HomeMy WebLinkAbout063763-A1 - General - Contract - Haltom City Senior Living, L.P. dba Paramore Fossil CreekCSC No. 63763-A1
AMENDMENT ONE TO CITY OI' FORT WORTH CONTRACT NO. 63763
This Contract Amendment is made and entered into by and between the City of Fort Worth ("City")
and HALTOM CITY SENIOR LIVING, L.P. dba PARMORE FOSSIL CR�EK ("Landlord"), each
individually referred to as a"Party" and collectively referred to as the "Parties."
RECITALS
WHEREAS, on JUN� 27, 2025, the City entered into an agreement with the Landlord for
rental assistance for a named tenant, City Secretary Office (CSO) Contract No. 63763 (the
"Agreement");
WHEREAS, ("Tenant") is a participant in the City's rental assistance
program;
WHEREAS, the Initial term of the Agreement was fi•om June 27, 2025, to May 31, 2026,
and allowed for annual renewals upon agreement of the Parties; and
WHEREAS, the Parties wish to amend the Agreement to update the Tenant and City's
rental obligations during the remainder of the initial rental term as outlined in Section 3.2.1; and
NOW THEREFORE, City and Landlord do hereby agree as follows:
AMENDMENTS TO AGREEMENT
The following teims are hereby amended to replace the referenced tei�rns in the Agreement
and shall be binding and enfot•ceable as if they were originally included therein.
1. Section 3.2 and 3.2.2 of the Agreement is hereby deleted in its entirety
and replaced with the following:
3.2 Rent and Amounts Pavable bv Citv
3.2.1 Reitt.
Initial Term:
• The City has been notified that the Tenant's Total Rent during the Initial Term is $1, 408.00
per month for the Unit. From June 27, 2025, to June 30, 2025, the Tenant's prorated rent
is $187.73.
• From June 27, 2025, to June 30, 2025, the Tenant shall be responsible for $187.73 of
prorated rent per month. From July 1, 2025, to July 31, 2025, the Tenant shall be
responsible for $0.00 of rent per month. Beginning August 1, 2025, to May 31, 2026, the
Tenant shall be responsible for $283.00 of rent per month.
• From June 27, 2025, to June 30, 2025, City shall be responsible for $0.00 of prorated rent
per month. From July 1, 2025, to July 31, 2025, the City shall be responsible for $1,408.00
of rent per month. Beginning August 1, 2025, to May 31, 2026, City shall be responsible
for $1,125.00 of rent per month.
CSC No. 63763 AMENDMENT ONE
CoFW and HALTOM CI'I'Y SGNIOR LIVING, L.Y. dba PARMOR� FOSSIL CREEIC
OFFICIAL RECORD
CITY SECRETARY Page 1 of 4
FT. WORTH, TX
Amendment One:
• The City has been notified that the Tenant's Total Rent during the Initial Term is
$1,408.00 per month for the Unit. From June 27, 2025, to June 30, 2025, the Tenant's
prorated rent is $187.73.
• From June 27, 2025, to June 30, 2025, the Tenant shall be responsible for $187.73 of
prorated rent per month. From July 1, 2025, to July 31, 2025, the Tenant shall be
responsible for $0.00 of rent per month. From August 1, 2025, to January 31, 2026,
the Tenant shall be responsible for $283.00 of rent per month. Beginning February 1,
2026, to May 31, 2026, the Tenant shall be responsible for $0.00 of rent per month.
� From June 27, 2025, to June 30, 2025, City shall be responsible for $0.00 of prorated
rent per• month. From July 1, 2025, to July 31, 2025, the City shall be responsible for
$1,408.00 of rent per month. From August 1, 2025, to January 31, 2026, City shall be
responsible for $1,125.00 of rent per month. Beginning February 1, 2026 to May 31,
2026, City shall be responsible for $1,408.00 of rent per month.
II.
All terms and conditions of the Agreement not amended herein remain unaffected and in
full force and effect, are binding on the Parties and are hereby ratified by the Parties.
[SIGNATURE PAGE FOLLOWS]
CSC No. 63763 AMENDMEN"I' ONE Page 2 of 4
CoFW and HALTOM CI'1'Y S�NIOR LIVING, L.Y. dba PARMORE FOSSIL CRGEIt
IN WITNESS WHEREOI', the parties hereto have executed this agreement, to be effective
February 1, 2026.
FOR CITY OF FORT WORTH:
Dc� n�► Bu ��hdo-�-�
Gaiia ouiyiiuuii ��eu io, ��' PSi j
Name: Dana Burghdoff
Title: Assistant City Manager
FOR LANDLORD:
seahe-��-e Burcess
J'i+ r'!n R�ir i�^" iF��„ ? �'1?�� (1��534�CST)
ivame: 3eanette �urgess
Title: Property Managei•
Date:OZ�16/2026
APPROVAL RECOMMENDED
�.c.�,�•� ��4��',�" e
i�a�ey Tlwnias �l=el� 14, �ii� Li.G�.0 i,�T)
Name: Kacey Tllomas
Title: Neighborhood Seivices Director
APPROVED AS TO FORM AND
LEGALITY
SopGcr"� Ma�Gc�w,t
Name: Sophie Mathews
Title: Assistant City Attorney
Date:�2�� ��2�26
ATTEST:
� �-�"
ame: Jannette Goodall
Title: City Secretary
Q.d44ounnIl
P O� FORl�Yaa
c° �� o �o9•i o
tio
PVa o=d
°d�*°�o �°�'
a�db nEXASop
Contract Compliance Manager:
By signing I acicnowledge that I am the
person responsible for the monitoring
and administration of this contract,
including ensuring all performance and
reporting i•equirements.
���' W � � �Z�i /
�
Name: Cyndee Garza
Title: Sr. Human Services Specialist
Date: 02�17/2026
M&C No.: 25-0676
OFFICIAL RECORD
CITY SECRETARY
FT. WORTH, TX
CSC No. 63763 AMENDMENT ONG Page 3 of 4
CoFW and HALTOM CiTY SENIOR LIVING, L.P. dba PARMORG rOSSIL CRLGK
EXHIBIT A
History of Rental Obligations by Lease Term
Lease
Term
Initial Tetm
Total Rent
Tenant's Portion
City's Portion
Pi•orated Rent fi•om June 27, 2025
to June 30, 2025:
$187.73
July 1, 2025 to May 31, 2026
$1,408.00
Amendment Prorated Rent fi•om June 27, 2025
One to June 30, 2025:
$187.73
July 1, 2025 to May 31, 2026:
$1,408.00
From June 27, 2025 to
June 30, 2025:
$187.73
From July 1, 2025 to July
31, 2025
$0.00
From August 1, 2025 -
May 31, 2026
$283.00
From June 27, 2025 to
June 30, 2025:
$187.73
From July 1, 2025 to July
31, 2025:
$0.00
From August 1, 2025 -
Januaiy 31, 2026:
$283.00
From February 1, 2026 -
May 31, 2026:
$0.00
From June 27, 2025 to June 30,
2025:
$0.00
From July 1, 2025 to July 31, 2025
$1,408.00
From August 1, 2025 - May 31,
2026
$1,125.00
From June 27, 2025 to June 30,
2025:
$187.73
From July 1, 2025 to July 31, 2025:
$1,408.00
From August 1, 2025 - Januaiy 31,
2026:
$1,125.00
From February 1, 2026 - May 31,
2026:
$1,408.00
CSC No. 63763 AMENDMENT ONE Page 4 of 4
CoFW and HALTOM CITY SENIOR LIVING, L.P. dba PARMORG rOSSIL CREEIC
� �
�� a� `bi �'�/'�:j�)
�n; �,�ti ,�evrra i r•.�� r ,�.ytic>r.i,r ru ��
� �
i
Tiils Lense Js valld onlyfffilled out Ge(orelanuary t, 202G.
Apartment Lease Cantract
This is a binding contract Read carefully before signing.
Tliis LeaseContract ("Lease") is betweenyou, the resitient(s) as Ifsted below a�d us.7he tertns"you" and "your" refer to alf residents.
The terms " refe� to the ow�er (isted helow.
PARTIES
Restdents Ji.mmy Reyna
OWner Haltom Citv Senior I,ivina LP
Occupants
LEASE DETAllS
i
Ends at 11:59 p.m. on: ���'
.� � '9F17_Io
C.MonthlyBaseRenttPar.3) E,SecurilyDeposit�Par.5) f.NoNceofTerminattonorintenttoMoveOut(Par.41
$ 1906.00 5 500.00 Aminlmumof 60 days'writtennoliceof
terminadon or Intent to move out required at end of initfal lease
term orduring renewal period
Nofe that thFs amount does nof
D.ProratedRent indudeanyAn/malDeposif,whlch Iftheoum6erofdaysfsn'tfilledin,noNceo(ntlenst3odays
��3 1SG�,"�� wouldberellectedlnnnAnfmal lsrequired.
S � Addendum.
qi due forthe remalnderof lst
monthor n /
D for z�d moMh � P�y
�
G. Late Pe¢s (Par.33)
Initfal Late Pee Daily Late Feo
� 10 SooEonemonth'smonlh{ybaserentor O � 9nofonemonth'smonthlybaserentfor daysor
� 5 ❑$ 0. 00 tor „ days
pnelFtentunpaldby11:59p.m.onlhe 3rd (3rdorgteater)dayofthemonlli
H.ReturttedChecknrRejected f.EarlyTerminationFeeOpifon(Par,7.2)
PaymentFee�Par.3.4) $
$ 75. 00 Notice of 60 days Is required.
You are not elfgt6le for eRrty ten»inatfon if
I.Retett)nyCharge�Par,7.1) Y����retndefnult.
Arelettfn char eof$1213.80 Feemust6epaldnolaterthan 14
9 9 days afleryou give us notice
(noltoexceed859no(theldghest �fanyvaluesornumGe�oldaysa�eblankor"0,'
monthlyReatduringtheLcaseterm) fbenthissediondoesnotnpply.
may be chasged tn certain detault
situations
K. Violatioo Charges
llnimal Vlolatlon iPar.12.2)
Initialchargeof$ �00,00 peranlmalp�ot
to excced $100 peranimap and
Adailychargeaf$ 10.00 peraoimal
(not to exceed $t0 per day per anlmal}
Insurance Violation (Master Lease Addeadum
orothersepasateaddendum)
S
i..AdditionalRent-MonthlyRecurringFixedCharges. YouvrlllpayseparatelytortheseitemsasoutlineAbelowand/orinseparateaddenda,
Spedal Provislons or an amendment to thls Lease.
Mimalrent S 20.00 Cabtelsatellile $ Internet $
Package servire $ Pest control $ Stormwateddralnage $
Trashservice $ WasherlOryer S
Other S
Other: S
Olher. 5
Other. $
M. U tilities and Other Varlabte Chacges. You �vq! pay sepacate�y (or gas, water, wastev�ater, efedrfclty, trash/recyding, utitiry bitling fees and other
Items as out4ined In sepatate addenda, Special Provls(ons or an amendment to Ihfs Lease.
UtiiityConneclionChargeorTransferPec$ 50.00 (nottoexceed$50)lobepaidwithin5dayso(wrtttennoQre(Par.3,5)
N. Other Charc�es and Reqidrements, You will pay separately for these items or comply wllh these requirements as outlfned in a Master Lease
Addendum, separate addenda or Speciai Provisions. Initial Access Device: S
AclditlonalorReplacementAccessDevlees:$ RequiredtnsuranceL4abilityLtmlt{perocuirrence):S
Special Pravisions. See Pat 32 or additional addenda attaciied. This lease cannot be changed unless le wr{ting and signed by you and us.
Apapment Lea se Conhaci P2023, Trxac ApatlmeN Assodailon, Inr. Pagc f of 6
i1�� .ii1.�n .�a:,5:hii�:����^.4t��r.��4�.��'d:,1 1�Jl4�iLkdS�a�'i_ +aYY�
1 f Definitlons.The following Ierrns arc commomy uted in Ih6 Lease:
t.t. "Ilnsfdenls"arethosclisled�n'Resldcnts'abovetvhosign
this lease and a�e avthorized lo live In thc apaitment.
1.2. 'bccupanls"uethosellsledlnihlsleasewhouealsoaulho-
�ized lo live in ihe apartmenl, bul who do not slgn thl: Leose.
1.3. "O�vner"maybcldcntlfiedbyanassumednameandisthe
owner only and nol properly managcrs or anyone clsc.
1.A. "Induding"inlhisLeasemcans'IncladingbulnoUlmlle�ilo'
1.5. "CommunilyPolicies"arelhevrtitlenaparlmentrulesand
policics, Including property 519na9c and Inslruclions for
care of our propc rly and ameniUcs, wllh rihfch you, your
occupanis, and you� guesls must comply.
1.6. "Rent"Ismonlhlybaserenlplus.ddillonalmonihly
�ecu�dng fized charges.
1J. "Lcasc'Includeslblsdoamenl,anyaddendaanJ
atlachments, Communiry Pollcies and Speclal Provislons.
2. Aparlmont.Youareleasinglheaparlmenllliledabove(oruseasa
piivale residence only.
1.1. Access,Inaccordancewiththislease,yo�ill�eceiveaccess
InformaUon or devlces (o� your apartment and mall6oz, and
otheraccessdevlceslnciudln9:Apt Kov, Mailhox
Hey Fob, hccesa card: 1 uer lease
holt�er
2.2. Measuremenls.Anydlmenslonsancisizesptovidedtoyou 6.
rclating lo Ihc apartment aic only approximallons or
estimates; aclual dimenslons and sizes may vary.
2,3. Reprosenlatlons,Youa9reelhaldesl9natlonsoracc�edl-
latlons assodated wllh the properly are sub�ect to change.
. Rnnt.YoumustpayyourRentonor6alorefhelstdayo/eac1�
moNh (due dafeJ �vifhout demand. There are no excepflons
regarding Ihe pnyment olRenf, nndyou ngree notpnying Renf on
oi be/ore fhe is t o(eacb monfh !s a moterinl Lrenth o/fhls Leose.
3.1, Payments.YouwlllpayyourRentbyanymethod,manner �'
and place we specify In accordance wlth ihis Lease.
Cash is naf accepin4/a vltliout ourprlor writfen
pennlsslon. Youcannotwlth6olAoro/fsetRentunlets
authorized 4y/arv. We may, at our opllon, requlrc at any
Iime lhat you pay pent and other sums duc In one stngle
payment by any method �•re specify.
3.2. ApplicationoFPaymunts.Paymento(eachsumdueisan
�ndependent covenant, which means payments are due
re9a�dlessofourperformance. Whenwerccetvemoney,
other Ihan �valer and wasle�vater payments su6)ect to
govemment regulalion, we may apply It at our oplion and
tvlthout noUce first to any of your unpald oblfgallons, then
to accrued rent. We may do so regardless o( notations on
checks or mon¢y orders and regardless ot tvhen lhe
oblfgationz arose. All sums olhcr than Rent and late (ees are
due upon ourdemand. After the due date, ��re do not have
to atcept any paymenls.
3.3. lale Feet, If vre don't receivc your monthly ba:e rent In full
�vhen It's due, you must paylate fees as oul0ned in Leasc Delails.
3.A. RvturnedPaymentFee.You'llpaythefeellstedinLease
Details (oreach returned checkor reJecled eledwnic
Autmwtic Leaso Rene�val an4 Notice ol Termination� Thlt Lease
wfll aulomallcally reneei monih�to-monlh unless ellhcr party gives
writlen noUce ol teimination or InteN to movc out as required by Par.
25 and specified on paqe 1,1/the mm�6er otAays fsn't filledin, no-
17cc o/af Ims 130 dnyi Is requlred.
Secudly Doposit. Thc total security Jeposll tor all �esidents Is duc
on or befoie the date Ihls Lease Is signcd. Any animal deposlt wlll be
deslpnaled In an animal addendum.5ecurity deposits may nol be ap-
pIIcA to flent vdthout our pdor eirillen consent.
5.1. flefundsandDedudlons.You�jurtaivcusvqurndva cc
nnUcnolmoveoulazprovldc�l�Pac? Sa�dforwar nn
addresslnwriUnotorocolve e�{Ittendestrin o
zed Isto dren,esorre�uod.lnnrcadnnceuithfblr
Lease anA ns ollowe�6ylai ; ve ntny dedu[I lrom your
securtfy Aeposlt nny nmounfs due under thls tcasc.l /vou
moveoutem�yorGnetaonsetoanofcefq vnmfe.vou7jJie
11n61e /ar rckevina charaes. Upon rece pt of your move•out
datc and lonvarding address in �wilinp,lhe security deposit
wfl� 6c relumed (Iess lawful deducUons) �vith an IlcmimJ
accounling o( any deduclions, no late� Ihan 30 days a(ler
suirendcr or abandonment, unless laws provlde otherv+ise.
Any refund may be by ane paymen[ Jolnlly payablc to all
residents and dlstribu�ed lo any one resldent �vc thoose,
or dlstri6uted equalty amonq all resldents.
lasumnca �uAnsurnnce dorsn't tover the loss o/ordamnge lo
yaur yerronnl properfy. You will be requlred Io havc ilabllily Insur-
ance as spedficJ In thls lcusc unless othenvlse prohlbiled by Iaw.lf
you have Insurance covciing thc apartment o� your peisonal betong-
Ings at the Iime you or we suffer or allege a loss, you a9rec lo requlre
your Insurance canier to waive any Insurance sub�ogallon ri9hts.
Even If not tequlred, we urge you ta obtain your o�vn Insurance for
losses due to thef4 fi�e, Ilood, water, plpe leaks anJ slmliar occuirenc-
¢s. Mosl renler's insuronce pollcles don't cover losses due to a Ilood.
Relelting and Ea�ly Lease Terminatlon. Thls Lease may nol be ter-
minated eaily ezcept as provlded in this Lease.
7d. RelalqngCharge.You'llbellable(orare1e11ingcha�gcas
Ilsted In Leate Details, (not to exceed 8596 ot the highes!
monlhly Rent duiing the Lease tcrm) if you: (A) tail lo move try
or fall lo glve wdlten movc-out notice as requlred in Pac 2g
(8) move out eiithout paying Rent In full for Ihe entire Lease
tc�m or rener�al period; (C) move ou[ at om dema nd becaute
of your de(aull; or (D) are Judlclally evicled. The relelUng
chaige Is nol a lerminatlon, cancellation or buyout fee and
does not rcleasc you from your obligations under this Lease,
Including Ilability for future ot pas4due Rent, char9es for
damages or other sums due.
The relet�in9 charge ts a Iiquldated amount covering only
part o( our damages—for our lime, eHort, and ¢xpense In
finding and processing a replacement resldent. These
damages ere uncerlain and hard lo asceHain—particulady
those retating to Inconvenience, papenvork, advertising,
shovAng aparlments, utllitles for shmving, checking prot-
pects, overhead, markeling costs, and localor•service fees.
You agree that Ihe relctlin9 chorge Is a reasonable eslimate
of our damages and ihat the charge Is due vrhether or not our
relet8ng att¢mpls succeed.
�-.•••-••��.•-•••••�•-•-��---••,•-•-•--•••-rr��---�•�-��•�� 7,2, EarlyL¢aseTerminationOptionProcedure.lnadditionto
we receive full payment in an acceptable method, your terminalion itghts reterced to in Z3 or 6.7 below, If this
3.5. UtIIItlesand5ervices.You'llpay(orallullll�iesandservices, provulonappllesunderLeaseDetalis,youmayop[to
relateddeposits,andanychar�esortecswhenlheyaredue te�minatethlsLeasepriortotheendoftheleasetermt/nllo/
andasoutlinedinthisLease.Televislonchanneislhatare the/ollo�vingocnu: (a)asoulllnedlnLeaseDelails,yougive
providedmay6ed�angedduiinptheLeasetermlfthe userrittennollceoteadytcrmination,paytheEarlyTermina-
change applles to all residenLs. tlon Option fee In (uil and speclfy Ihe date by eihlch you'11
Ifyourelectricilyisinlermpted,youmustuseonlybaltery• moveout;�b)youarenotinde(aultatanyUmeanddonot
operaled119hling(no0ames).Youmustnotalloriany holdover,and(c)yautepayallrentmnresslont,creditsor
utililies �olher Ihan cable or Inlernet) to be cul o(f or discounts you recelved during Ihe Lease Ierm.l( you are In
sr+itchedforanyreason—Includingdisconneclion(ornot default,IheLeaseremedlesapply,
pay(ngyourbllis—unllllheLeasetcrmorrene�valperlod 7,;, SpeclalTerminationRlghls.Youmayhnvefhe�lghtunder
ends.lFautilityislndlvidualtymetered,itmustbeconnected Texns/mvtoterminntethlsteaseearly(ncertafns!lunNoni
inyournameandyoumustnoti(ylheproviderofyourmove• brvolvingmil(tarydeploymentorlrm�sfer,fomllyviolence,
outdate.Ifyoudelaygetlingserviceturnedonlnyourname certalnsexunlo(fenses,sfalkingordenfho/atoleretldenf.
bylhlsLease'sstartdateorcauseiltobetransferredbacklnto 8. De�ayofOccupancy.Wearenolresponsibleforanydelayo(your
ournamebeloreyousurrenJerorabandontheapartment, ocapancycausedbyconslrucUon,repalrs,cleaning,oraprevlous
you'llbeliableforthechargellsledabove(nottoexceed550 resident'sholdin9over.ThisLeaset�+lllremalnln(orcesubJeclto
perblllingperlod),Dlustheactualorestlmatedcostoflhe (1)abatemeMotRenlonadailybasisduringdelay,anA(2)youriighl
ullliliesusedwhllelheulililyshouldhavebeenbllledtoyou. �ole�minatelhisleaselnvrtitingassetforthbelovi.Rentabatement
I(yourapartmentisl�d(vlduallymeteredandyouchange andLeaseleiminationdonotapplyifthedelayfsforcleaningorre-
your�etallelectAcprovlder,youmustgiveuswrittennotice, palrsthaldon'tpreventyoufrommovinglnrolheapartment.
You must pay all applicable provider fees, including any fees
tochangeservicebacklntoournameatteryoumoveout. 6.1. Termination.l(we9lvewriltennolicetoyouo(adelayln
3.6. LeaseChanges.LeasechangesareontyallaveJduringthe occupancywhenorafterthlsLeasebeglns,yaumayteimi-
Leasetermorrenewalperiodifgovemed6yPac10,spedfied nalethlsLease�vlihin3daysafteryourecelvewritlennotice.
InSpeclaiProvislonslnPar32,orhyawrillenaddendumor If�veglveyouwtittennollcebeforethedatethlsLeasebegins
amendmentslgned6yyouandus.AtoraRertheendofthe andlhenolicestalesthataconstrvctlonorolherdelayis
InNialleaselerm,(Ientincreasesrrlllbecomeetfectivewithat ezpectedandlhatthcapartmentvAllbereadyforyouto
IeastSdayspluslhenumbero(days'advancenoticemntained occupyonaspecficdate,youmaylerminatethisLeasewlthin
inBoxFonpa9e11n�vritingfromustoyou.YournewLease, 7daysafterreceivingwrittennolice.
whlchmayindudelncreasedRentorLeasechanges,�vill6egln Afterpwperleiminallon,youareenHtledonlylorefundof
onlhedatestatedinanyadvancenoticeweprovlde(vrilhoul anydeposll(s)andanyRentyoupald.
�cedingyourtignature)unless ougiveuswdttenmovc�out
nolice under Par. Z5, vihich applles only lo the end o( the cu�rcnt
Lease termor renewal pe�bd.
Av���mml leue Comncl OlOD,4us ApMment A��q�/aj�n.1�C. I Inqe E o16
Vf 8 ue Moon e51¢nature Senices Document ID: 516662447
9. Cateo(UnftandDamages,Youmustprom�.:,ypayorrclmburseus
for loss, damage, consequentlal dnmages, governmenl fines m char9•
es, or cosl ot repalrs or service In lhe apartment communiry because
of a Lease violatlon; improper use, ne91i9ence, or olher conduct by
you, yout Invilces, your oca�panls, ar your gucsis; m, as allov+ed by
laer, any olher cause not due to our negilgence or fault, ex<ept fvr
damages hy acls o( God lo �he exlenl Ihey couldn't be mlti9a[ed by
your aclion ot inactlon.
Unless damage or wnsfewalei sloppnge fs duc lo ournegllgenc4
vdre nof IlnGle /or—nndyou must pay lar—repnirs miA repinte-
menls ocrurring dudng tlie Lense lerm or ren ennl perlod, lndud�
ing: (A) Amnape 6oin wasletvnlcr sloppnget [nuseA6yimproper
a6jecls In 1lnes axdusNclyservin9 youroparlmmh (0) damnge fo
doors, wlnAo�vs, or rueens; nnA(q dmm�9elrom wlndows or doors
lelt open.
Yf:l�iiiiri ��IVii��.=•,��'lli::f'�ill �� . �L�.'�.i a4xu,tbq�iLS!9,�
10. Communilypolides,CmnnumllyPol(des4cromepnrto(fM1is
Le�se andmu:f 4e lollowed. We may make chan9es, Induding addl-
Uons, to our viAtten Communlly Polides, and those chan9es can be-
wme elfecUve immedlately Ihhe Commmilly Polldes aic dlshibuteJ
anJ applicable lo all units In Ihr. apaNmeM communlry a�d do no!
chan9e thc dollai amounls owed unJer this �ease.
10.1. PhotolVidcopcleaso.You9lveuspermisslontouseany
phologiaph, Ilkeness, image orvideo laken o(you while
youme using properly common areas or parlfcipaUny In
anyevent sponzored by us.
10.2.
70.3.
70.9.
10.5.
Disclosure o( Informalion. Al our solc opllon, wc may,
but are not obllgaled lo, share and use Informalion related
lo lhis Lease for law-enforcement, governmcntal, or businett
purposes. At our requesl, You aulhorize any utltity provldcr lo
give us In(ormatlon about pending or actual connectlons or
dlsconnecllons ot ull Ilry service lo your aparlme nl.
Guesfs, We may ezciude (rom lhe aparlment community
any guests or olhcrs �•�ho, in our solc Judgment, havc bcen
vlolating !he law, vlolating lhls Lease or our Community
Policles, or disturbing olher resldent s, nc(gh6ors, visitors,
or o�vner representatives.lVe may also exdudc (rom any
outside arca or common area anyone who refuses to sho�•r
pholo Idenlification or ref uscs to Idenlify hfmsel( or
hersel( a s a resldenl, an aullwilzeJ ucwpanl, or a guesl of
a spedfic resident In the community.
Anyone not IlsteJ in thts Lcase cannot stay In lhc
apartmentformorelhan 7 dayslnonevreek
withou[ our pilor vidlten consent, a nd no moie Ihan twice
Ihat many days In any one month. If the previous space
Isn't filled In, 2 days total per wcek will be the Ilmit.
Notice ol Convictions and Reglst raUon. You mus[
notify us ���Ithln 15 days ff you or any of your occupants:
(!a are convicted o( any (elony, (B) are convicled ot any
misdemeanor Involvfng a controlled substance, v�olence to
anolherpeison,ordesliudionof properry,or(C� registeras a
sezoHender.lnforming us of a criminal ronviGion or
sex-offender reglstration doesn't waive any rl9hls we may
have agalnst you.
Odors, Naise and ConsttucHon. You agree tha[ odon
and smells (Including those related to cookin9),
everyday nolses or sounJs rclaled to �epalr, renovatlon,
Improvemen[, or mnslruction in or around the property
a�e all a normal part of a multifanilly living environment and
tha[ it Is ImpracUcai (or us to prevent them from penetrating
yout apar Immt.
11. ConducLYouagreetocommuNcateandconductyoursel(Inala�v
ful, murteous and reasonable manner at aIl Omes when Inteiactin9
viilh us, our representalives and other resldents or occupants. Any
acts of unlaw(ul, dlscourleous or unreasonable commuNcaUon or
conduct by you, your occupants or guests is a breach of thls Lease.
You must use customa�y d1119ence In malnlalnin9 the apar�menL
keeping il In a sanilary conrlllion anJ nol damaginq or Illterinq Ihe
common areas. Trash must be dlsposed of at Icathvicekly. You r411
u:e your apartment and all olher areas, including any balconles,with
reasonable care. V/e may regulate Ihe ute of p assa9e�vay5, patios,
balconies, porches, and activltles In common areas.
11.7. Prohi6ltedConduct.You,yourocapanls,andyourguests
tvill nat engage in cerlaln prohl6lted conduct, Including the
tollo�vin9 activiNes:
(a) cdminalmnduchmanufacturing,delivering,or
possessing a coNrolled subslance or dmg parapher-
nalia; engagln9ln or Ih�eatening vlolence; possessing
a weapon prohlbited by stale law; discharging a fircarm
in Ihe apadmenl community; or, ezcepl �vhen
ailowed by law, displaying or possessln9 a gun, Y.nl(e,
or othenveapon In Ihe cammon area, or In a vray that
may alarm olhers;
(b) behavin9lnaloud,obnoxiousordan9erousmanner,
(c) dlslw6in9'uiUveateninglhe�i9hts,comfoi6health,saiely,
orconecnlenm of olhets, h�dudin9 us, our agenls, or om
�epresenlatfves;
(d) disruplin9ourbuslnessopemllons;
(e) storinganythln9lndosMscontainln9waterhealersor
9n appl{ances;
(q lampeiin9v4thuti�llieso��clecommunlcation
ecrylpment;
(9) brin91n9haza�dousmatcrtalslnW�heaparlmcnt
commuMty;
p� usln9vAndmvs(oreNryorexil;
(q heatln�theapartmentv�ithgas�ope�atedappliances;
��1 makingbaddallhorfalsealle9atlonsagalnstusorour
ageMs lo o�hers;
(k) smokingofanyklnd,thaUsnotlnacmrdancer�iththis
Leasc;
@ using9lasscontatnersinornearpools;or
(m) conductin9 any k1nJ of business (induding chlld-carc
scrvlces) In your aparlmenl or In ihc aparlment
community—except for any Iav�ful business
conducled'at home" by compuler, mall, or lelephone If
nistomers, cliems, paticntz, employees or oll�cr
bu slness associates do ool come to your epat lmenl
(or business purposes.
12. Anlmals�Nollvin9ctealuresa/nnyklndnrenllo�ved,evantempo-
mrlly, nuywMe�eln fhe npnrfinenf or aportmeut commmdfyun-
/ess we've gfven wrlllen permisslon. If we allo�v an anlmal, you must
sl9n a separate Mimal �ddendum and, cxccpt as set forth In ll�e ad-
dendum, pay an animal deposit and appllcable fees and addltiooal
monlhly renl, as applicable. An animal deposlt is considered a c�ener-
al searity deposlL You icpresenl lhat any iequesls, stalements and
represenlations you make, lncluding those (or an asslslance or sup•
porl animal, are true, accurate and made In good lai�h. Feedlny stray,
(eral or tvlld animals Is a brwch otlhis Lease.
12.7. RemovalofUnauU�orizedAnlmal.Vlemayremovcan
unaulhorized anlmal by Q) Icaving, in a conspfcuous
place In Ihe aparlment, a eiritlen nolice o( our fntent lo
remove Ihe anlmal within 2A hours; and (2) follotving !he
procedures o( Par.14. Wc may: keep or kennel the animai;
W m the animal over to a humane sodety, local authoriry
or rescue otganizalion; or return the anlmal lo you If
we consmt to your request to keep the anlmal and you
have completed and signed an Anlmal Addendum and
pald all fees. When keeping or kennelin9 an animal, we
��ron't be Iiablc for loss, harm, sickness, or death of the
animal unless duc to our negllgence. You must pay (or
the animal's reasona6le care and kenneling cha�9es.
12.2. Violaltons of Animal Pollcies and Charges. I(you or
any gues[ or occupanl vlolales Ihe animal reslrlQlons ol
Ihls Lease or our Community Policies, you'll be subJect lo
charges, Jama9es, eviclton, and olher remedles
provlded In this Lease, Including animal vlolatlon charges
listed fn lease Delalis Bom U�e date the animal eras
hwught iNo your aparlment unlll It Is removed. I( an
animal has been in the apa� Iment al any time dudng
your tcrm of occupanq (�vilh or tvilhout our mnsent),
we'll charge you for all deaning and repaii msls,
including defleaing, deodo�izing, and shampooing. Initial
and dai�y animal�violation charges and animal�removal
charges are Ilquldated damages (or our lime,
lnconvenfence, and overhead in enfordny anlmal
restrictions and Community PoIlcles.
73, Parking.Youmaynot6eguaianlcedparkinq.Wemayiegulatelhe
t(me, manner, and place of parkfng of all motorized vehlcles and
olher modes of Iransportallon, Including bicycles and scoolers, In
lhls Lease.ln addition to other dghls vre have to low or boot vehides
under stale law, we also havc the righl lo removc, at U�e ezpense of
Ihe vehidc owne� or operalor, any vehlde that Is not In mmpllance
wilh �his Lcase.
14. IVhen V/c May Enter. If yoo or any oiher resident, 9ucst or occupant
Is precenl, lhen repalr or tervice persons, conlroctors, law officers,
govemmeot representatives, lenders, appratsers, prospective resl-
denls or buyers, Insurance agents, persons authoiized to enter under
your re�lal appllcatlon, or our representatives may peacefully enler
the apailmentat reasonablc timrs forreasonable business purposes.
If nobody Is In Ihe aparlment, then any such person may enter peace-
fully and at reasonable lfines (by breaking a window or other means
�vhen necessary) (or �easonable business purposes If wrilten notice of
�he entry Iz lef [ in a consplcuous place in Ilie aparUnent Immedlalely
aher Iheentry.4Ye are under no obll9alion �oenleronlywhen you
ate present, and we may, bul aie not obligated to, givc pAor nolice or
make appolntments.
Ap�ilmenllei�eCoNracto2021,Ta�iA �itmentA �n D� elof6
P � Olue �oon e51RnaWrc Scrvices Ooament ID; 5166G2M7 � 9
15. Roquesls,ftepairsandMal(imctlons.
�
75.2.
Wrilten Requcsts Requlred.1/you oronyo�cupanf needr
lo sendo reques t—/or rxnmple, (or�epalrt, lnslallnllont,
rar v(ws, ownashlp olsrlolure, orte�urlty-telnleAmnl fers—
If must Le wdtfen nnd delivered to mndeslgnnled
repreren lative In nrrordance wifh f61s Lease (except (or
(alr-housin9 acmmmodallon onnodlfiwllon iequests or
sltualions Involving imminenl dan9er or thrca�s lo health or
safely, such as fire, smoke, gas, exploslon, or crime In
progress).Our �vAtten noles �eguding your orai requcst do
not conslitutc a wdllen request from you. Our mmplyin9
��dlh or respondin9 to any oral rcqucst doesn't rialve lhc stilcl
requtremenl for wdtten notices undcr this Lease. A requesl
(or malnlenance or repair by anyone reslding In your
apadmeM mnsUtutes a requcsl from all resldeMs, ilm flme,
manner, mclhoA andmeans o/per/oiming mnlnfenancc
and repnlrs,lnduAL�g rvhrfher or tvldch vendon fo iise,
are wJfhln owsole dfsaeflon.
Your Itequlrement to Nolify. You musl promplly notlfy us In
vnllln9 of alrcondilionin9 or heaUn9 problems,�valer leaks or
motsture, mold, elecl dcal problems, mal(unclioning lighls,
6roken or missln� locks or latches, or any olher condlllon that
poses a Iwzard or thieat lo properry, heallh, or sa(ety. Unless
wc Inslruct othen�4se, you are rcquircd to keep Ihe
apai Iment cooled or heated according lo lhis Lease. Alr
condltlonin9 prohlems uc normalty not emergendes.
753. U1f1111as.Ylemaychangeorinslallulllitylinesor
equlpment se�ving lhe aparlment If ihe woik Is donc
rcasonably without subslanUally Increasing your
utllity cvsls. Wc may tuin off equlpment and Interrupt
utllitles as needed to pe�foim woik or lo avoid
property damage orolher emergenclesJf ulllltles
malfuncqon or are damaged by fire, waler, or siml�ar
cause,you must noti(y our representalive Immedialely.
15.4. YourRamaAles,We'llactvillhcustomarydlll9encelo
makc repairs and reconneqions �vithin a rcasonable
Ume, laking Into consideiation when casualty-Insurance
pwceeds are received. Unless required by sta W te afler
a tasvallyloss, ordurtng equipment repalr,your Rent
v+lli not abate In whole or In part.'Rcasonable lime'
aaouMs lor Ihe severity and nature o(the pwblem and
thc reasonable avallabllity of materials, labor, and
utilltles. 1lwe/nllto tlmetyrepaLa condltlon Ihnt
maferlallyn/fects fhe physicnl henith orsn(ely o/nn
ordlnnryrcrident as �equlred 6y theTexas P�opertyCode,
you may Le enflfled to exerrlse remedfes under 4 92.056
nnd ¢ 92.0561 offhe Texas PiopertyCode. ilyou /ollo�v
the praredures under those setflons, fhc /ollo�iing
remed/es, among olhers, mnyLe avalla6le toyou;
f i) ferminalion of fh(s Lense and nn npprop�infe rehmd
unde�92.056(Q: (2lhave fhecondltfon repafredor
iemedled ntcoiding fo § 92.0561; (3) dedutt /rom fhe Fent
Ilte cosl o/fhe repnlrortemeAy qccording la 4 92.0561;
and4) /��dic(pl remedles ncmrding to 3 92.0563.
iG. Our Right to Terminate for Apartment Community Damage or
Closure. If, in our sole )udgment, damages to the unit or hulldl�g are
signlficanl or performance ot needed repalrs potes a danger to you,
we may lerminate thls Lease and your �ight to possesslon by givfng
you al Ieas V days' w�iUen notice, If terminatlon ocars, you agree
vre'll re(und only proroted renl and all deposils, minus la�v(ul deduo-
tlonz. We may remove and dispose of your personal properly It, In
our sole )udgment, it causes a health ar satety hazard or Impedes our
ablliryro make repalrs.
16,1. ProperlyClosure,WeaisohavetheAghttoterminatc
this Lease and your rlght lo possession by giving you at
least 30 days' wrillen nolice o( terminaUon if vie are
demolishing your aparlment or cbsing It and it vAll no
longer be used lor residentlal purposes (orat least 6
monihs, or It any part of the properly becomes subJect to
an eminent domain procecding.
t7. AssignmenlsanJ5u61etting.Youmaynotas:i9n�IdsLeaseorsub•
let your aparlmenL You agrce Ihat you v�on't rent, oi(er to rent or
Ucen:e a II or any pai t of your apa« ment to anyone eisc unless other-
wise agreed to In advance by us in �vriting. You agree thal you won t
accept anylhing of value from anyone else (or the use o( any pait o(
your apartmenl. You ag�ee not to Ilst any part of your apartment on
any lodging or ihort-term rental webslle or with any person or ser-
vice that adverUses dercllings for tmt.
iB.Securily�nd5afety�evlces.We'll nvfor/nIss�pnsecurl de-
viceslhatarereuulredbvlaw You711nayfor(Alrekevinalhal
yourequest(unlasstvof Iledlorekev fterthenrPvlousres!•
dent moved oull; and IB�reoalrs o� ro ��acements hncauze o!
misuscordamane6q vouc� vo irfa�, ily.vou(o�cuoanlx.arvour
ucs s Youm�stpaylmmedlatelyafterllieworklsdoneunlessslatc
Iawaulhorizes advance payment.You must also pay In advancefor
any addillonal orchanged security devices you request.
Texas Pioperl y CoAc>..s. 92.75 I, 91,153, and 9I.754 requlrc, �vith
some exteptlaii,l6nf ve provlAe at no msf fo you whrn ocrapnncy
6egins; (AJ a i�lndotvlotd� on cad� w6�doivj (0) n doorvlewer (pcep•
hole or �v7ndow) on ench exterior daor,• (C) n pin lo�kon encb sl(Aing
Aoor, (DJ rftliern Aoorhnndle Intrh or n senuily bnr on end� allding
door, (E) n keylest 6ofting devlte (AeaAbolt) on carli exfer7w dooi;
nnd (F) e(1 her n keyed domknoL lock or n keyeAdenQLol f lock on
one enlry Auor. Kcyed locks tv1116e rekeycd nlfcr tlie pdorresldenf
moves ouL i/�e rekeying w111 be Aonc efther 6elore yau move In or
vilh6�7dnys n/fer you move In, os requlied bylmv. ll �ve loli laln•
s(nll onekcyscaidl y Aevlces ns reqidied Ly Int�, you Imvc Ihe rlght
lo dnso nnd deduc! Ihe rmsonn6lc cost 6om yournext Renl pny-
ment under Texas P/opeil y Code aec. 92.1G5(IJ. We Inny denctivale
oino! Inslnll keylessGolHn9 devlcet on yourdoors7l(A) you oran
occupant In Ihe Awellingli aver55 ordlta6leA, nnA(e) thc reqube-
mmts o/Trxns P�operf y CoAetec.92.753(ej w(/) nre snNtfi¢A,
18.1. SmokolllarmsandDelectionDevices.We'll(urnlsh
smake alarms or olher detectlon Jevices requlrcd by l avi
or dty ordinance. We may Install addiUonal detec tors
not so requlred. We'll tesl them and provide wmking
batlerieswhenyou first take possesslon o(your
apartmenl. Upon requesl, we'll provldc, as requlieJ by
law, a smoke alarm capable o( alerting a pe�son vilth a
hcarinc� Impairmenl.
You must pay fot and ieplacc 6attcrles as needed,
unless the lavi provides olhcivQsc. We may replacc dead
or missin9 battedes at your expentc, wllhout prior notice
to yau. Ncithcr you noryourguests oroccupanls may
dlsable nlarms or detettort.1/you dnmape a dlsaLle tfie
smoke nlnrm orremove a 6af fery �vi0imrt replaAng ft
�vll h a iroiking bnf fery, you mny Le IlaGlc lo us undc�
Texar Pioperty CoAe ter.9],Y611 lor S 100phis one
monfh's Rent, ac��ml damnges, and af lorney's lees.
18.2. DulytoReport.Youmustlmmedlatelyreporttousany
missin9, maltunclioning or defedive securitydevices,
smokc alums or delectors. You'll be Ilablc i(you tnll to
report mailuncllons, or fail lo report any loss, dama9e, or
fines resulting (rom fire, smoke, or water.
79. Ilcsidant Safoty and Loss. Unieisol6envise requlred 6yla�v, nonc
o(irs, ouremploycet, ngenfs, onnana9emenf compnnles nre 11n41e
lo you, yomgueils oroccupnnlslornnydamnge, pruonnNnJury,
lojs fo personal properl y, orloss o(buslness or pertonallncome,
Irom any cautc, induding Gul not Ilmikd ro: ne9Bgent orinlentlom
aladso(residenfs, occupnntr, orgueils; Ihefl, 6urglary, nssnuif,
vnndallsm orofhernlmer fi�e,flood, waterleaks, rohr,hnll,lce,
sno�v,smoke, Bghfning, tvind, exploslons, inlenupflon olufilltfes,
plpe leaks orolheroccurrences unless such damage, Injuryorlou Is
rnused excluslvely Ly ou�na911gen[e.
We do nof wnnant secuAf y ol anyklnd. You agree that you vAll not
rely upon any senrtily mcasures taken by us for persona I security,
and that you wlll ca11911 and local law enforcement aulhodlies If any
security needs arisc.
You ackna•iledge fhat eic are not equlpped or tralned to provlde
personal secwlly services to you, your guests or occupanls. Yau rec-
ognize that we are aot requlred to provide any private secwity ser-
vlces and that no security devices or measures on ihe properly are
fall-sa(c. You fuAher acknowled9c that, even I( an alarm or gate amc-
oilies are provided, lhey are mechanlcal devlces Ihat can malhinc-
Iion. Any charges resul�ing from Ihe use oF an 1nlrusion alarm wlll be
charged lo you, Including, bu1 nal Iimiled to, any false ala�ms �vilh
policelfiie/ambulance resppnse or olher required dry charges.
10. CondltlonoflhePremisesandAllerallons.
20.1. As•Is.Wedlsclaimalllniplled�varrnntles.Youacceptthe
apartment, f�xlures, and fumilure as Is, ezcept for
condilions mate�lalty affecling the health or safely of
ordlna�y persons. You'll be give� an Inventory and
Condlllon Form at or before move-In. You agrce lhat
af ler completlon of the form or vdthin 48 hours af ter
move�in, whicheve� comes firsl, you must note on the
form all defecls or damagc, sign the form, retum it to
us, and lhe foim accurately iellects the condltlon o( the
premises for purposes of delerminin9 any refund duc to
you when you movc oulAlhenvisc, everything vAll bc
considered to 6e In a clean, safe, and good working
conditlon, You must still send a separate request (or any
�epairs needed as provided by Par.15.1.
20.2. Standardsandlmprovements.Unlessauthorizedby
law or 6y us In wAUng, you must not pertorm any repaln,
palnlln9, wallpapering, carpeting, electrical changes, or
othcrviise alter our property. No holes or stickers arc
allo�ved insidc or outside the aparlment. Unless thlt Lease
states otheiailse, vie'll pennit a rcasonablc number of sinall
nail holes for hanging picture s an sheef rockwalls and in
9rooves of crood-pancled walls. No waler furnilurc, washing
machines, dryers, exlra phone or tclevlslon outlels, alarm
systcros, cameras, two-way Iaik Jevire, video or other door
Ap��imentla�eConiract02021.7eu�Ap��ImentA 11� P�qeAof6
Bluc Moon e51¢nature SeMces Document ID:516662447 ,
belis,orbckchanges,adcillions,or��.._�Ingispermitted i(youdontpaymefiislmonth'sRcohvhenorbe(orelhislcase
imlessrequlicdbylaworvm'vemnseNedlnr�ri11n9.Youmay begl�s,aUfu4veRmlforthcleaceMrm�villbeaulomalicnity
tnslal�asatelliledishorantenna,butuniylfyousignour acceler�tedvrithoulnoliceandbecomelmmeJlitelydue.We
talelliledishoranlennaleaseaddendum,whichmmplies alsomayendyourdghtotaaupancyandrecoverdama9es,
e�ithreasonablerestdcllonsallowedby(ederallaw.Youmust (vNreRentaltomeysfees,comtcosls,andolherlav+fulcharges.
notaller,dama9qorremoveowpwperty,Indudingalann 2;,q, Ho�dovor.Youandnlioccupanlsmustwcaleandsurrendet
syslemz,detecllondevlces,appllances,fumRure,lelephone theapailmentbyorbeforetheJateconWinedlrc(1)your
andtelevlsionwidn9,sueens,locks,orsecurllydevices.When ���ove�outnollce�2)ournoUcetovacatq(3)ournoticeot
you movc In, wc'll svppiy i19ht bulbs fm 6x�ures ere fumish, In•
cluJln9extedorfixWresoperatedtmminsidelheapartmenl; nomrenmval,orlA)awrlttenagreementspecifylnpadif(erent
after that, you II repUce them al your expense move�ou( Jnte. I( � holdover occun, iha� yoii II be Ila61e to us
wilhbulbsoflhesamelypcandv�allagc.Yourimprovementt forallRentforlhe(ullte�mohheprevlouslysl9nedleaseofa
lolheapartment(madewithonvllhoutourconsenl)become newresldentwhocan'loccopybecauseo(tlieholJover,anA
oun unless �ve aqree olhenvlse In wrilin9. at our opUon, we may extend Ihe Lease tc�m andPor Inaease
Ihe Renl by 25ho by delivcring vidUen notice to you or your
27. Notices.Wdtlennoliceloorfromouiemp�oyees,agents,o� apailmentyvhl�eyoucontinueloholdover.
managementcompanlesmnslitulesnoticeroor(romus.Noticesto 23.5. OlherRomedles.Wemayreporlunpaidamounhto
, youoronyolherresldentoftheapartmentconsHwtenoticetoall credita9endesasal�owed6ylaw.lftveorourdebt
� cesldenls.Noticesandrequest:(romanyresldentconsfilulenotice wl@ctortiiestomlleUanymoneyyouoweus,you
fromallresldmts.OnlyreslJen�scanglvenoticeofteaseterminallon a9reethaU•morthedebtcolleUormaycontaclyo�by
andlnlenUomovcoutunderPac79.AllnoticesanddowmentsvAll anylcgalmcansJ(youdefault,youvAllpayus,InaddiUon
6einEn911shanJ,alouropilon,inanyolherlan9uagethalyouread tooUiersumsdue,anyrenWldlscounlsorconcessions
�� or spcak. agrecd lo In wdUn9 thal have bcen applied lo your acmunt.
' 21.1. EledronicNotica.Noticemay6egiveneledronlcallyby Wemayiecoverallomey'sfeeslnconnectionwithen(ordng
. us fo you if allowed by law. If allowed by latv and In our dyhls under this Lease. All unpaid amounts you owc bear
'�, accordance�vllhlhlsLease,elecironlcnollce/romyoulous Interestatlherateprovldedl�yTexasFlnanceCodeSecUon
muslbesenitotheemalladdrcssnnd/orportalspedfiedfn 304,o07(c)frointheduedate.Youmustpayallcolleqlon�
tldslease.Noticemayalsobe9lvenbypl�onecallortoa agencyfeesllyoufaillopaysumsduewllhlnl0daysafter
pAysical address i( allowed In this Lease. you are malled a Ieticr demanding paymenl rnd stating that
' Yourepresentthalyouhaveprovidedyourcurrentemall coVectlorvagency(eeswill6eaddedifyoudon'lpnyailsums
� addresstous,andthatyouw111notVfyusintheeventyour bylhaldeadline.Youarealsoliable(oracharye(nolto
emall address changcs. excecd 5150) to cover our tlme, <ost a nd expense (or any
�, evlcllon proceeding a9alnsl you, plus our attomey's fees and
I expenses, murt cos Is, ond filing fecs azlually patd.
l.=;r;�i�r .±r�as��sa ut�"l.],n,�1�:r�,t� �;;:,;:�,':;�c :ri`�:. i��l sn.
22. LIa61111y,EachresldentlsJolntlyondseveraltyllable(oralllease
obllgatlons. if you or any guest or oaupant vlofates thls Lcase ot our
Community Polides, all resldents are considcred to have vio�ated lhis
leaze.
22.1. Indamnificatfon byYou.Yov7ldelenA,indemnfrynndholdus
nnd our employecs, agenl s, and management rompany
hamdess /rom olllln6ilif y nrirfn9 /rom yourcanduct or
requesfs fo ourrepresentallvet nnd liom the conduct ot or
requesls 6y yowlnvifees, oraipnnfs orguesls.
23. DofaultbyResldent.
23.7. ActsofDefau�l.You'llbelndefaulllf:(A)youdon'1
timely pay Rent, Includfng monthiy recurting charges, or
other amounts you ovie; �0) you or any guest or
ottupant vlolates Ihls Leue, our Communlly Polides,
or fire, sa�ely, health, crlminal or other laws, mgardless of
tvhelher or v�here arrest or convicUon ocan; (Q you
givelnco« ecl,incomplete,orfalseans�verilnarenla�
appllcation or in this lersr, or (D) you or any occupant Is
charged, detained, convideJ, or 91ven deterred
adJudicalion or pretdal diversion for (q an oftense
involving actual or potential physlcai harm to a person, or
InvoNing the manufacture or delivery o( a controlled
sub:lance, mari)va na, or drug parapheroalia as defined
In the Texas Conlrolled Subslances Acl, or l2) any sex-
re�ated crime, lncluding a �nlsdemeanor.
23.2. EvicUon.!/youde(pult,IndudingholAingover,wemny
end your right oloccupancy byglv(ng you nt least n 24•
l�our wdtten notice 10 vncafe. Terminatlon of your possetslon
�i9hts doesn't relcase you from Iiabill�y (or fulure Rent or
olhcr Lea:e o611gations. �/ferglvin9 nolt[¢ to vacafe or
(1(ng an evlcflon sulf, we may slili occept Renf o7 oU�er
sums due; the filLig or nccep(nnce doesn't iiaive or
Alminish ourdg6t o/evlctfao or any olbe�confra�lunlo�
s fnfutory rlghl. AccepUn9 money at any Ume doesn't �vaivc
our ri9ht lo damages, to past or fu W re Pent or other sums,
or to our continuin9 with eviction proceedings. in an evictlon,
Rent is owed for the full rental period aad vAll not be
prora�ed.
233. Acceleration.Unless�veeleclnottoaccelerateRent,ail
monlhly Rent for the rest of Ihe Lease tcrm or renewal
period v�lll be accelerated aulomalically wilhoul notice
or demand (before or af ter acceleration) and will be
Immedialely due I(, wilhout our wrilten consent• (A) you
move out, remove property In preparing to move out,
or you or any occupant 9ives oral or wrilten notice of
Intent to move out before Ihe lease Ierm or renewal
period ends; and (0) you haven't paid all flent /or the
enHre Leasc term or renewal pedod. Remalning Rent wlll
also be azcelerated I( yodre Judidally evided or move
out w6en �ve demand because you'vc de(aulled.
Repinsentalives' Authority and Wnlvert. Owrepretentatives (!n-
duA6�g managemenf personne/, employees, and ogents) hnve no
nul(mdf y to waNe, nn�end, orfcrminnfr. fhls Lense or anyporl opf
unless in �vriling andslgned, nnAno nulhorily lo mnkep�omiser, rep•
resenfaflons, oragreemmts thatlmpotesranffydulles a ofherob•
!lgatlons on us orourrepiesentaffves, unfess In �•iriting andsfgned.
No aclfon oromtssion by us vitll6e consldered a��r�Ner o(our tighis or o(
any subzequenl violation,default, or time or place of per(ormance. ow
rhot�c fo en/orre, nof en/one or Aelny eniwcement ol rniffm•no-
fice requlremenl s, rentaldue Anles, nccelerallon, Nens, or nny other
dghlslsn't n wnive� undernny draunstm�ces. Delay in demandin9
sums you rnve is not a eialver. Fxcept when noUce or demand is required
by law,you waNe any notice and demand for pedoimance from us If you
de(aulL NoIhIn9 in IhVs Lea�e conslin�tes a waivero(out remed�es (or a
breach underyour prior lease that occurred 6efore ihe lease te�m 6egins.
Your leazc Is subordinale lo exisling and future cem�ded mort9a9es, um
less the ovmer's Icndcr chooses olhenvise.
All �emedies are cumulative Exercising one remedy won't mnstilute
an clection or walver of o�her remedies. All provislons regarding our
nonllabllily or nonduty apply to our employees, agents, and mana9e-
menl companles. No employee, a9ent, or ma na9ement company is
personally Ilablc tor any of our contractual, stalutory, or oiher obliga-
Iions mcrely by vlrtue of acUnq on our behalF.
�..,.. �,..i �..•..:c � �. '. d .i�Ai�...i'NI i� daii4'1 �i�Lf . ;� . ,yi, _, .
25. Movo�OutNoticc. Beforemovingouf,yaumusfg(veowrcpresen-
fative aAvance tvrltfen move-outriollrc nt sfatedln Pnr.4, even 1/
fhis Lense has Lecomc a monfh-fo•montli lease. The move�out Jate
can'1 be chan9ed unless we and you both a9ree In writing.
Your move�out noNce must compty wiNi each of l6elo�ioivtng:
(a) Uniesswcrequlremorelhan30days'notice,Ifyougive
notice on Ihe first day ol the monih you inlend to move
out, move oul will be on the last Jay o( that monlh.
(b) Yourmove�outnoUcemuslnotterminatethisLease
befo�e llic end of the Lease lerm or renewal period.
(c) Ifvrc reqolre you to ylve us mom lhan 30 days'viritten
notice to move out be(ore ihe end o( thc Lease tcrm, �ve
�•�III qive you 1 written reminder nol less f han 5 days nor
morc than 90 days befoie your dcadline for giving us
your written movc�out noNce. lf vre faU to give a reminder
nollce, 30 days' writlen notice to move out Is requfred.
(� Youmustgettromusaw�iqenazkaowledgmentotyour
nolice.
26. Movc�OutProcedures.
2G.1. Clcaning.Youmustthoroughlycicanthcapailment,inciuding
doors, winJo�vs, furni�ure, bathrooms, kitchen appliances,
patios, balconles, 9ardges, carports, and storoge rooms. You
must follow move-out dcanin9lnst ruaions If Ihcy bave been
provided.l(you don't clean adequately, you'll be Ilable for
reasonable cleaning chaiges—Includin9 charges forcleaning
carpets, drapeiies, (umftvre, walls, elc Iha! are soiled beyond
�pxtmeMle��eCoNr�<I�lOt).TeufApailmrn�Aiio�� a�ton.lnc. P�9e5o16
IVI Olue Moon e5I¢nalme Services Oocument ID:5166G2447 `
normalwear(Ihatis,wcaro�sollin� •cwn�vlihoul
ne9ligence, cardessness, acddenl, or ,.,�use).
26.2, Move�OutinspecNoo.Wemay,hutarcnolobll9atr.dto,
provide a Jolnl move-out Inspectlon. Our representatfves
havc no authodty to bind or Ilmil us cegarding deductlons (or
repa�rs, dama9es, or d�arges. �ny sWlemenls or estlmales by
us or our represeMative are sub)cU to our correc llon, modl-
ficatbn, or disapproval befoie fina I auwnling or �efundin9,
27. SurrenAer and ALandonmenL You hwe s�urendereA lhc apartmenl
�vhen: (A) the move�oul Jalc has passed and no onc is living In (he
apartmenl In our reasonable �udqmeN; or (Oj apartment }:eys and ar
cess devicet listed In Pac 7.1 have becn turned In to us—tvhichever
happens fust.
You have nbnndoned the apartment v�hen all of Ihe followiny have
ocwned: (A) everyonc appcars lo have moved out in our reasonable
JuJgmem; (0) you'vc bcen In default for nonpayment of Ocnt for 5
conseculive days, ot r�aler, 9a s, or eiectde servlce for the apa� Iment
not conneued in our name has been teiminated or lransferred; and
(q you've not responded for 2 days to our �olicc Icf t on the inside ot
the maln enlry door stating lhat �vc conslder the aparlment aban-
doned. An apartmenl Is a�so conslJercd abandoncd 10 days afler lhe
dr.ath ot a sole rc5ldent.
27�1. 7he Ending of Your Oi �his, Suuender, abandonment, or
Judldal eviUlon ends your ilght of possesslon (or alt purposes
and 91ves us the Immediate rlqhl to dean up, make repalrs in,
and mlet lhc apm Imeni; dMeimine. ny secuAty•deposil
deducUons; and �emove or storc properly �efl In Ihe aparlment.
27,2. RomovalandSlora�cofProperty,Wc,orlaw�tficcrs,may—
but have no duly to—remove or slore all propeiry �hal In our
solc Judgment belongs lo you and remalns In the aparlment
or In common areas padudin� any vehides you or any
occupant or guest mvns or uses) aRer you're Judlclally evlUed
or If you smrender or abandon lhe aparimmt.
Y/c'ie notllaG�e /or [asunity, loss, danmge, orf he/L You
must pay rwsonable charges forour packing, removing and
slotin9 anyproperty.
Excepl fot an�mals, we may throvi away or qive to a chadta6ie
organlzation ali personal property that Is:
p) IcR(ntheaparlmentaflc�sunenderorabandonmenr,or
(2) Icft outslde more than 1 hour a(ter v�dt o( possession Is
exeated, (olloviing JudlQai evlclion.
An anlmai removed af ter sinrender, abandonment, orevlcilon
may be kenneled or tutned over to a bca� aulhodty, humane
so<lety, or rcscue organlxalion.
Is�l'idliii�:�hu:l�iuFyiil.l.vil i�t=fi�%leiii��is•lUt�i'�L+',fY�
26. TI111Membership.We,themanagementcompanyrepresentingus,
or any localor servlce that you used confirms membershlp In good
standing oF both theTezas Apartmenl Association and Ihe a(fillated
bcai apartment assodaUon for lhe area wherc the aparlment is
localed at the Ilme of sl9ning Ihis Lcase. I( not, ihe follotvinq applies:
(A) thls Leasc is voldable at your oplion and Is unenforceable hy us
(except for property damages); and (6) �ve may noUe<over past or
(ulure rent or olher charges. The above temedles also apply If both
of the following occur. (p lhis Lease Is auromapwlly renewed on a
'r ilh�to•mon�hbaslsmorethanonceattermembershipinTAAand
`r'xal assoclation has lapmd; and (2) neilher Ihe owner nor the mam
a9ement company is a mem6er of TAA and the local assodallon duing
Ihe third auromalic reneviaL 11 signed a(fidavit from lhe affiliated Ioca1
apm Iment assodatfon alleslinq to nonmembership vihen lhts lease
or renewalwas signed vAll he conclusive evldence o(nonmembership.
Govemmenlal eotiNez may use TpA forms II TAA agrees in w�iting.
Name, address and telephone num6er of locator service pf applicable):
29. Severa6111ty and Survtvabtlity. It any provision ol ihit Lease Is invai-
. IJ or unen(orceable under appllcable Inv, it won't Invalidale ihe �e-
malndcr of thls Lcase or cha n9e Ihc Intent of the parlles. Paragraphs
10.1,10.2, 76, 22,1, 27, 30 and 31 shall survivc thn terminatlon o(
this Lease. Thls Lease 61nds subsequent owners.
30. Controlltng Law. Texas la�v governs this lease. All Iitigatlon ailsing
under lhis Lease and all Lease obllgallons mutl be brouqht in lhc
county, and preqnct If appllcable, vihere the apailrnent Is located.
31. Walvers.8ysl9ningthisLease,youa9rectothe(ollowing:
37.1. ClassAcllonWalver.Youagreethatyouwillnotputicfpate
In any class actlon clalms ayalnzt us or our employees, ayents,
or management company. You must filc any dahn agalnsl us
Individualty, and ym+expressiy rvaive yourdghf to Ldng,
�epresenf, Joln or of lienvisc mnlnlnln a dars ntfJon,
rolledfve nclion orslndlaiproceeding ngafnsl us fn
nny/o�um,
YODUNDEIi IDTNALWITNOUTTHISWA��I Y, 00
COULD OE A PiuiTY IN A C1A55 ACiION L4WSUI7, AV
$IGNING TF�S L[ASE. YOU nCCFPTTHIS IVQN_FIl_�ND
CHOOSETOHAVEANYCLAIMSDECIDEDINpIVIDUALIY.
TIIETEIIMINATIONORBRP11111TO��OFTHBLE SEVIVE
11.7. ForcoMaJeureJlwearepreventedfranmmplelingsubstam
Ilal pedomiance of any obllgatlon ander Ihls lca se by
occmrences Ihal are beyond our conlrol, InduJln9 bul
not Ilmlled ro, an acl of GoJ, slrfkes, epldemlcs, war, acb of
terroiism, rfols, Oood, fire, hmilcanp tornado, sabola9e or
govemmenlai �egulalion, Iben wc ihall bc cxcused (rom any
furU�cr perfoimance of obliqalions lo �he fullest exlent
atlowed by law.
32, Spedal Provlslons. The follo�ving, or at W ched Specfal Piovlsions anJ
any addenda or Community PoIIQes provlded to you, are pa� I of this
lease and supersede anyconfliclln9 provlslons In this Lease.
Oeforesubmitling a renlal applicatlon orslg�tng this Lease,you
should revlevi ti�e documents and may cansult an altorney, You are
6ounJ 6y thtzLease�vhenit Is iipned.An eleclronlc signaturels
bfnding.7lds Lease, lncluding all addenda, Is the eNire agreement
bcl�vecn you and us. You agree 1 hat you are NOT relyln9 on any
oral representa(ions.
Resfdent orAes7dents (all slgn below)
�%
�Name of Reslden�
(Name o( Resident)
{Name of Residenl)
(Name ot flesident)
INamc of Residenl)
(Name of 8esidenp
06/27/2025
Date si9ned
Datc signed
Date signed
Datesl9ned
Dalc signed
Date signed
OimerorOvner's Represenfnllve(signing on behalf of ovmaj
a��a����.
AO+�ImeMleaieCoMr��41M01RCUI5t�levAJePormll� •��C3ReNi�dO<foEer1017 i�ge6o16
IJI Blue Moon e5lenmurc Servlccs Domment ID: S1Gfi62447 j
CITY COUNCIL AGENDA
Create New From This M&C
�
DATE: 8/12/2025 REFERENCE NO.: M&C 25-0676 LOG NAME:
CODE: C TYPE: NON- PUBLIC
CONSENT HEARING:
Offidal site of the City of Fort \North, Texas
FURT�'4'ORTII
��
192025-2026 H U D
ANNUAL ACTION
PLAN
YES
SUBJECT: (ALL) Conduct Public Hearing and Approve the City of Fort Worth's 2025-2026 Annual
Action Plan for the Use of Federal Grant Funds in the Amount of $13,273,355.77 to be
Awarded by the United States Department of Housing and Urban Development from the
Community Development Block Grant, HOME Investment Partnerships Program,
Emergency Solutions Grant, and Housing Opportunities for Persons with AIDS Program,
Authorize Collection and Use of Program Income, Authorize Execution of Related
Contracts, Adopt Appropriation Ordinance, and Authorize Waiver of Indirect Costs
(PUBLIC HEARING - a. Staff Available for Questions: Juliet Moses; b. Public Comment c.
Council Action: Close Public Hearing and Act on M&C)
RECOMMENDATION:
It is recommended that City Council:
1. Conduct a public hearing to allow citizen input and consideration of the City's 2025-2026 Annual
Action Plan for use of federal grant funds to be awarded by the United States Department of
Housing and Urban Development in the amount of $13,273,355.77 for the Community
Development Block Grant, HOME Investment Partnerships Program, Emergency Solutions Grant,
and Housing Opportunities for Persons with AIDS grant programs;
2. Approve the City's 2025-2026 Annual Action Plan for submission to the United States Department
of Housing and Urban Development, including allocations of grant funds to particular programs
and activities as detailed below;
3. Authorize the collection and use of an estimated $30,000.00 of program income which is
expected to result from activities using prior years' Community Development Block Grant funds
for the City's Priority Repair Program;
4. Authorize the collection and use of an estimated $30,000.00 of program income which is
expected to result from activities using prior years' HOME Investment Partnerships Program grant
funds for the City's Homebuyer Assistance Program, and authorize the use of 10 percent of the
program income for administrative costs;
5. Authorize the City Manager or his designee to execute contracts for one-year terms with the
agencies listed in Tables 1, 2, and 3 below for Program Year 2025-2026 for Community
Development Block Grant, Emergency Solutions Grant, and Housing Opportunities for Persons
with AIDS grant funds, contingent upon receipt of funding, and satisfactory completion of all
federal regulatory requirements;
6. Adopt the attached appropriation ordinance increasing estimated receipts and appropriations in
the Grants Operating Federal Fund in the total amount of $13,273,355.77 consisting of
$7,116,438.00 in Community Development Block Grant funds, $2,814,431.77 in HOME
Investment Partnerships Program funds, $615,818.00 in Emergency Solutions Grant funds, and
$2,726,668.00 in Housing Opportunities for Persons with AIDS grant funds, all subject to receipt
of such funds; and
7. Authorize a waiver of the Neighborhood Services Department indirect cost of 21.05\%, estimated
total of $264,698.00.
DISCUSSION:
The City's 2025-2026 Annual Action Plan summarizes the major housing and community development
activities and proposed expenditures for the program year beginning October 1, 2025 and ending
September 30, 2026 for use of federal grant funds totaling $13,273,355.77 from the United States
Department of Housing and Urban Development (HUD) from the Community Development Block Grant
(CDBG), HOME Investment Partnerships Program (HOME), Emergency Solutions Grant (ESG), and
Housing Opportunities for Persons with AIDS (HOPWA) grant programs, plus program income from the
CDBG and HOME grant programs totaling $60,000.00. It also summarizes the use of program income
resulting from activities using prior years' CDBG and HOME funds, the primary purpose of which is to
benefit low-and moderate-income persons in Fort Worth. ESG funds primarily benefit persons experiencing
homelessness, and HOPWA funds primarily benefit low-and moderate-income persons with HIV/AIDS.
A Request for Proposals from social service agencies and nonprofit organizations seeking grant funding
was published on January 15, 2025. All proposals were received on March 3, 2025. Staff reviewed all
proposals and developed recommendations for the allocation of estimated funding from HUD based on the
capacity of applicant organizations, grant experience, fiscal stability, and compliance with applicable
federal regulations. One public hearing was held on July 14, 2025, to provide citizens with the opportunity
to participate in the development of the Annual Action Ptan. Recommendations for award amounts were
considered and adopted by the Community Development Council on June 11, 2025.
A 30-day public comment period was held from June 16, 2025, through July 16, 2025. Notice of this public
comment period was published in the Cleburne Times Review on June 10, 2025; in the Fort Worth Star
Telegram and Weatherford Democrat on June 11, 2025; and in La Vida News and the Wise County
Messenger on June 12, 2025.
Any comments received are maintained by the Neighborhood Services Department in accordance with
federal regulations. The City held two public hearings as a part of the HUD required citizen participation
process. The first public hearing was held by staff on July 14, 2025, and the second public hearing is
scheduled for the City Council Meeeting on August 12, 2025.
A summary of staffs final funding recommendations is provided below in Tables 1, 2, and 3. The 2025-
2026 Annual Action Ptan will be submitted to HUD by August 15, 2025.
Indirect costs totaling approximately $264,698.00 could be charged to these grants, as the Neighborhood
Services Department indirect cost rate is 21.05\% in the City's most recent Cost Allocation Plan. A waiver
of these costs is requested to allow allocation of these funds to further support the programs and services
to assist low-to-moderate income citizens.
COMMUNITY DEVELOPMENT BLOCK GRANT (CDBG)
For Program Year 2025-2026, it is recommended that the amount of $7,116,438.00 in CDBG funds and an
estimated amount of $30,000.00 in CDBG program income totaling $7,146,438.00 be allocated as follows:
Public Service Agencies -$1,067,465.00 (Limited to 15\% of the grant allocation): Includes social services
for low- and moderate income persons, persons with disabilities, and disadvantaged persons; Housing
Programs -$2,665,000.00: Includes funding for the City's Priority Repair Program, Cowtown Brush-Up, and
accessibility modifications for seniors and persons with disabilities; Major Projects -$1,000,685.00:
Includes funding for street improvements; Program Delivery -$960,000.00: Includes program delivery
costs for housing programs; Administration -$1,423,288.00 (Limited to 20\% of the grant allocation):
Includes costs for administering the CDBG grant; Estimated Program Income -$30,000.00: Includes up to
$30,000.00 in funding for the City's Priority Repair Program. Any CDBG program income over the
estimated amount not used for the Priority Repair Program will be allocated to priority activities in the City's
Consolidated Plan, subject to the City Council approval.
HOME INVESTMENT PARTNERSHIPS PROGRAM (HOME)
For Program Year 2025-2026, it is recommended that the amount of $2,814,431.77 in HOME funds and an
estimated amount of $30,000.00 in HOME program income totaling $2,844,431.77 be allocated as fo►lows:
Homebuyer Assistance Program -$1,110,824.77: Includes funding for down payment and closing cost
assistance for low- and moderate-income homebuyers through the Fort Worth Community Land Trust, the
City of Fort Worth and Trinity Habitat for Humanity; Community Housing Development Organizations
(CHDOs) for affordable housing projects -$422,164.00: These funds will be used by Housing Channel for
the Mason Heights affordable housing development in southeast Fort Worth. Funds will be used for the
acquisition of land and the new construction of 236 units. An estimated 183 units (approximately 771%) will
be sold to low to moderate income households at or below 80\% Area Median Income (AMI); Major
Projects -$1,000,000.00 allocated to Fort Worth Housing Solutions (FWHS) as a part of Phase Six of the
Choice Neighborhood Initiative (CNI) grant benefiting low-moderate come residents in the Stop Six
Neighborhood of Fort Worth; Administration -$281,443.00 (Limited to 10\% of the grant allocation):
Includes costs for administering the HOME grant; Estimated Program Income -$30,000.00: Includes
funding for the Homebuyer Assistance Program and HOME grant administrative costs. HUD allows the City
to use 10 percent of any HOME program income towards the cost of administering the HOME grant.
HOME program income over the estimated amount not used for the Homebuyer Assistance Program will
be allocated to priority activities in the City's Consolidated Plan, subject to City Council approval.
HOUSING OPPORTUNITIES FOR PERSONS WITH AIDS (HOPWA)
For Program Year 2025-2026, it is recommended that the amount of $2,726,668.00 in HOPWA funds be
allocated as follows: Public Service Agencies -$1,670,868.00; Neighborhood Services Department -
$974,000.00; Administration -$81,800.00 (Limited to 3\% of the grant allocation)
EMERGENCY SOLUTIONS GRANT (ESG)
For Program Year 2025-2026, it is recommended that the amount of $615,818.00 in ESG funds to be
allocated as follows: Public Service Agencies -$569,632.00; Administration -$46,186.00 (Limited to 7.5\%
of the grant allocation)
CONTRACT RECOMMENDATIONS
The Community Development Council and Neighborhood Services Department staff recommend that
contracts be executed with the public service and subrecipient agencies listed below for the amounts
shown in the following tables:
Community Development Block Grant Contracts
TABLE 1: CDBG AGENCIES
AGENCY I CONSOLGOAL D PLAN I pROGRAM
Housing Channel IAffordable Housing Housing Counseling &
Education
Meals-On-Wheels, Inc. of Healthy Living and
Tarrant County Wellness
Guardianship Services Inc. Aging In Place
IUnited Community Centers, Inc IChildren and Youth
Services
IBoys & Girls Club of Greater IlChildren and Youth
Tarrant County Services
IGirls Inc of Tarrant County Children and Youth
Services
ICamp Fire First Texas I Children and Youth
Services
IJunior Achievement of the Children and Youth
Chisholm Trail, Inc. Services
IThe Women's Center of Tarrantl Economic Empowerment
County and Financial Resilience
Easter Seals North Texas, Inc. IEconomic Empowerment
and Financial Resilience
Homelessness
Presbyterian Night Shelter Prevention and Special
Needs Support
ICDBG Public Services Agencies Total
Nutrition Program
Money Smart+ Elder
Financial Fraud
Prevention Workshops
IEducation Literacy
Program
IYouth Development at
Eastside Branch
IWhole Girl Program
ITeens In Action
ICradle to Career
Initiative
Employment Solutions
Employment Services
AMOUNT I
�
$111,00O.00I
�
$120,00O.00I
$80,000.00
$125,00O.00I
�
$72,00O.00I
$90,281.00I
�
$62,184.00
$50,000.00
$90,000.00
$92,000.00
Moving Home Program $175,000.00
I$1,067,465.00�
**Rehabilitation, Education and Accessibility
Advocacy for Citizens with Improvements Project Ramp
Handicaps dba REACH, Inc.
$165,000.00
**Fort Worth Area Habitat for Housing Preservation and
Humanity, Inc. DBA Trinity Rehabilitation Cowtown Brush Up $500,000.00
Habitat for Humanity
�CDBG Subrecipient Agencies Total �� $665,000.00�
�TOTAL CDBG CONTRACTS I�$1,732,465.00�
**REACH and Trinity Habitat will be funded from the CDBG Housing Programs and Services budget.
Housing Opportunities for Persons with AIDS Contracts
TABLE 2: HOPWA AGENCIES
AGENCY
Tarrant County
Samaritan Housing,
Inc.
AIDS Outreach
Center, Inc.
CONSOLIDATED PLAN
GOAL
Homelessness Prevention
and Special Needs
Support
Homelessness Prevention
and Special Needs
Support
�TOTAL HOPWA CONTRACTS
Emergency Solutions Grants Contracts
TABLE 3: ESG AGENCIES
AGENCY
The Presbyterian Night
Shelter of Tarrant County,
I nc.
PROGRAM
HOPWA Program -
Administration, Tenant-
Based Rental Assistance
(TBRA), Short-Term
Rent, Mortgage, and
Utility Assistance
(STRMU), Supportive
Services, Facility-Based
Operations (FBO)
The Housing Assistance
Program
- Administration, Tenant-
Based Rental Assistance
(TBRA), Short-Term
Rent, Mortgage, and
Utility Assistance
(STRMU), Supportive
Services
PROGAM
Homelessness Prevention and Shelter
Special Needs Support Operations/Services
Lighthouse for the Homelessness Prevention and Day Shelter
Homeless dba True Worth Special Needs Support Operations/Services
Place
IThe Salvation Army
(Center for Transforming
Lives
�
CONSOLIDATED PLAN II
GOAL
Homelessness Prevention and Homelessness
Special Needs Support Prevention
IlHomelessness Prevention and Rapid Re-Housing
Special Needs Support
�� ��
AMOUNT
$1,406,188.00
$264,680.00
$1,670,868.00�
AMOUNT
$139,491.00
$150,000.00
I $127,141.00I
�
� $73,00O.00I
�
I $80,00O.00I
SafeHaven of Tarrant I Homelessness Prevention and IlShelter
County Special Needs Support Operations/Services
TOTALESG CONTRACTS
All figures have been rounded to the nearest dollar for presentation purposes.
I
��$569,632.00
Each of these grants are an entitlement grant rather than a competitive grant received from the United
States Department of Housing and Urban Development (HUD). Entitlement grants provide funds to
agencies based on a formula prescribed in legislation or regulation, rather than based on review. These
specific grants are allocated to the City of Fort Worth based on population size and per capita income each
year. The grants have been consistently awarded to the City since 1974 with the inception of the
Community Development Block Grant (CDBG) through the Housing and Community Development Act of
1974. The Emergency Shelter (renamed Solutions) Grant (ESG) was authorized in 1987 through the
McKinney-Vento Homelessness Assistance Act. The HOME Investment Partnerships Program (HOME)
and the Housing Opportunities for Persons with AIDS (HOPWA) Program were authorized through the
Cranston-Gonzales National Affordable Housing Act of 1990. With these grants, administrative and
program delivery allocations support approximately 90 FTE positions in the Neighborhood Services
Department, which is funded nearly 60\% with various grants including these entitlement grants.
Positions funded with HUD Entitlement grants are subject to grant availability. In the event of a grant award
being decreased or eliminated, the Neighborhood Services Department would review programs and
services funded by the grants and determine a level of service and staffing that aligns with the available
funding. Alternatives to consider may include staff and program reductions or eliminations.
The City of Fort Worth has certified that all programs receiving funding through the HOPWA, HOME, ESG,
and CDBG grants comply with applicable Executive Orders.
These programs are available in ALL COUNCIL DISTRICTS.
FISCAL INFORMATIONICERTIFICATION:
The Director of Finance certifies that upon approval of the above recommendations and adoption of the
attached appropriation ordinance, funds will be available in the current operating budget, as appropriated,
of the Grants Operating Federal Fund. The Neighborhood Services Department (and Financial
Management Services) will be responsible for the collection and deposit of funds due to the City. Prior to
an expenditure being incurred, the Neighborhood Services Department has the responsibility to validate
the availability of funds. These are reimbursement grants.
TO
IFund Department Account Project
I ID I I ID
FROM
Fund Department Account Project
ID ID
Submitted for Citv Manaqer's Office bv:
Oriqinatinq Department Head:
Additional Information Contact:
Program � Activity
Program � Activity
Budget Reference # I Amount
Year (Chartfield 2)
Budget I Reference # Amount
Year (Chartfield 2)
Dana Burghdoff (8018)
Kacey Bess (8187)
Juliet Moses (6203)
ATTACHMENTS
F�RT��RTHo
City Secretary's Office
Contract Routing & Transmittal Slip
Contractor's Name: HALTOM CITY SENIOR LIVING, L.P. dba PARMORE FOSSIL CREEK
Subject of the Agreement: Amendment to Aggreement beginning February 1, 2026
CSC 63763 A1 TBRA rental assistance for HOPWA client.
M&C Approved by the Council? * Yes ❑✓ No ❑
If �so, the M&C must be attached to the contract.
Is this an Amendment to an Existing contract? Yes ❑✓ No ❑ CSC 63763
If �so, provide the original contract number and the amendment number.
Is the Contract "PermanenY'? *Yes ❑ No 0
If �unsure, see back page for permanent contract listing.
Is this entire contract Confidential? *Yes ❑ No ❑✓ If only specific information is
Confidential, please list what information is Confidential and the page it is located.
Client's name on the first page of contract (pg 3), first page of lease (pg 7)
Effective Date: 2/1 /2026 Expiration Date: 05/31 /2026
If different from the approval date. If applicable.
Is a 1295 Form required? * Yes ❑ No ❑✓
*If �so, please ensure it is attached to the approving M&C or attached to the contract.
Proj ect Number: If applicable.
*Did you include a Text field on the contract to add the City Secretary Contract (CSC)
number? Yes ❑✓ No ❑
Contracts need to be routed for CSO processin� in the followin� order:
1. Katherine Cenicola (Approver)
2. Jannette S. Goodall (Signer)
3. Allison Tidwell (Form Filler)
*Indicates the information is required and if the information is not provided, the contract will be
returned to the department.
Permanent Contracts
Advanced Funding Agreements
Architect Service
Community Facilities
Completion Agreement
Construction Agreement
Credit Agreement/ Impact Fees
Crossing Agreement
Design Procurement
Development Agreement
Drainage Improvements
Economic Development
Engineering Services
Escrow Agreement
Interlocal Agreements
Lake Worth Sale
Maintenance Agreement/Storm Water
Parks/Improvement
Parks/Other Amenities
Parks/Play Equipment
Project Development
Property/Purchase (Property owned by the City)
Property/Sales (Property owned by the City)
Property/Transfers (Property owned by the City)
Public Art
Sanitary Sewer Main Replacements
Sanitary Sewer Rehabilitations
Settlements (Employees Only)
Streets/Maintenance
Streets/Redevelopment
Streets/Repairs
Streets/Traffic Signals
Structural Demolition (City owned properties)
Utility Relocation
Water Reclamation Facility
Water/Emergency Repair
Water/Interceptor
Water/Main Repairs
Water/Main Replacement
Water/Sanitary Sewer Rehabilitation
Water/Sewer Service
Water/Storage Tank