRQRQSURGXFWV  $SSOLFDEOHVWDQGDUGV  &KHPLFDOFRPSRVLWLRQ  'HWDLOVRILQVWDOODWLRQ E,QVWUXFWLRQVIRULQVSHFWLRQPDLQWHQDQFHDQGUHSDLU '0DQXDOIRU(TXLSPHQWDQG6\VWHPV 6XEPLWFRSLHVRIFRPSOHWHPDQXDOLQILQDOIRUP &RQWHQWIRUHDFKXQLWRIHTXLSPHQWDQGV\VWHPDVDSSURSULDWH D'HVFULSWLRQRIXQLWDQGFRPSRQHQWSDUWV  )XQFWLRQQRUPDORSHUDWLQJFKDUDFWHULVWLFVDQGOLPLWLQJFRQGLWLRQV  3HUIRUPDQFHFXUYHVHQJLQHHULQJGDWDDQGWHVWV  &RPSOHWHQRPHQFODWXUHDQGFRPPHUFLDOQXPEHURIUHSODFHDEOHSDUWV E2SHUDWLQJSURFHGXUHV  6WDUWXSEUHDNLQURXWLQHDQGQRUPDORSHUDWLQJLQVWUXFWLRQV  5HJXODWLRQFRQWUROVWRSSLQJVKXWGRZQDQGHPHUJHQF\LQVWUXFWLRQV  6XPPHUDQGZLQWHURSHUDWLQJLQVWUXFWLRQV  6SHFLDORSHUDWLQJLQVWUXFWLRQV F0DLQWHQDQFHSURFHGXUHV  5RXWLQHRSHUDWLRQV  *XLGHWRWURXEOHVKRRWLQJ  'LVDVVHPEO\UHSDLUDQGUHDVVHPEO\  $OLJQPHQWDGMXVWLQJDQGFKHFNLQJ G6HUYLFLQJDQGOXEULFDWLRQVFKHGXOH  /LVWRIOXEULFDQWVUHTXLUHG H0DQXIDFWXUHU VSULQWHGRSHUDWLQJDQGPDLQWHQDQFHLQVWUXFWLRQV I'HVFULSWLRQRIVHTXHQFHRIRSHUDWLRQE\FRQWUROPDQXIDFWXUHU  3UHGLFWHGOLIHRISDUWVVXEMHFWWRZHDU  ,WHPVUHFRPPHQGHGWREHVWRFNHGDVVSDUHSDUWV J$VLQVWDOOHGFRQWUROGLDJUDPVE\FRQWUROVPDQXIDFWXUHU K(DFKFRQWUDFWRU VFRRUGLQDWLRQGUDZLQJV  $VLQVWDOOHGFRORUFRGHGSLSLQJGLDJUDPV  '$323(5$7,21$1'0$,17(1$1&('$7$ 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$SULO   L&KDUWVRIYDOYHWDJQXPEHUVZLWKORFDWLRQDQGIXQFWLRQRIHDFKYDOYH M/LVWRIRULJLQDOPDQXIDFWXUHU VVSDUHSDUWVPDQXIDFWXUHU VFXUUHQWSULFHVDQG UHFRPPHQGHGTXDQWLWLHVWREHPDLQWDLQHGLQVWRUDJH N2WKHUGDWDDVUHTXLUHGXQGHUSHUWLQHQW6HFWLRQVRI6SHFLILFDWLRQV &RQWHQWIRUHDFKHOHFWULFDQGHOHFWURQLFV\VWHPDVDSSURSULDWH D'HVFULSWLRQRIV\VWHPDQGFRPSRQHQWSDUWV  )XQFWLRQQRUPDORSHUDWLQJFKDUDFWHULVWLFVDQGOLPLWLQJFRQGLWLRQV  3HUIRUPDQFHFXUYHVHQJLQHHULQJGDWDDQGWHVWV  &RPSOHWHQRPHQFODWXUHDQGFRPPHUFLDOQXPEHURIUHSODFHDEOHSDUWV E&LUFXLWGLUHFWRULHVRISDQHOERDUGV  (OHFWULFDOVHUYLFH  &RQWUROV  &RPPXQLFDWLRQV F$VLQVWDOOHGFRORUFRGHGZLULQJGLDJUDPV G2SHUDWLQJSURFHGXUHV  5RXWLQHDQGQRUPDORSHUDWLQJLQVWUXFWLRQV  6HTXHQFHVUHTXLUHG  6SHFLDORSHUDWLQJLQVWUXFWLRQV H0DLQWHQDQFHSURFHGXUHV  5RXWLQHRSHUDWLRQV  *XLGHWRWURXEOHVKRRWLQJ  'LVDVVHPEO\UHSDLUDQGUHDVVHPEO\  $GMXVWPHQWDQGFKHFNLQJ I0DQXIDFWXUHU VSULQWHGRSHUDWLQJDQGPDLQWHQDQFHLQVWUXFWLRQV J/LVWRIRULJLQDOPDQXIDFWXUHU VVSDUHSDUWVPDQXIDFWXUHU VFXUUHQWSULFHVDQG UHFRPPHQGHGTXDQWLWLHVWREHPDLQWDLQHGLQVWRUDJH K2WKHUGDWDDVUHTXLUHGXQGHUSHUWLQHQW6HFWLRQVRI6SHFLILFDWLRQV 3UHSDUHDQGLQFOXGHDGGLWLRQDOGDWDZKHQWKHQHHGIRUVXFKGDWDEHFRPHVDSSDUHQW GXULQJLQVWUXFWLRQRI&LW\ VSHUVRQQHO &/26(28768%0,77$/6>12786('@ 0$,17(1$1&(0$7(5,$/68%0,77$/6>12786('@ 48$/,7<$6685$1&( $3URYLGHRSHUDWLRQDQGPDLQWHQDQFHGDWDE\SHUVRQQHOZLWKWKHIROORZLQJFULWHULD 7UDLQHGDQGH[SHULHQFHGLQPDLQWHQDQFHDQGRSHUDWLRQRIGHVFULEHGSURGXFWV 6NLOOHGDVWHFKQLFDOZULWHUWRWKHH[WHQWUHTXLUHGWRFRPPXQLFDWHHVVHQWLDOGDWD 6NLOOHGDVGUDIWVPDQFRPSHWHQWWRSUHSDUHUHTXLUHGGUDZLQJV  '$323(5$7,21$1'0$,17(1$1&('$7$ 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$SULO   '(/,9(5<6725$*($1'+$1'/,1*>12786('@ ),(/'>6,7(@&21',7,216>12786('@ :$55$17<>12786('@ 3$57352'8&76>12786('@ 3$57(;(&87,21>12786('@ (1'2)6(&7,21  5HYLVLRQ/RJ '$7( 1$0( 6800$5<2)&+$1*(  '-RKQVRQ $±WLWOHRIVHFWLRQUHPRYHG  0'RPHQHFK 5HYLVHGIRU'$3$SSOLFDWLRQ     '$3352-(&75(&25''2&80(176 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$SULO  6(&7,21 352-(&75(&25''2&80(176 3$57*(1(5$/ 6800$5< $6HFWLRQ,QFOXGHV :RUNDVVRFLDWHGZLWKWKHGRFXPHQWLQJWKHSURMHFWDQGUHFRUGLQJFKDQJHVWRSURMHFW GRFXPHQWVLQFOXGLQJ D5HFRUG'UDZLQJV E:DWHU0HWHU6HUYLFH5HSRUWV F6DQLWDU\6HZHU6HUYLFH5HSRUWV G/DUJH:DWHU0HWHU5HSRUWV %'HYLDWLRQVIURPWKLV&LW\RI)RUW:RUWK6WDQGDUG6SHFLILFDWLRQ 1RQH &5HODWHG6SHFLILFDWLRQ6HFWLRQVLQFOXGHEXWDUHQRWQHFHVVDULO\OLPLWHGWR 'LYLVLRQ±%LGGLQJ5HTXLUHPHQWV&RQWUDFW)RUPVDQG&RQGLWLRQVRIWKH&RQWUDFW 'LYLVLRQ±*HQHUDO5HTXLUHPHQWV 35,&($1'3$<0(17352&('85(6 $0HDVXUHPHQWDQG3D\PHQW :RUNDVVRFLDWHGZLWKWKLV,WHPLVFRQVLGHUHGVXEVLGLDU\WRWKHYDULRXV,WHPVELG 1RVHSDUDWHSD\PHQWZLOOEHDOORZHGIRUWKLV,WHP 5()(5(1&(6>12786('@ $'0,1,675$7,9(5(48,5(0(176>12786('@ 68%0,77$/6 $3ULRUWRVXEPLWWLQJDUHTXHVWIRU)LQDO,QVSHFWLRQGHOLYHU3URMHFW5HFRUG'RFXPHQWVWR &LW\¶V3URMHFW5HSUHVHQWDWLYH $&7,2168%0,77$/6,1)250$7,21$/68%0,77$/6>12786('@ &/26(28768%0,77$/6>12786('@ 0$,17(1$1&(0$7(5,$/68%0,77$/6>12786('@ 48$/,7<$6685$1&( $$FFXUDF\RI5HFRUGV 7KRURXJKO\FRRUGLQDWHFKDQJHVZLWKLQWKH5HFRUG'RFXPHQWVPDNLQJDGHTXDWH DQGSURSHUHQWULHVRQHDFKSDJHRI6SHFLILFDWLRQVDQGHDFKVKHHWRI'UDZLQJVDQG RWKHU'RFXPHQWVZKHUHVXFKHQWU\LVUHTXLUHGWRVKRZWKHFKDQJHSURSHUO\ $FFXUDF\RIUHFRUGVVKDOOEHVXFKWKDWIXWXUHVHDUFKIRULWHPVVKRZQLQWKH&RQWUDFW 'RFXPHQWVPD\UHO\UHDVRQDEO\RQLQIRUPDWLRQREWDLQHGIURPWKHDSSURYHG3URMHFW 5HFRUG'RFXPHQWV  '$3352-(&75(&25''2&80(176 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$SULO  7RIDFLOLWDWHDFFXUDF\RIUHFRUGVPDNHHQWULHVZLWKLQKRXUVDIWHUUHFHLSWRI LQIRUPDWLRQWKDWWKHFKDQJHKDVRFFXUUHG 3URYLGHIDFWXDOLQIRUPDWLRQUHJDUGLQJDOODVSHFWVRIWKH:RUNERWKFRQFHDOHGDQG YLVLEOHWRHQDEOHIXWXUHPRGLILFDWLRQRIWKH:RUNWRSURFHHGZLWKRXWOHQJWK\DQG H[SHQVLYHVLWHPHDVXUHPHQWLQYHVWLJDWLRQDQGH[DPLQDWLRQ 6725$*($1'+$1'/,1* $6WRUDJHDQG+DQGOLQJ5HTXLUHPHQWV 0DLQWDLQWKHMREVHWRI5HFRUG'RFXPHQWVFRPSOHWHO\SURWHFWHGIURPGHWHULRUDWLRQ DQGIURPORVVDQGGDPDJHXQWLOFRPSOHWLRQRIWKH:RUNDQGWUDQVIHURIDOOUHFRUGHG GDWDWRWKHILQDO3URMHFW5HFRUG'RFXPHQWV ,QWKHHYHQWRIORVVRIUHFRUGHGGDWDXVHPHDQVQHFHVVDU\WRDJDLQVHFXUHWKHGDWD WRWKH&LW\ VDSSURYDO D,QVXFKFDVHSURYLGHUHSODFHPHQWVWRWKHVWDQGDUGVRULJLQDOO\UHTXLUHGE\WKH &RQWUDFW'RFXPHQWV ),(/'>6,7(@&21',7,216>12786('@ :$55$17<>12786('@ 3$57352'8&76 2:1(5)851,6+('>25@2:1(56833/,('352'8&76>12786('@ 5(&25''2&80(176 $-REVHW 3URPSWO\IROORZLQJUHFHLSWRIWKH1RWLFHWR3URFHHGVHFXUHIURPWKH&LW\DWQR FKDUJHWRWKH&RQWUDFWRUFRPSOHWHVHWRIDOO'RFXPHQWVFRPSULVLQJWKH&RQWUDFW %)LQDO5HFRUG'RFXPHQWV $WDWLPHQHDULQJWKHFRPSOHWLRQRIWKH:RUNDQGSULRUWR)LQDO,QVSHFWLRQSURYLGH WKH&LW\FRPSOHWHVHWRIDOO)LQDO5HFRUG'UDZLQJVLQWKH&RQWUDFW $&&(6625,(6>12786('@ 6285&(48$/,7<&21752/>12786('@ 3$57(;(&87,21 ,167$//(56>12786('@ (;$0,1$7,21>12786('@ 35(3$5$7,21>12786('@ 0$,17(1$1&('2&80(176 $0DLQWHQDQFHRI-RE6HW ,PPHGLDWHO\XSRQUHFHLSWRIWKHMREVHWLGHQWLI\HDFKRIWKH'RFXPHQWVZLWKWKH WLWOH5(&25''2&80(176-2%6(7  '$3352-(&75(&25''2&80(176 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$SULO  3UHVHUYDWLRQ D&RQVLGHULQJWKH&RQWUDFWFRPSOHWLRQWLPHWKHSUREDEOHQXPEHURIRFFDVLRQV XSRQZKLFKWKHMREVHWPXVWEHWDNHQRXWIRUQHZHQWULHVDQGIRUH[DPLQDWLRQ DQGWKHFRQGLWLRQVXQGHUZKLFKWKHVHDFWLYLWLHVZLOOEHSHUIRUPHGGHYLVHD VXLWDEOHPHWKRGIRUSURWHFWLQJWKHMREVHW E'RQRWXVHWKHMREVHWIRUDQ\SXUSRVHH[FHSWHQWU\RIQHZGDWDDQGIRUUHYLHZ E\WKH&LW\XQWLOVWDUWRIWUDQVIHURIGDWDWRILQDO3URMHFW5HFRUG'RFXPHQWV F0DLQWDLQWKHMREVHWDWWKHVLWHRIZRUN &RRUGLQDWLRQZLWK&RQVWUXFWLRQ6XUYH\ D$WDPLQLPXPFOHDUO\PDUNDQ\GHYLDWLRQVIURP&RQWUDFW'RFXPHQWV DVVRFLDWHGZLWKLQVWDOODWLRQRIWKHLQIUDVWUXFWXUH 0DNLQJHQWULHVRQ'UDZLQJV D5HFRUGDQ\GHYLDWLRQVIURP&RQWUDFW'RFXPHQWV E8VHDQHUDVDEOHFRORUHGSHQFLO QRWLQNRULQGHOLEOHSHQFLO FOHDUO\GHVFULEHWKH FKDQJHE\JUDSKLFOLQHDQGQRWHDVUHTXLUHG F'DWHDOOHQWULHV G&DOODWWHQWLRQWRWKHHQWU\E\DFORXGGUDZQDURXQGWKHDUHDRUDUHDVDIIHFWHG H,QWKHHYHQWRIRYHUODSSLQJFKDQJHVXVHGLIIHUHQWFRORUVIRUWKHRYHUODSSLQJ FKDQJHV &RQYHUVLRQRIVFKHPDWLFOD\RXWV D,QVRPHFDVHVRQWKH'UDZLQJVDUUDQJHPHQWVRIFRQGXLWVFLUFXLWVSLSLQJ GXFWVDQGVLPLODULWHPVDUHVKRZQVFKHPDWLFDOO\DQGDUHQRWLQWHQGHGWR SRUWUD\SUHFLVHSK\VLFDOOD\RXW  )LQDOSK\VLFDODUUDQJHPHQWLVGHWHUPLQHGE\WKH&RQWUDFWRUVXEMHFWWRWKH &LW\ VDSSURYDO  +RZHYHUGHVLJQRIIXWXUHPRGLILFDWLRQVRIWKHIDFLOLW\PD\UHTXLUH DFFXUDWHLQIRUPDWLRQDVWRWKHILQDOSK\VLFDOOD\RXWRILWHPVZKLFKDUH VKRZQRQO\VFKHPDWLFDOO\RQWKH'UDZLQJV E6KRZRQWKHMREVHWRI5HFRUG'UDZLQJVE\GLPHQVLRQDFFXUDWHWRZLWKLQ LQFKWKHFHQWHUOLQHRIHDFKUXQRILWHPV  )LQDOSK\VLFDODUUDQJHPHQWLVGHWHUPLQHGE\WKH&RQWUDFWRUVXEMHFWWRWKH &LW\ VDSSURYDO  6KRZE\V\PERORUQRWHWKHYHUWLFDOORFDWLRQRIWKH,WHP XQGHUVODELQ FHLOLQJSOHQXPH[SRVHGDQGWKHOLNH   0DNHDOOLGHQWLILFDWLRQVXIILFLHQWO\GHVFULSWLYHWKDWLWPD\EHUHODWHG UHOLDEO\WRWKH6SHFLILFDWLRQV F7KH&LW\PD\ZDLYHWKHUHTXLUHPHQWVIRUFRQYHUVLRQRIVFKHPDWLFOD\RXWV ZKHUHLQWKH&LW\ VMXGJPHQWFRQYHUVLRQVHUYHVQRXVHIXOSXUSRVH+RZHYHU GRQRWUHO\XSRQZDLYHUVEHLQJLVVXHGH[FHSWDVVSHFLILFDOO\LVVXHGLQZULWLQJ E\WKH&LW\ %)LQDO3URMHFW5HFRUG'RFXPHQWV 7UDQVIHURIGDWDWR'UDZLQJV D&DUHIXOO\WUDQVIHUFKDQJHGDWDVKRZQRQWKHMREVHWRI5HFRUG'UDZLQJVWRWKH FRUUHVSRQGLQJILQDOGRFXPHQWVFRRUGLQDWLQJWKHFKDQJHVDVUHTXLUHG E&OHDUO\LQGLFDWHDWHDFKDIIHFWHGGHWDLODQGRWKHU'UDZLQJDIXOOGHVFULSWLRQRI FKDQJHVPDGHGXULQJFRQVWUXFWLRQDQGWKHDFWXDOORFDWLRQRILWHPV F&DOODWWHQWLRQWRHDFKHQWU\E\GUDZLQJDFORXGDURXQGWKHDUHDRUDUHDV DIIHFWHG  '$3352-(&75(&25''2&80(176 3DJHRI   &,7<2))257:257+  7H[DV,QGXVWULHV$GGLWLRQ1R/RW%ORFN 67$1'$5'&216758&7,2163(&,),&$7,21'2&80(176±'(9(/23(5$:$5'('352-(&76 &LW\3URMHFW 5HYLVHG$SULO  G0DNHFKDQJHVQHDWO\FRQVLVWHQWO\DQGZLWKWKHSURSHUPHGLDWRDVVXUH ORQJHYLW\DQGFOHDUUHSURGXFWLRQ 7UDQVIHURIGDWDWRRWKHU'RFXPHQWV D,IWKH'RFXPHQWVRWKHUWKDQ'UDZLQJVKDYHEHHQNHSWFOHDQGXULQJSURJUHVVRI WKH:RUNDQGLIHQWULHVWKHUHRQKDYHEHHQRUGHUO\WRWKHDSSURYDORIWKH&LW\ WKHMREVHWRIWKRVH'RFXPHQWVRWKHUWKDQ'UDZLQJVZLOOEHDFFHSWHGDVILQDO 5HFRUG'RFXPHQWV E,IDQ\VXFK'RFXPHQWLVQRWVRDSSURYHGE\WKH&LW\VHFXUHDQHZFRS\RIWKDW 'RFXPHQWIURPWKH&LW\DWWKH&LW\ VXVXDOFKDUJHIRUUHSURGXFWLRQDQG KDQGOLQJDQGFDUHIXOO\WUDQVIHUWKHFKDQJHGDWDWRWKHQHZFRS\WRWKHDSSURYDO RIWKH&LW\ 5(3$,55(6725$7,21>12786('@ 5(,167$//$7,21>12786('@ ),(/'>25@6,7(48$/,7<&21752/>12786('@ 6<67(067$5783>12786('@ $'-867,1*>12786('@ &/($1,1*>12786('@ &/26(287$&7,9,7,(6>12786('@ 3527(&7,21>12786('@ 0$,17(1$1&(>12786('@ $77$&+0(176>12786('@ (1'2)6(&7,21  5HYLVLRQ/RJ '$7( 1$0( 6800$5<2)&+$1*(  0'RPHQHFK 5HYLVHGIRU'$3$SSOLFDWLRQ    $SSURYDO 6SHF1R &ODVVVLILFDWLRQ 0DQXIDFWXUHU 0RGHO1R 1DWLRQDO6SHF 6L]H :DWHU 6HZHU0DQKROHV %DVHV&RPSRQHQWV 5HY   8UHWKDQH+\GURSKLOLF:DWHUVWRS $VDKL.RJ\R.. $GHND8OWUD6HDO3 $670'''   2IIVHW-RLQWIRU 'LDP0+ +DQVRQ&RQFUHWH3URGXFWV 'UDZLQJ1R   3URILOH*DVNHWIRU 'LDP0+ 3UHVV6HDO*DVNHW&RUS **DVNHW $670&& 660+   +'3(0DQKROH$GMXVWPHQW5LQJV /DGWHFK,QF +'3($GMXVWPHQW5LQJ 7UDIILFDQG1RQWUDIILFDUHD   0DQKROH([WHUQDO:UDS &DQXVD&36 :UDSLG6HDO0DQKROH(QFDSVXODWLRQ6\VWHP :DWHU 6HZHU0DQKROHV %DVHV)LEHUJODVV    )LEHUJODVV0DQKROH )OXLG&RQWDLQPHQW,QF )ORZWLWH $670 1RQWUDIILFDUHD   )LEHUJODVV0DQKROH /)0DQXIDFWXULQJ 1RQWUDIILFDUHD :DWHU 6HZHU0DQKROHV %DVHV)UDPHV &RYHUV5HFWDQJXODU 5HY  0DQKROH)UDPHVDQG&RYHUV :HVWHUQ,URQ:RUNV%DVV +D\V)RXQGU\  [:' :DWHU 6HZHU0DQKROHV %DVHV)UDPHV &RYHUV6WDQGDUG 5RXQG  5HY  0DQKROH)UDPHVDQG&RYHUV :HVWHUQ,URQ:RUNV%DVV +D\V)RXQGU\  'LD  0DQKROH)UDPHVDQG&RYHUV 0F.LQOH\,URQ:RUNV,QF $$0 'LD   0DQKROH)UDPHVDQG&RYHUV 1HHQDK)RXQGU\ 5 $670$ $$6+720 'LD   0DQKROH)UDPHVDQG&RYHUV 1HHQDK)RXQGU\ 5/0 +LQJHG $670$ $$6+720 'LD   0DQKROH)UDPHVDQG&RYHUV 1HHQDK)RXQGU\ 1) $670$ $$6+720 'LD   0DQKROH)UDPHVDQG&RYHUV 1HHQDK)RXQGU\ 5/0 +LQJHG $670$ $$6+720 GLD  0DQKROH)UDPHVDQG&RYHUV 6LJPD&RUSRUDWLRQ 0+1  0DQKROH)UDPHVDQG&RYHUV 6LJPD&RUSRUDWLRQ 0+1  0DQKROH)UDPHVDQG&RYHUV 3RQW$0RXVVRQ *7667' GLD  0DQKROH)UDPHVDQG&RYHUV 1HHQDK&DVWLQJ GLD   0DQKROH)UDPHVDQG&RYHUV +LQJHG 3RZHUVHDO +LQJHG'XFWLOH,URQ0DQKROH $670$ 'LD   0DQKROH)UDPHVDQG&RYHUV 6DLQW*REDLQ3LSHOLQHV 3DPUH[UH[XV 5(5)6 'LD   'LD0+5LQJDQG&RYHU (DVW-RUGDQ,URQ:RUNV 9DQG9'HVLJQV $$6+720 'LD   'LD0+5LQJDQG&RYHU 6LJPD&RUSRUDWLRQ 0+):1 0+ 'LD   'LD0+5LQJDQG&RYHU 6WDU3LSH3URGXFWV 0+)7:66'& 'LD   'LD0+5LQJDQG&RYHU $FFXFDVW +HDY\'XW\ZLWK*DVNHW5LQJ 'LD   'LD0+5LQJDQG&RYHU +LQJHG /RFNDEOH (DVW-RUGDQ,URQ:RUNV (5*2;/$VVHPEO\ ZLWK&DP/RFN03,&7*DVNHW $66+720 $670$ 'LD   'LD0+5LQJDQG&RYHU +LQJHG /RFNDEOH &, 6,3,QGXVWULHV   $670$ 'LD   'LD0+5LQJDQG&RYHU &RPSRVLWH$FFHVV3URGXFWV/3 &$321()7:&RPSRVLWHZ/RFN ZR+LQJ 'LD   'LD0+5LQJDQG&RYHU 7UXPEXOO0DQXIDFWXULQJ   )UDPHDQG&RYHU 'LD :DWHU 6HZHU0DQKROHV %DVHV)UDPHV &RYHUV:DWHU7LJKW 3UHVVXUH7LJKW 5HY  0DQKROH)UDPHVDQG&RYHUV 3RQW$0RXVVRQ 3DPWLJKW 'LD  0DQKROH)UDPHVDQG&RYHUV 1HHQDK&DVWLQJ 'LD  0DQKROH)UDPHVDQG&RYHUV :HVWHUQ,URQ:RUNV%DVV +D\V)RXQGU\ 3 'LD  0DQKROH)UDPHVDQG&RYHUV 0F.LQOH\,URQ:RUNV,QF :3$$0 'LD   0DQKROH)UDPHVDQG&RYHUV $FFXFDVW 5& $670$ 'LD   0DQKROH)UDPHVDQG&RYHUV 6,3 6HUDPSRUH,QGXVWULHV3ULYDWH/WG 5LQJDQG&RYHU $670$ 'LD :DWHU 6HZHU0DQKROHV %DVHV3UHFDVW&RQFUHWH 5HY  0DQKROH3UHFDVW&RQFUHWH +\GUR&RQGXLW&RUS 63/,WHP $670&   0DQKROH3UHFDVW&RQFUHWH :DOO&RQFUHWH3LSH&R,QF $670&    0DQKROH3UHFDVW&RQFUHWH &RQFUHWH3URGXFW,QF ,'0DQKROHZ&RQH $670& ZFRQH   0DQKROH3UHFDVW&RQFUHWH 7KH7XUQHU&RPSDQ\ ,'0DQKROHZ&RQH $670&    0DQKROH3UHFDVW&RQFUHWH 2OGFDVWOH3UHFDVW,QF,'0DQKROHZ&RQH $670& 'LDPZ5LQJ   0DQKROH3UHFDVW 5HLQIRUFHG3RO\PHU &RQFUHWH 86&RPSRVLWH3LSH 5HLQIRUFHG3RO\PHU&RQFUHWH $670& WR   0DQKROH3UHFDVW&RQFUHWH )RUWHUUD3LSHDQG3UHFDVW  ,'0DQKROHZ&RQH $670&     0DQKROH3UHFDVW&RQFUHWH )RUWHUUD3LSHDQG3UHFDVW ,'0DQKROHZ&RQH $670&    0DQKROH3UHFDVW 5HLQIRUFHG3RO\PHU &RQFUHWH $UPRURFN  ,'0DQKROHZ&RQH     0DQKROH3UHFDVW +\EULG 3RO\PHU 39& 3UHGO6\VWHPV  ,'0DQKROHZ&RQH  1RQ7UDIILF$UHDV :DWHU 6HZHU0DQKROHV %DVHV5HKDE6\VWHPV&HPHQWLWLRXV ( 0DQKROH5HKDE6\VWHPV 4XDGH[  ( 0DQKROH5HKDE6\VWHPV 6WDQGDUG&HPHQW0DWHULDOV,QF 5HOLQHU063 ( 0DQKROH5HKDE6\VWHPV $303HUPDIRUP  ( 0DQKROH5HKDE6\VWHP 6WURQJ&RPSDQ\ 6WURQJ6HDO06$5HKDE6\VWHP  ( 0DQKROH5HKDE6\VWHP /LQHU 3RO\WULSOH[7HFKQRORJLHV 0+UHSDLUSURGXFWWRVWRSLQILOWUDWLRQ $670'  *HQHUDO&RQFUHWH5HSDLU )OH[.UHWH7HFKQRORJLHV 9LQ\O3RO\HVWHU5HSDLU3URGXFW 0LVF8VH :DWHU 6HZHU0DQKROHV %DVHV5HKDE6\VWHPV1RQ&HPHQWLWLRXV  ( 0DQKROH5HKDE6\VWHPV 6SUD\URT 6SUD\:DOO3RO\XUHWKDQH&RDWLQJ $670'' ( 0DQKROH5HKDE6\VWHPV 6XQ&RDVW  &RDWLQJIRU&RUURVLRQSURWHFWLRQ ([WHULRU (57(&+ 6HULHVDQG $VSKDWLF(PXOVLRQ )RU([WHULRU&RDWLQJRI&RQFUHWH 6WUXFWXUHV2QO\  &RDWLQJVIRU&RUURVLRQ3URWHFWLRQ &KHVWHUWRQ $UF6+%66 $FLG5HVLVWDQFH7HVW 6HZHU$SSOLFDWLRQV  &RDWLQJVIRU&RUURVLRQ3URWHFWLRQ :DUUHQ(QYLURQPHQWDO 6DQG0 6HZHU$SSOLFDWLRQV  &RDWLQJVIRU&RUURVLRQ3URWHFWLRQ &LWDGHO 6/66ROLGV(SR[\ 6HZHU$SSOLFDWLRQV    &RDWLQJIRU&RUURVLRQSURWHFWLRQ ([WHULRU 6KHUZLQ:LOOLDPV 55 &'DPSSURRILQJ1RQ)LEHUHG6SUD\ *UDGH $VSKDWLF(PXOVLRQ )RU([WHULRU&RDWLQJRI&RQFUHWH 6WUXFWXUHV2QO\ &,7<2))257:257+ :$7(5'(3$570(17 67$1'$5'352'8&7/,67 ‘–‡ǣŽŽ™ƒ–‡”‘”•‡™‡”’‹’‡Žƒ”‰‡”–Šƒͳͷ‹…Š†‹ƒ‡–‡”•ŠƒŽŽ„‡ƒ’’”‘˜‡†ˆ‘”—•‡„›–Š‡ƒ–‡”‡’ƒ”–‡–‘ƒ’”‘Œ‡…–•’‡…‹ˆ‹…„ƒ•‹•Ǥ’‡…‹ƒŽ„‡††‹‰ƒ›„‡”‡“—‹”‡†ˆ‘”•‘‡’‹’‡•Ǥ 8SGDWHG  Ύ&ƌŽŵKƌŝŐŝŶĂů^ƚĂŶĚĂƌĚWƌŽĚƵĐƚƐ>ŝƐƚ ϭ $SSURYDO 6SHF1R &ODVVVLILFDWLRQ 0DQXIDFWXUHU 0RGHO1R 1DWLRQDO6SHF 6L]H &,7<2))257:257+ :$7(5'(3$570(17 67$1'$5'352'8&7/,67 ‘–‡ǣŽŽ™ƒ–‡”‘”•‡™‡”’‹’‡Žƒ”‰‡”–Šƒͳͷ‹…Š†‹ƒ‡–‡”•ŠƒŽŽ„‡ƒ’’”‘˜‡†ˆ‘”—•‡„›–Š‡ƒ–‡”‡’ƒ”–‡–‘ƒ’”‘Œ‡…–•’‡…‹ˆ‹…„ƒ•‹•Ǥ’‡…‹ƒŽ„‡††‹‰ƒ›„‡”‡“—‹”‡†ˆ‘”•‘‡’‹’‡•Ǥ 8SGDWHG  :DWHU 6HZHU0DQKROH,QVHUWV)LHOG2SHUDWLRQV8VH2QO\ 5HY  0DQKROH,QVHUW .QXWVRQ(QWHUSULVHV 0DGHWR2UGHU3ODVWLF $670' )RUGLD  0DQKROH,QVHUW 6RXWK:HVWHUQ3DFNDJLQJ 0DGHWR2UGHU3ODVWLF $670' )RUGLD  0DQKROH,QVHUW 1RIORZ,QIORZ 0DGHWR2UGHU3ODVWLF $670' )RUGLD   0DQKROH,QVHUW 6RXWKZHVWHUQ3DFNLQJ 6HDOV,QF /LIH6DYHU6WDLQOHVV6WHHO )RUGLD   0DQKROH,QVHUW 6RXWKZHVWHUQ3DFNLQJ 6HDOV,QF 7HWKHU/RN6WDLQOHVV6WHHO )RUGLD :DWHU 6HZHU3LSH&DVLQJ6SDFHUV   6WHHO%DQG&DVLQJ6SDFHUV $GYDQFHG3URGXFWVDQG6\VWHPV,QF &DUERQ6WHHO6SDFHUV0RGHO6,  6WDLQOHVV6WHHO&DVLQJ6SDFHU $GYDQFHG3URGXFWVDQG6\VWHPV,QF 6WDLQOHVV6WHHO6SDFHU0RGHO66,  &DVLQJ6SDFHUV &DVFDGH:DWHUZRUNV0DQXIDFWXULQJ &DVLQJ6SDFHUV  6WDLQOHVV6WHHO&DVLQJ6SDFHU 3LSHOLQH6HDODQG,QVXODWRU 6WDLQOHVV6WHHO&DVLQJ6SDFHU 8SWR  &RDWHG6WHHO&DVLQ6SDFHUV 3LSHOLQH6HDODQG,QVXODWRU &RDWHG6WHHO&DVLQ6SDFHUV 8SWR  6WDLQOHVV6WHHO&DVLQJ6SDFHU 3RZHUVHDO 3RZHUFKRFN 8SWR  &DVLQJ6SDFHUV %:0 66&DVLQJ6SDFHU 6WDLQOHVV6WHHO  &DVLQJ6SDFHUV %:0 )%&DVLQJ6SDFHU &RDWHG&DUERQ6WHHO  IRU1RQBSUHVVXUH3LSHDQG*URXWHG&DVLQJ   &DVLQJ6SDFHUV &&,3LSHOLQH6\VWHPV &6&&66 :DWHU 6HZHU3LSHV'XFWLOH,URQ   'XFWLOH,URQ3LSH *ULIILQ3LSH3URGXFWV&R 6XSHU%HOO7LWH'XFWLOH,URQ3UHVVXUH3LSH$::$&&WKUX   'XFWLOH,URQ3LSH $PHULFDQ'XFWLOH,URQ3LSH&R$PHULFDQ)DVWLWH3LSH %HOO6SLJRW $::$&& WKUX   'XFWLOH,URQ3LSH $PHULFDQ'XFWLOH,URQ3LSH&R$PHULFDQ)OH[5LQJ 5HVWUDLQHG-RLQW $::$&& WKUX  'XFWLOH,URQ3LSH 863LSHDQG)RXQGU\&R $::$&&  'XFWLOH,URQ3LSH 0F:DQH&DVW,URQ3LSH&R $::$&& :DWHU 6HZHU8WLOLW\/LQH0DUNHU  6HZHU&RDWLQJV(SR[\   (SR[\/LQLQJ6\VWHP 6DXHUHLVHQ,QF 6HZHU*DUG56 /$&RXQW\  (SR[\/LQLQJ6\VWHP (UWHFK7HFKQLFDO&RDWLQJV (UWHFKDQG6HULHV  ,QWHULRU'XFWLOH,URQ3LSH&RDWLQJ ,QGXURQ 3URWHFWR $670% 'XFWLOH,URQ3LSH2QO\  &RDWLQJVIRU&RUURVLRQ3URWHFWLRQ &KHVWHUWRQ $UF6+%66 $FLG5HVLVWDQFH7HVW 6HZHU$SSOLFDWLRQV  &RDWLQJVIRU&RUURVLRQ3URWHFWLRQ :DUUHQ(QYLURQPHQWDO 6DQG0 6HZHU$SSOLFDWLRQV 6HZHU&RDWLQJV3RO\XUHWKDQH 6HZHU&RPELQDWLRQ$LU9DOYHV   $LU5HOHDVH9DOYH $5,86$,QF '/73 &RPSRVLWH%RG\  6HZHU3LSHV&RQFUHWH ( &RQF3LSH5HLQIRUFHG :DOO&RQFUHWH3LSH&R,QF $670& ( &RQF3LSH5HLQIRUFHG +\GUR&RQGXLW&RUSRUDWLRQ &ODVV,,,7 *63/,WHP $670& ( &RQF3LSH5HLQIRUFHG +DQVRQ&RQFUHWH3URGXFWV 63/,WHP0DQKROH3LSH $670& ( &RQF3LSH5HLQIRUFHG &RQFUHWH3LSH 3URGXFWV&R,QF $670& 6HZHU3LSH(QODUJPHQW6\VWHP 0HWKRG   3,06\VWHP 3,0&RUSRUDWLRQ 3RO\HWK\OHQH 3,0&RUS3LVFDWD:D\1- $SSURYHG3UHYLRXVO\ 0F&RQQHOO6\VWHPV 0F/DW&RQVWUXFWLRQ 3RO\HWK\OHQH +RXVWRQ7H[DV $SSURYHG3UHYLRXVO\ 7566\VWHPV 7UHQFKOHVV5HSODFHPHQW6\VWHP 3RO\HWK\OHQH &DOJDU\&DQDGD $SSURYHG3UHYLRXVO\ 6HZHU3LSH)LEHUJODVV5HLQIRUFHG3LSH    &HQW&DVW)LEHUJODVV )53 +REDV3LSH86$,QF+REDV3LSH 1RQ3UHVVXUH $670''   )LEHUJODVV3LSH )53 $PHURQ %RQGVWUDQG53033LSH $670''  *ODVV)LEHU5HLQIRUFHG3RO\PHU3LSH )53 7KRPSVRQ3LSH*URXS 7KRPSVRQ3LSH )ORZWLWH $670''  3RO\PHU0RGLILHG&RQFUHWH3LSH $PLWHFK86$ 0H\HU3RO\FUHWH3LSH $670&$) WR&ODVV9  ( 5HLQIRUFHG3RO\PHU&RQFUHWH3LSH 86&RPSRVLWH3LSH 5HLQIRUFHG3RO\PHU&RQFUHWH3LSH $670& 6HZHU3LSHV+'3(  +LJKGHQVLW\SRO\HWK\OHQHSLSH 3KLOOLSV'ULVFRSLSH,QF 2SWLFRUH'XFWLOH3RO\HWK\OHQH3LSH $670'  +LJKGHQVLW\SRO\HWK\OHQHSLSH 3OH[FR,QF $670'  +LJKGHQVLW\SRO\HWK\OHQHSLSH 3ROO\3LSH,QF $670'  +LJKGHQVLW\SRO\HWK\OHQHSLSH &65+\GUR&RQGXLW3LSHOLQH6\VWHPV 0F&RQQHOO3LSH(QODUJHPHQW $670' 6HZHU3LSHV39& 3UHVVXUH6HZHU     '539&3UHVVXUH3LSH 3LSHOLIH-HWVWUHDP 39&3UHVVXUH3LSH $::$& WKUX   '539&3UHVVXUH3LSH 5R\DO%XLOGLQJ3URGXFWV 5R\DO6HDO39&3UHVVXUH3LSH $::$& WKUX Ύ&ƌŽŵKƌŝŐŝŶĂů^ƚĂŶĚĂƌĚWƌŽĚƵĐƚƐ>ŝƐƚ Ϯ $SSURYDO 6SHF1R &ODVVVLILFDWLRQ 0DQXIDFWXUHU 0RGHO1R 1DWLRQDO6SHF 6L]H &,7<2))257:257+ :$7(5'(3$570(17 67$1'$5'352'8&7/,67 ‘–‡ǣŽŽ™ƒ–‡”‘”•‡™‡”’‹’‡Žƒ”‰‡”–Šƒͳͷ‹…Š†‹ƒ‡–‡”•ŠƒŽŽ„‡ƒ’’”‘˜‡†ˆ‘”—•‡„›–Š‡ƒ–‡”‡’ƒ”–‡–‘ƒ’”‘Œ‡…–•’‡…‹ˆ‹…„ƒ•‹•Ǥ’‡…‹ƒŽ„‡††‹‰ƒ›„‡”‡“—‹”‡†ˆ‘”•‘‡’‹’‡•Ǥ 8SGDWHG  6HZHU3LSHV39&    39&6HZHU3LSH -00DQXIDFWXULQJ&R,QF -0(DJOH 6'5 $670'    39&6HZHU3LSH 'LDPRQG3ODVWLFV&RUSRUDWLRQ 6'5$670'WKUX  39&6HZHU3LSH /DPVRQ9\ORQ3LSH $670) WKUX   39&6HZHU3LSH 9LQ\OWHFK39&3LSH *UDYLW\6HZHU $670' WKUX   39&6HZHU3LSH 'LDPRQG3ODVWLFV&RUSRUDWLRQ 6*UDYLW\6HZHU3LSH $670) WR  39&6HZHU3LSH -00DQXIDFWXULQJ&R,QF -0(DJOH 6'536 $670)    39&6HZHU3LSH 3LSHOLIH-HW6WUHDP 6'5DQG6'5 $670)  39&6ROLG:DOO3LSH 'LDPRQG3ODVWLFV&RUSRUDWLRQ 6'536 $670) WR 39&6HZHU)LWWLQJV +DUFR 6'5DQG6'5*DVNHW)LWWLQJV $670''HWF  39&6HZHU)LWWLQJV 3ODVWLF7UHQGV,QF :HVWODNH *DVNHWHG39&6HZHU0DLQ)LWWLQJV $670'   39&6HZHU3LSH 3LSHOLIH-HW6WUHDP 6'5 $670)    39&6HZHU3LSH 3LSHOLIH-HW6WUHDP 6'5 $670'    *DVNHWHG)LWWLQJV 39& *3.3URGXFWV,QF 6'5 $670')    39&6HZHU3LSH 1$3&2 :HVWODNH 6'5 $670'   39&6HZHU3LSH 6DQGHUVRQ3LSH&RUS 6'5 $670'    39&6HZHU3LSH 1$3&2 :HVWODNH 6'536 $670)  6HZHU3LSHV5HKDE&,33  &XUHGLQ3ODFH3LSH ,QVLWXIRUP7H[DUN,QF $670)  &XUHGLQ3ODFH3LSH 1DWLRQDO(QYLURWHFK*URXS 1DWLRQDO/LQHU 63/ ,WHP $670)'  &XUHGLQ3ODFH3LSH 5H\QROGV,QF,QOLQHU7HFKQROJ\ ,QOLQHU86$ ,QOLQHU7HFKQRORJ\ $670) 6HZHU3LSHV5HKDE)ROG )RUP )ROGDQG)RUP3LSH &XOOXP3LSH6\VWHPV,QF  )ROGDQG)RUP3LSH ,QVLWXIRUP7HFKQRORJLHV,QF ,QVLWXIRUP1X3,SH $670) )ROGDQG)RUP3LSH $PHULFDQ3LSH 3ODVWLFV,QF'HPR3XUSRVH2QO\  )ROGDQG)RUP3LSH 8OWUDOLQHU 8OWUDOLQHU39&$OOR\3LSHOLQHU $670)  )ROGDQG)RUP3LSH 0LOOHU3LSHOLQH&RUS (;0HWKRG $670)) 8SWRGLDPHWHU 6HZHU3LSHV2SHQ3URILOH/DUJH'LDPHWHU  ( 39&6HZHU3LSH5LEEHG /DPVRQ9\ORQ3LSH &DUORQ9\ORQ+&&ORVHG3URILOH3LSH $670) WR  ( 39&6HZHU3LSH5LEEHG ([WUXVLRQ7HFKQRORJLHV,QF 8OWUD5LE2SHQ3URILOH6HZHU3LSH $670) WR ( 39&6HZHU3LSH5LEEHG 8SRQRU(7,&RPSDQ\  ( 3RO\SURS\OHQH 33 6HZHU3LSH'RXEOH:DOO $GYDQFHG'UDLQDJH6\VWHPV $'6 6DQL7LWH+3'RXEOH:DOO &RUUXJDWHG $670)   ( 3RO\SURS\OHQH 33 6HZHU3LSH7ULSOH:DOO $GYDQFHG'UDLQDJH6\VWHPV $'6 6DQL7LWH+37ULSOH:DOO3LSH $670) WR  6WHHO5HLQIRUFHG3RO\HWK\OHQH3LSH &RQ7HFK&RQVWUXFWLRQ3URGXFWV 'XUPD[[ $670) WR :DWHU$SSXUWHQDQFHV    'RXEOH6WUDS6DGGOH 5RPDF 161\ORQ&RDWHG $::$& 69&XSWR3LSH  'RXEOH6WUDS6DGGOH 6PLWK%ODLU 1\ORQ&RDWHG'RXEOH6WUDS6DGGOH   'RXEOH6WUDS6HUYLFH6DGGOH 0XHOOHU&RPSDQ\ '56'RXEOH 66 6WUDS',6DGGOH $::$& 69&XSWR3LSH  &XUE6WRSV%DOO0HWHU9DOYHV 0F'RQDOG 007 07 DQG  &XUE6WRSV%DOO0HWHU9DOYHV 0F'RQDOG %%070DQG0 òDQG   &XUE6WRSV%DOO0HWHU9DOYHV )RUG0HWHU%R[&R,QF )%1/)%1/)9:1/ /1/ $::$&    &XUE6WRSV%DOO0HWHU9DOYHV )RUG0HWHU%R[&R,QF )%1/)%1/)9: 1//1/ $::$&    &XUE6WRSV%DOO0HWHU9DOYHV )RUG0HWHU%R[&R,QF )%1/)%1/%:5 1/%:51//1/ $::$&    &XUE6WRSV%DOO0HWHU9DOYHV 0XHOOHU&R/WG %1%1%1+ 1+1+1 $::$&$16) $16,16)    &XUE6WRSV%DOO0HWHU9DOYHV 0XHOOHU&R/WG %1%1%1+ 1+1+1 $::$&$16) $16,16)    &XUE6WRSV%DOO0HWHU9DOYHV 0XHOOHU&R/WG %1%1+1+ 1 $::$&$16) $16,16)   &RDWHG7DSSLQJ6DGGOHZLWK'RXEOH666WUDSV -&0,QGXVWULHV,QF 'RXEOH%DQG666DGGOH 7DSVRQXSWR   7DSSLQJ6OHHYH &RDWHG6WHHO -&0,QGXVWULHV,QF 7DSSLQJ6OHHYH(66 $::$& 8SWRZ2XW   7DSSLQJ6OHHYH &RDWHGRU6WDLQOHVV6WHHO -&0,QGXVWULHV,QF 7DSSLQJ6OHHYH $::$& &RQFUHWH3LSH2QO\  7DSSLQJ6OHHYH 6WDLQOHVV6WHHO 3RZHUVHDO $6 )ODQJH  0- DQG   7DSSLQJ6OHHYH &RDWHG6WHHO 5RPDF )76 $::$& 8SWRZ2XW   7DSSLQJ6OHHYH 6WDLQOHVV6WHHO 5RPDF 6676WDLQOHVV6WHHO $::$& 8SWRZ2XW   7DSSLQJ6OHHYH 6WDLQOHVV6WHHO 5RPDF 667,,,6WDLQOHVV6WHHO $::$& 8SWRZ2XW  -RLQW5HSDLU&ODPS 3RZHUVHDO %HOO-RLQW5HSDLU&ODPS WR 3ODVWLF0HWHU%R[Z&RPSRVLWH/LG '):3ODVWLFV,QF '):&(3$))7: 3ODVWLF0HWHU%R[Z&RPSRVLWH/LG '):3ODVWLFV,QF '):&(3$))7:  3ODVWLF0HWHU%R[Z&RPSRVLWH/LG '):3ODVWLFV,QF '):&(3$))7: &ODVV$ &RQFUHWH0HWHU%R[ %DVV +D\V &0%%/,' &RQFUHWH0HWHU%R[ %DVV +D\V &0%'XDO/,' &RQFUHWH0HWHU%R[ %DVV +D\V &0%%/,' :DWHU%ROWV1XWVDQG*DVNHWV  Ύ&ƌŽŵKƌŝŐŝŶĂů^ƚĂŶĚĂƌĚWƌŽĚƵĐƚƐ>ŝƐƚ ϯ $SSURYDO 6SHF1R &ODVVVLILFDWLRQ 0DQXIDFWXUHU 0RGHO1R 1DWLRQDO6SHF 6L]H &,7<2))257:257+ :$7(5'(3$570(17 67$1'$5'352'8&7/,67 ‘–‡ǣŽŽ™ƒ–‡”‘”•‡™‡”’‹’‡Žƒ”‰‡”–Šƒͳͷ‹…Š†‹ƒ‡–‡”•ŠƒŽŽ„‡ƒ’’”‘˜‡†ˆ‘”—•‡„›–Š‡ƒ–‡”‡’ƒ”–‡–‘ƒ’”‘Œ‡…–•’‡…‹ˆ‹…„ƒ•‹•Ǥ’‡…‹ƒŽ„‡††‹‰ƒ›„‡”‡“—‹”‡†ˆ‘”•‘‡’‹’‡•Ǥ 8SGDWHG  :DWHU&RPELQDWLRQ$LU5HOHDVH  ( &RPELQDWLRQ$LU5HOHDVH9DOYH *$,QGXVWULHV,QF (PSLUH$LUDQG9DFXXP9DOYH0RGHO $670$&ODVV%$670$ IORDW$670$&RYHU %ROWV   ( &RPELQDWLRQ$LU5HOHDVH9DOYH 0XOWLSOH[0DQXIDFWXULQJ&R &ULVSLQ$LUDQG9DFXXP9DOYHV0RGHO1R  ( &RPELQDWLRQ$LU5HOHDVH9DOYH 9DOYHDQG3ULPHU&RUS $3&2&&DQG&   :DWHU'U\%DUUHO)LUH+\GUDQWV   ( 'U\%DUUHO)LUH+\GUDQW $PHULFDQ'DUOLQJ9DOYH 'UDZLQJ1RV $::$&  ( 'U\%DUUHO)LUH+\GUDQW $PHULFDQ'DUOLQJ9DOYH 6KRS'UDZLQJ1R $::$&  ( 'U\%DUUHO)LUH+\GUDQW &ORZ&RUSRUDWLRQ 6KRS'UDZLQJ1R' $::$&  ( 'U\%DUUHO)LUH+\GUDQW $PHULFDQ$9.&RPSDQ\ 0RGHO $::$&  ( 'U\%DUUHO)LUH+\GUDQW &ORZ&RUSRUDWLRQ 'UDZLQJV''% $::$& ( 'U\%DUUHO)LUH+\GUDQW ,77.HQQHG\9DOYH 6KRS'UDZLQJ1R'): $::$&  ( 'U\%DUUHO)LUH+\GUDQW 0 +9DOYH&RPSDQ\ 6KRS'UDZLQJ1R $::$&  ( 'U\%DUUHO)LUH+\GUDQW 0XHOOHU&RPSDQ\ 6KRS'UDZLQJV1R $&HQWXULRQ $::$&  ( 'U\%DUUHO)LUH+\GUDQW 0XHOOHU&RPSDQ\ 6KRS'UDZLQJ)+ $6XSHU&HQWXULRQ $::$&  ( 'U\%DUUHO)LUH+\GUDQW 863LSH )RXQGU\ 6KRS'UDZLQJ1R $::$&  ( 'U\%DUUHO)LUH+\GUDQW :DWHURXV&RPSDQ\ 6KRS'UDZLQJ1R6. $::$&   'U\%DUUHO)LUH+\GUDQW (- (DVW-RUGDQ,URQ:RUNV :DWHU0DVWHU&' :DWHU0HWHUV  ( 'HWHFWRU&KHFN0HWHU $PHV&RPSDQ\ 0RGHO'HWHFWRU&KHFN9DOYH $::$&   0DJQHWLF'ULYH9HUWLFDO7XUELQH +HUVH\ 0DJQHWLF'ULYH9HUWLFDO $::$&&ODVV  :DWHU3LSHV39& 3UHVVXUH:DWHU     39&3UHVVXUH3LSH 9LQ\OWHFK39&3LSH '5 $::$&$::$& $670'    39&3UHVVXUH3LSH 3LSHOLIH-HW6WUHDP '5 $::$&    39&3UHVVXUH3LSH 3LSHOLIH-HW6WUHDP '5 $::$&    39&3UHVVXUH3LSH 'LDPRQG3ODVWLFV&RUSRUDWLRQ '5 $::$&    39&3UHVVXUH3LSH 'LDPRQG3ODVWLFV&RUSRUDWLRQ '5 $::$&    39&3UHVVXUH3LSH -00DQXIDFWXULQJ&R,QFGED-0(DJOH '5 $::$& 8/ $16,16) )0    39&3UHVVXUH3LSH -00DQXIDFWXULQJ&R,QFGED-0(DJOH '5 $::$& 8/ $16,16) )0    39&3UHVVXUH3LSH 8QGHUJURXQG6ROXWLRQV,QF '5)XVLEOH39& $::$&    39&3UHVVXUH3LSH 1$3&2 :HVWODNH '5 $::$&    39&3UHVVXUH3LSH 1$3&2 :HVWODNH '5 $::$&    39&3UHVVXUH3LSH 6DQGHUVRQ3LSH&RUS '5 $::$&  :DWHU3LSHV9DOYHV )LWWLQJV'XFWLOH,URQ)LWWLQJV   ( 'XFWLOH,URQ)LWWLQJV 6WDU3LSH3URGXFWV,QF 0HFKDQLFDO-RLQW)LWWLQJV $::$& & ( 'XFWLOH,URQ)LWWLQJV *ULIILQ3LSH3URGXFWV&R 0HFKDQLFDO-RLQW)LWWLQJV $::$& ( 'XFWLOH,URQ)LWWLQJV 0F:DQH7\OHU3LSH8QLRQ8WLOLWLHV'LYLVLRQ 0HFKDQLFDO-RLQW)LWWLQJV66%&ODVV$::$&&&  ( 'XFWLOH,URQ)LWWLQJV 6LJPD&R 0HFKDQLFDO-RLQW)LWWLQJV66%&ODVV$::$&&&  ( 0-)LWWLQJV $FFXFDVW &ODVV&0-)LWWLQJV $::$&   ( 'XFWLOH,URQ-RLQW5HVWUDLQWV )RUG0HWHU%R[&R8QL)ODQJH 8QL)ODQJH6HULHV$::$&& WR  ( 39&-RLQW5HVWUDLQWV )RUG0HWHU%R[&R8QL)ODQJH 8QL)ODQJH6HULHV&LUFOH/RFN $::$&& WR  ( 'XFWLOH,URQ-RLQW5HVWUDLQWV 2QH%ROW,QF 2QH%ROW5HVWUDLQHG-RLQW)LWWLQJ $::$&&& WR   'XFWLOH,URQ3LSH0HFKDQLFDO-RLQW5HVWUDLQW (%$$,URQ,QF0HJDOXJ6HULHV IRU',3LSH $::$&&& WR   39&3LSH0HFKDQLFDO-RLQW5HVWUDLQW (%$$,URQ,QF0HJDOXJ6HULHV IRU39&3LSH $::$&&& WR  ( 0HFKDQLFDO-RLQW5HWDLQHU*ODQGV 39& 6LJPD&R 6LJPD2QH/RN6/&6/&$::$&& WR   0HFKDQLFDO-RLQW5HWDLQHU*ODQGV 39& 6LJPD&R 6LJPD2QH/RN6/&66/&6$::$&& WR  ( 0HFKDQLFDO-RLQW5HWDLQHU*ODQGV 39& 6LJPD&R 6LJPD2QH/RN6/&($::$&& WR  ( 0-)LWWLQJV ',3 6LJPD&R 6LJPD2QH/RN6/'($::$&   ( ,QWHULRU5HVWUDLQHG-RLQW6\VWHP 6 %7HFKQFLDO3URGXFWV %XOOGRJ6\VWHP 'LDPRQG/RN -0$670) WR  ( 0HFKDQLFDO-RLQW)LWWLQJV 6,3,QGXVWULHV 6HUDPSRUH 0HFKDQLFDO-RLQW)LWWLQJV $::$& WR   0HFKDQLFDO-RLQW5HWDLQHU*ODQGV 6WDU3LSH3URGXFWV,QF39&6WDUJULS6HULHV$670$$::$&   0HFKDQLFDO-RLQW5HWDLQHU*ODQGV 6WDU3LSH3URGXFWV,QF',36WDUJULS6HULHV$670$$::$&   0HFKDQLFDO-RLQW5HWDLQHU*ODQGV 6,3,QGXVWULHV 6HUDPSRUH (=*ULS-RLQW5HVWUDLQW (=' %ODFN)RU',3 $670$$::$&    0HFKDQLFDO-RLQW5HWDLQHU*ODQGV 6,3,QGXVWULHV 6HUDPSRUH (=*ULS-RLQW5HVWUDLQW (=' 5HGIRU& '539&3LSH $670$$::$&    0HFKDQLFDO-RLQW5HWDLQHU*ODQGV 6,3,QGXVWULHV 6HUDPSRUH (=*ULS-RLQW5HVWUDLQW (=' 5HGIRU& '539&3LSH $670$$::$&  Ύ&ƌŽŵKƌŝŐŝŶĂů^ƚĂŶĚĂƌĚWƌŽĚƵĐƚƐ>ŝƐƚ ϰ $SSURYDO 6SHF1R &ODVVVLILFDWLRQ 0DQXIDFWXUHU 0RGHO1R 1DWLRQDO6SHF 6L]H &,7<2))257:257+ :$7(5'(3$570(17 67$1'$5'352'8&7/,67 ‘–‡ǣŽŽ™ƒ–‡”‘”•‡™‡”’‹’‡Žƒ”‰‡”–Šƒͳͷ‹…Š†‹ƒ‡–‡”•ŠƒŽŽ„‡ƒ’’”‘˜‡†ˆ‘”—•‡„›–Š‡ƒ–‡”‡’ƒ”–‡–‘ƒ’”‘Œ‡…–•’‡…‹ˆ‹…„ƒ•‹•Ǥ’‡…‹ƒŽ„‡††‹‰ƒ›„‡”‡“—‹”‡†ˆ‘”•‘‡’‹’‡•Ǥ 8SGDWHG  :DWHU3LSHV9DOYHV )LWWLQJV5HVLOLHQW6HDWHG*DWH9DOYH   5HVLOLHQW:HGJHG*DWH9DOYHZQR*HDUV $PHULFDQ)ORZ&RQWURO 6HULHV'UDZLQJ   5HVLOLHQW:HGJH*DWH9DOYH $PHULFDQ)ORZ&RQWURO 6HULHVDQG6HULHV $::$& DQG  5HVLOLHQW:HGJH*DWH9DOYH $PHULFDQ)ORZ&RQWURO 6HULHV  6' $::$& DQG  5HVLOLHQW:HGJH*DWH9DOYH $PHULFDQ)ORZ&RQWURO 6HULHV 6' $::$&   ( 5HVLOLHQW:HGJH*DWH9DOYH $PHULFDQ)ORZ&RQWURO 6HULHV 'XFWLOH,URQ $::$& WR  5HVLOLHQW:HGJH*DWH9DOYH $PHULFDQ)ORZ&RQWURO DQG$)& $::$& DQG  ( 5HVLOLHQW:HGJH*DWH9DOYH $PHULFDQ$9.&RPSDQ\ $PHULFDQ$9.5HVLOLHQW6HDGHG*9 $::$& WR  ( 5HVLOLHQW:HGJH*DWH9DOYH $PHULFDQ$9.&RPSDQ\DQGVPDOOHU ( 5HVLOLHQW6HDWHG*DWH9DOYH .HQQHG\ ( 5HVLOLHQW6HDWHG*DWH9DOYH 0 + ( 5HVLOLHQW6HDWHG*DWH9DOYH 0XHOOHU&R  5HVLOLHQW:HGJH*DWH9DOYH 0XHOOHU&R 6HULHV$ 6' $::$&   5HVLOLHQW:HGJH*DWH9DOYH 0XHOOHU&R 6HULHV$IRU 6' $::$& DQGVPDOOHU  5HVLOLHQW:HGJH*DWH9DOYH 0XHOOHU&R 0XHOOHU & $::$& DQG  5HVLOLHQW:HGJH*DWH9DOYH 0XHOOHU&R 0XHOOHU & $::$& DQG  ( 5HVLOLHQW:HGJH*DWH9DOYH &ORZ9DOYH&R $::$&   5HVLOLHQW:HGJH*DWH9DOYH &ORZ9DOYH&R 56*9 6'' $::$&   ( 5HVLOLHQW:HGJH*DWH9DOYH &ORZ9DOYH&R &ORZ5:9DOYH 6'' $::$& DQGVPDOOHU  5HVLOLHQW:HGJH*DWH9DOYH &ORZ9DOYH&R &ORZ & $::$& DQG 1RWH  5HVLOLHQW:HGJH*DWH9DOYH &ORZ9DOYH&R &ORZ9DOYH0RGHO $::$& WR 1RWH  ( 5HVLOLHQW6HDWHG*DWH9DOYH 6WRFNKDP9DOYHV )LWWLQJV $::$&$16,VWHP $670$7\SH%ROWV  QXWV  ( 5HVLOLHQW6HDWHG*DWH9DOYH 863LSHDQG)RXQGU\&R0HWURVHDOUHTXLUHPHQWV63/WR   5HVLOLHQW6HDWHG*DWH9DOYH (- (DVW-RUGDQ,URQ:RUNV (-)ORZ0DVWHU*DWH9DOYH %R[HV 0DWFR*DWH9DOYH 0DWFR1RUFD 05 $::$$16,&$Q WR :DWHU3LSHV9DOYHV )LWWLQJV5XEEHU6HDWHG%XWWHUIO\9DOYH  ( 5XEEHU6HDWHG%XWWHUIO\9DOYH +HQU\3UDWW&R $::$&  ( 5XEEHU6HDWHG%XWWHUIO\9DOYH 0XHOOHU&R $::$& DQGVPDOOHU  ( 5XEEHU6HDWHG%XWWHUIO\9DOYH 'H]XULN9DOYHV&R $::$& DQGODUJHU  ( 9DOPDWLF$PHULFDQ%XWWHUIO\9DOYH 9DOPDWLF9DOYHDQG0DQXIDFWXULQJ&RUS 9DOPDWLF$PHULFDQ%XWWHUIO\9DOYH $::$& 8SWRGLDPHWHU  ( 5XEEHU6HDWHG%XWWHUIO\9DOYH 0 +9DOYH 0 +6W\OH  $::$& WR   5XEEHU6HDWHG%XWWHUIO\9DOYH *$,QGXVWULHV *ROGHQ$QGHUVRQ $::$&%XWWHUIO\9DOYH $::$&  :DWHU3RO\HWK\OHQH(QFDVHPHQW   ( 3RO\HWK\OHQH(QFDVPHQW )OH[VRO3DFNDJLQJ )XOWRQ(QWHUSULVHV $::$& PLO//'  ( 3RO\HWK\OHQH(QFDVPHQW 0RXQWDLQ6WDWHV3ODVWLFV 063 DQG$(3,QG 6WDQGDUG+DUGZDUH $::$& PLO//'  ( 3RO\HWK\OHQH(QFDVPHQW $(3,QGXVWULHV %XOOVWURQJE\&RZWRZQ%ROW *DVNHW $::$& PLO//'   3RO\HWK\OHQH(QFDVPHQW 1RUWKWRZQ3URGXFWV,QF 3((QFDVHPHQWIRU',3 $::$& PLO//' :DWHU6DPSOLQJ6WDWLRQ  :DWHU6DPSOLQJ6WDWLRQ :DWHU3OXV %:DWHU6DPSOLQJ6WDWLRQ :DWHU$XWRPDWLF)OXVKHU  $XWRPDWHG)OXVKLQJ6\VWHP 0XHOOHU+\GURJXDUG +*$,1%51/355 3RUWDEOH  +*$,139&/3/* 3HUPDQHQW  $XWRPDWHG)OXVKLQJ6\VWHP .XSIHUOH)RXQGU\&RPSDQ\ (FOLSVHZF  $XWRPDWHG)OXVKLQJ6\VWHP .XSIHUOH)RXQGU\&RPSDQ\ (FOLSVH 3RUWDEOH  Ύ&ƌŽŵKƌŝŐŝŶĂů^ƚĂŶĚĂƌĚWƌŽĚƵĐƚƐ>ŝƐƚ ϱ